LOCUS       HUMAGPRO                7137 bp    mRNA    linear   HUM 06-MAR-1995
DEFINITION  Human large aggregating cartilage proteoglycan core protein mRNA,
            complete cds.
ACCESSION   M55172
VERSION     M55172.1
KEYWORDS    aggrecan; large aggregating cartilage proteoglycan core protein.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 7137)
  AUTHORS   Doege,K.J., Sasaki,M., Kimura,T. and Yamada,Y.
  TITLE     Complete coding sequence and deduced primary structure of the human
            cartilage large aggregating proteoglycan, aggrecan. Human-specific
            repeats, and additional alternatively spliced forms
  JOURNAL   J. Biol. Chem. 266 (2), 894-902 (1991)
   PUBMED   1985970
COMMENT     Original source text: Human juvenile cartilage chondrocyte, cDNA to
            mRNA, clone PSA003-5.
FEATURES             Location/Qualifiers
     source          1..7137
                     /db_xref="H-InvDB:HIT000195772"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="PSA003-5"
                     /cell_type="chondrocyte"
                     /tissue_type="cartilage"
                     /dev_stage="juvenile"
     CDS             61..7011
                     /codon_start=1
                     /product="large aggregating cartilage proteoglycan core
                     protein"
                     /protein_id="AAA62824.1"
                     /db_xref="GI:178259"
                     /translation="MTTLLWVFVTLRVITAAVTVETSDHDNSLSVSIPQPSPLRVLLG
                     TSLTIPCYFIDPMHPVTTAPSTAPLAPRIKWSRVSKEKEVVLLVATEGRVRVNSAYQD
                     KVSLPNYPAIPSDATLEVQSLRSNDSGVYRCEVMHGIEDSEATLEVVVKGIVFHYRAI
                     STRYTLDFDRAQRACLQNSAIIATPEQLQAAYEDGFHQCDAGWLADQTVRYPIHTPRE
                     GCYGDKDEFPGVRTYGIRDTNETYDVYCFAEEMEGEVFYATSPEKFTFQEAANECRRL
                     GARLATTGHVYLAWQAGMDMCSAGWLADRSVRYPISKARPNCGGNLLGVRTVYVHANQ
                     TGYPDPSSRYDAICYTGEDFVDIPENFFGVGGEEDITVQTVTWPDMELPLPRNITEGE
                     ARGSVILTVKPIFEVSPSPLEPEEPFTFAPEIGATAFAEVENETGEATRPWGFPTPGL
                     GPATAFTSEDLVVQVTAVPGQPHLPGGVVFHYRPGPTRYSLTFEEAQQACPGTGAVIA
                     SPEQLQAAYEAGYEQCDAGWLRDQTVRYPIVSPRTPCVGDKDSSPGVRTYGVRPSTET
                     YDVYCFVDRLEGEVFFATRLEQFTFQEALEFCESHNATATTGQLYAAWSRGLDKCYAG
                     WLADGSLRYPIVTPRPACGGDKPGVRTVYLYPNQTGLPDPLSRHHAFCFRGISAVPSP
                     GEEEGGTPTSPSGVEEWIVTQVVPGVAAVPVEEETTAVPSGETTAILEFTTEPENQTE
                     WEPAYTPVGTSPLPGILPTWPPTGAETEESTEGPSATEVPSASEEPSPSEVPFPSEEP
                     SPSEEPFPSVRPFPSVELFPSEEPFPSKEPSPSEEPSASEEPYTPSPPEPSWTELPSS
                     GEESGAPDVSGDFTGSGDVSGHLDFSGQLSGDRASGLPSGDLDSSGLTSTVGSGLTVE
                     SGLPSGDEERIEWPSTPTVGELPSGAEILEGSASGVGDLSGLPSGEVLETSASGVGDL
                     SGLPSGEVLETTAPGVEDISGLPSGEVLETTAPGVEDISGLPSGEVLETTAPGVEDIS
                     GLPSGEVLETTAPGVEDISGLPSGEVLETTAPGVEDISGLPSGEVLETAAPGVEDISG
                     LPSGEVLETAAPGVEDISGLPSGEVLETAAPGVEDISGLPSGEVLETAAPGVEDISGL
                     PSGEVLETAAPGVEDISGLPSGEVLETAAPGVEDISGLPSGEVLETAAPGVEDISGLP
                     SGEVLETAAPGVEDISGLPSGEVLETAAPGVEDISGLPSGEVLETAAPGVEDISGLPS
                     GEVLETAAPGVEDISGLPSGEVLETTAPGVEEISGLPSGEVLETTAPGVDEISGLPSG
                     EVLETTAPGVEEISGLPSGEVLETSTSAVGDLSGLPSGGEVLEISVSGVEDISGLPSG
                     EVVETSASGIEDVSELPSGEGLETSASGVEDLSRLPSGEEVLEISASGFGDLSGVPSG
                     GEGLETSASEVGTDLSGLPSGREGLETSASGAEDLSGLPSGKEDLVGSASGDLDLGKL
                     PSGTLGSGQAPETSGLPSGFSGEYSGVDLGSGPPSGLPDFSGLPSGFPTVSLVDSTLV
                     EVVTASTASELEGRGTIGISGAGEISGLPSSELDISGRASGLPSGTELSGQASGSPDV
                     SGEIPGLFGVSGQPSGFPDTSGETSGVTELSGLSSGQPGVSGEASGVLYGTSQPFGIT
                     DLSGