LOCUS       HUMBMYH7CD              6008 bp    mRNA    linear   HUM 06-MAR-1995
DEFINITION  Homo sapiens beta-myosin heavy chain (MYH7) mRNA, complete cds.
ACCESSION   M58018
VERSION     M58018.1
KEYWORDS    beta-myosin heavy chain; cardiac myosin heavy chain.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 6008)
  AUTHORS   Jaenicke,T., Diederich,K.W., Haas,W., Schleich,J., Lichter,P.,
            Pfordt,M., Bach,A. and Vosberg,H.P.
  TITLE     The complete sequence of the human beta-myosin heavy chain gene and
            a comparative analysis of its product
  JOURNAL   Genomics 8 (2), 194-206 (1990)
   PUBMED   2249844
COMMENT     Original source text: Human leukocyte, cDNA to mRNA.
FEATURES             Location/Qualifiers
     source          1..6008
                     /db_xref="H-InvDB:HIT000195856"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /map="14q11.2-q13"
                     /clone="lambda gMHC-1"
                     /clone="lambda gMHC-2"
                     /clone="lambda gMHC-3"
                     /clone="lambda gMHC-4"
                     /cell_type="leukocyte"
                     /tissue_type="blood"
                     /dev_stage="adult"
     gene            1..6008
                     /gene="MYH7"
     CDS             87..5894
                     /gene="MYH7"
                     /codon_start=1
                     /product="beta-myosin heavy chain"
                     /protein_id="AAA62830.1"
                     /db_xref="GI:179510"
                     /db_xref="GDB:G00-120-215"
                     /translation="MGDSEMAVFGAAAPYLRKSEKERLEAQTRPFDLKKDVFVPDDKQ
                     EFVKAKIVSREGGKVTAETEYGKTVTVKEDQVMQQNPPKFDKIEDMAMLTFLHEPAVL
                     YNLKDRYGSWMIYTYSGLFCVTVNPYKWLPVYTPEVVAAYRGKKRSEAPPHIFSISDN
                     AYQYMLTDRENQSILITGESGAGKTVNTKRVIQYFAVIAAIGDRSKKDQSPGKGTLED
                     QIIQANPALEAFGNAKTVRNDNSSRFGKFIRIHFGATGKLASADIETYLLEKSRVIFQ
                     LKAERDYHIFYQILSNKKPELLDMLLITNNPYDYAFISQGETTVASIDDAEELMATDN
                     AFDVLGFTSEEKNSMYKLTGAIMHFGNMKFKLKQREEQAEPDGTEEADKSAYLMGLNS
                     ADLLKGLCHPRVKVGNEYVTKGQNVQQVIYATGALAKAVYERMFNWMVTRINATLETK
                     QPRQYFIGVLDIAGFEIFDFNSFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEW
                     TFIDFGMDLQACIDLIEKPMGIMSILEEECMFPKATDMTFKAKLFDNHLGKSANFQKP
                     RNIKGKPEAHFSLIHYAGIVDYNIIGWLQKNKDPLNETVVGLYQKSSLKLLSTLFANY
                     AGADAPIEKGKGKAKKGSSFQTVSALHRENLNKLMTNLRSTHPHFVRCIIPNETKSPG
                     VMDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFRQRYRILNPAAIPEGQFIDSRK
                     GAEKLLSSLDIDHNQYKFGHTKVFFKAGLLGLLEEMRDERLSRIITRIQAQSRGVLAR
                     MEYKKLLERRDSLLVIQWNIRAFMGVKNWPWMKLYFKIKPLLKSAEREKEMASMKEEF
                     TRLKEALEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNLADAEERCDQLIKNKIQ
                     LEAKVKEMNERLEDEEEMNAELTAKKRKLEDECSELKRDIDDLELTLAKVEKEKHATE
                     NKVKNLTEEMAGLDEIIAKLTKEKKALQEAHQQALDDLQAEEDKVNTLTKAKVKLEQQ
                     VDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKQQLDERLKKKDFELN
                     ALNARIEDEQALGSQLQKKLKELQARIEELEEELESERTARAKVEKLRSDLSRELEEI
                     SERLEEAGGATSVQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSVAELG
                     EQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKMCRTLEDQMNEHRSK
                     AEETQRSVNDLTSQRAKLQTENGELSRQLDEKEALISQLTRGKLTYTQQLEDLKRQLE
                     EEVKAKNALAHALQSARHDCDLLREQYEEETEAKAELQRVLSKANSEVAQWRTKYETD
                     AIQRTEELEEAKKKLAQRLQEAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSN
                     AAAAALDKKQRNFDKILAEWKQKYEESQSELESSQKEARSLSTELFKLKNAYEESLEH
                     LETFKRENKNLQEEISDLTEQLGSSGKTIHELEKVRKQLEAEKMELQSALEEAEASLE
                     HEEGKILRAQLEFNQIKAEIERKLAEKDEEMEQAKRNHLRVVDSLQTSLDAETRSRNE
                     ALRVKKKMEGDLNEMEIQLSHANRMAAEAQKQVKSLQSLLKDTQIQLDDAVRANDDLK
                     ENIAIVERRNNLLQAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQNTSLINQ
                     KKKMDADLSQLQTEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKK
                     NMEQTIKDLQHRLDEAEQIALKGGKKQLQKLEARVRELENELEAEQKRNAESVKGMRK
                     SERRIKELTYQTEEDRKNLLRLQDLVDKLQLKVKAYKRQAEEAEEQANTNLSKFRKVQ
                     HELDEAEERADIAESQVNKLRAKSRDIGTKGLNEE"
BASE COUNT         1612 a         1560 c         1877 g          959 t
ORIGIN      14q.
        1 tgtctttccc tgctgctctc aggtcccctg caggccttgg cccctttcct catctgtaga
       61 cacacttgag tagcccaggc acagccatgg gagattcgga gatggcagtc tttggggctg
      121 ccgcccccta cctgcgcaag tcagagaagg agcggctaga agcgcagacc aggccttttg
      181 acctcaagaa ggatgtcttc gtgcctgatg acaaacagga gtttgtcaag gccaagatcg
      241 tgtctcgaga gggtggcaaa gtcactgccg agactgagta tggcaagaca gtgaccgtga
      301 aggaggacca ggtgatgcag cagaacccac ccaagttcga caaaatcgag gacatggcca
      361 tgctgacctt cctgcatgag cccgcggtgc tctacaacct caaggatcgc tacggctcct
      421 ggatgatcta cacctactcg ggcctcttct gtgtcaccgt caacccttac aagtggctgc
      481 cggtgtacac tcctgaggtg gtggctgcct accggggcaa gaagaggagc gaggccccgc
      541 cccacatctt ctccatctcc gacaacgcct atcagtacat gctgacagac agagaaaacc
      601 agtccatcct gatcaccgga gaatccggag cagggaagac agtcaacacc aagagggtca
      661 tccagtactt tgctgttatt gcagccattg gggaccgcag caagaaggac cagagcccgg
      721 gcaagggcac cctggaggac cagatcatcc aggccaaccc tgctctggag gcctttggca
      781 atgccaagac cgtccggaac gacaactcct cccgcttcgg gaaattcatt cgaattcatt
      841 ttggggcaac aggaaagttg gcatctgcag acatagagac ctatcttctg gaaaaatcca
      901 gagttatttt ccagctgaaa gcagagagag attatcacat tttctaccaa atcctgtcta
      961 acaaaaagcc tgagctgctg gacatgctgc tgatcaccaa caacccctac gattatgcat
     1021 tcatctccca aggagagacc accgtggcct ccattgatga cgctgaggag ctcatggcca
     1081 ctgataacgc ttttgatgtg ctgggcttca cttcagagga gaaaaactcc atgtataagc
     1141 tgacaggcgc catcatgcac tttggaaaca tgaagttcaa gctgaagcag cgggaggagc
     1201 aggcggagcc agacggcact gaagaggctg acaagtctgc ctacctcatg gggctgaact
     1261 cagccgacct gctcaagggg ctgtgccacc ctcgggtgaa agtgggcaat gagtacgtca
     1321 ccaaggggca gaatgtccag caggtgatat atgccactgg ggcactggcc aaggcagtgt
     1381 atgagaggat gttcaactgg atggtgacgc gcatcaatgc caccctggag accaagcagc
     1441 cacgccagta cttcatagga gtcctggaca tcgctggctt cgagatcttc gatttcaaca
     1501 gctttgagca gctctgcatc aacttcacca acgagaagct gcagcagttc ttcaaccacc
     1561 acatgtttgt gctggagcag gaggagtaca agaaggaggg catcgagtgg acattcattg
     1621 actttggcat ggacctgcag gcctgcattg acctcatcga gaagcccatg ggcatcatgt
     1681 ccatcctgga agaggagtgc atgttcccca aggccaccga catgaccttc aaggccaagc
     1741 tgtttgacaa ccacctgggc aaatccgcca acttccagaa gccacgaaat atcaagggga
     1801 agcctgaagc ccacttctcc ctgatccact atgccggcat cgtggactac aacatcattg
     1861 gctggctgca gaagaacaag gatcctctca atgagactgt cgtgggcttg tatcagaagt
     1921 cttccctcaa gttgctcagc accctgtttg ccaactatgc tggggctgat gcgcctattg
     1981 agaagggcaa aggcaaggcc aagaaaggct cgtcctttca gactgtgtca gctctgcaca
     2041 gggaaaatct gaacaagctg atgaccaact tgcgctccac ccatccccac tttgtacgtt
     2101 gtatcatccc taatgagaca aagtctccag gcgtgatgga caaccccctg gtcatgcacc
     2161 agctgcgctg caatggtgtg ctggagggca tccgcatctg caggaaaggc ttccccaacc
     2221 gcatcctcta cggggacttc cggcagaggt atcgcatcct gaacccagcg gccatccctg
     2281 agggacagtt cattgatagc aggaaggggg cagagaagct gctcagctcc ctggacattg
     2341 atcacaacca gtacaagttt ggccacacca aggtgttctt caaggccggg ctgctggggc
     2401 tgctggagga aatgagggac gagaggctga gccgcatcat cacgcgtatc caggcccagt
     2461 cccgaggtgt gctcgccaga atggagtaca aaaagctgct ggaacgtaga gactccctgc
     2521 tggtaatcca gtggaacatt cgggccttca tgggggtcaa gaattggccc tggatgaagc
     2581 tctacttcaa gatcaagccg ctgctgaaga gtgcagaaag agagaaggag atggcctcca
     2641 tgaaggagga gttcacacgc ctcaaagagg cgctagagaa gtccgaggct cgccgcaagg
     2701 agctggagga gaagatggtg tccctgctgc aggagaagaa tgacctgcag ctccaagtgc
     2761 aggcggaaca agacaacctg gcagatgctg aggagcgctg tgatcagctg atcaaaaaca
     2821 agattcagct ggaggctaag gtgaaggaga tgaacgagag gctggaggat gaggaggaga
     2881 tgaatgctga gctcactgcc aagaagcgca agttggaaga tgagtgctca gagctcaaaa
     2941 gggacatcga tgatctggag ctgacactgg ccaaagtgga gaaggagaaa cacgcaacag
     3001 agaacaaggt gaaaaacctg acagaggaga tggctgggct ggatgagatc attgccaagc
     3061 tgaccaagga gaagaaagct ctgcaagagg cccaccaaca ggctctggat gaccttcagg
     3121 ccgaggagga caaggtcaac accctgacta aggccaaagt caagctggag cagcaagtgg
     3181 atgatctgga aggatccctg gagcaagaga agaaggtgcg catggacctg gagcgagcga
     3241 agcggaagct ggagggcgac ctgaagctga cccaggagag catcatggac ctggagaatg
     3301 acaagcagca gctggatgag cggctgaaaa aaaaagactt tgagctgaat gctctcaacg
     3361 caaggattga ggatgaacag gccctcggca gccagctgca gaagaagctc aaggagcttc
     3421 aggcacgcat cgaggagctg gaggaggagc tggagtccga gcgcaccgcc agggctaagg
     3481 tggagaagct gcgctcagac ctgtctcggg agctggagga gatcagcgag cggctggaag
     3541 aggccggcgg ggccacgtcc gtgcagatcg agatgaacaa gaagcgcgag gccgagttcc
     3601 agaagatgcg gcgggacctg gaggaggcca cgctgcagca cgaggccact gccgcggccc
     3661 tgcgcaagaa gcacgccgac agcgtggccg agctgggcga gcagatcgac aacctgcagc
     3721 gggtgaagca gaagctggag aaggagaaga gcgagttcaa gctggagctg gatgacgtca
     3781 cctccaacat ggagcagatc atcaaggcca aggctaacct ggagaagatg tgccggacct
     3841 tggaagacca gatgaatgag caccggagca aggcggagga gacccagcgt tctgtcaacg
     3901 acctcaccag ccagcgggcc aagttgcaaa ccgagaatgg tgagctgtcc cggcagctgg
     3961 atgagaagga ggcactgatc tcccagctga cccgaggcaa gctcacctac acccagcagc
     4021 tggaggacct caagaggcag ctggaggagg aggttaaggc gaagaacgcc ctggcccacg
     4081 cactgcagtc ggcccggcat gactgcgacc tgctgcggga gcagtacgag gaggagacgg
     4141 aggccaaggc cgagctgcag cgcgtccttt ccaaggccaa ctcggaggtg gcccagtgga
     4201 ggaccaagta tgagacggac gccattcagc ggactgagga gctcgaggag gccaagaaga
     4261 agctggccca gcggctgcag gaagctgagg aggccgtgga ggctgttaat gccaagtgct
     4321 cctcgctgga gaagaccaag caccggctac agaatgagat cgaggacttg atggtggacg
     4381 tagagcgctc caatgctgct gctgcagccc tggacaagaa gcagaggaac ttcgacaaga
     4441 tcctggccga gtggaagcag aagtatgagg agtcgcagtc ggagctggag tcctcgcaga
     4501 aggaggctcg ctccctcagc acagagctct tcaaactcaa gaacgcctat gaggagtccc
     4561 tggaacatct ggagaccttc aagcgggaga acaaaaacct gcaggaggag atctccgact
     4621 tgactgagca gttgggttcc agcggaaaga ctatccatga gctggagaag gtccgaaagc
     4681 agctggaggc cgagaagatg gagctgcagt cagccctgga ggaggccgag gcctccctgg
     4741 agcacgagga gggcaagatc ctccgggccc agctggagtt caaccagatc aaggcagaga
     4801 tcgagcggaa gctggcagag aaggacgagg agatggaaca ggccaagcgc aaccacctgc
     4861 gggtggtgga ctcgctgcag acctccctgg acgcagagac acgcagccgc aacgaggccc
     4921 tgagggtgaa gaagaagatg gaaggagacc tcaatgagat ggagatccag ctcagccacg
     4981 ccaaccgcat ggccgccgag gcccagaagc aagtcaagag cctccagagc ttgttgaagg
     5041 acacccagat tcagctggac gatgcagtcc gtgccaacga cgacctgaag gagaacatcg
     5101 ccatcgtgga gcggcgcaac aacctgctgc aggctgagct ggaggagttg cgtgccgtgg
     5161 tggagcagac agagcggtcc cggaagctgg cggagcagga gctgattgag actagtgagc
     5221 gggtgcagct gctgcattcc cagaacacca gcctcatcaa ccagaagaag aagatggatg
     5281 ctgacctgtc ccagctccag actgaagtgg aggaggcagt gcaggagtgc aggaatgctg
     5341 aggagaaggc caagaaggcc atcacggatg ccgccatgat ggcagaggag ctgaagaagg
     5401 agcaggacac cagcgcccac ctggagcgca tgaagaagaa catggaacag accattaagg
     5461 acctgcagca ccggctggac gaagccgagc agatcgccct caagggcggc aagaagcagc
     5521 tgcagaagct ggaagcgcgg gtgcgggagc tggagaatga gctggaggcc gagcagaagc
     5581 gcaacgcaga gtcggtgaag ggcatgagga agagcgagcg gcgcatcaag gagctcacct
     5641 accagacgga ggaggacagg aaaaacctgc tgcggctgca ggacctggta gacaagctgc
     5701 agctaaaggt caaggcctac aagcgccagg ccgaggaggc ggaggagcaa gccaacacca
     5761 acctgtccaa gttccgcaag gtgcagcacg agctggatga ggcagaggag cgggcggaca
     5821 tcgccgagtc ccaggtcaac aagctgcggg ccaagagccg tgacattggc acgaagggct
     5881 tgaatgagga gtagctttgc cacatcttga tctgctcagc cctggaggtg ccagcaaagc
     5941 cccatgctgg agcctgtgta acagctcctt gggaggaagc agaataaagc aattttcctt
     6001 gaagccga
//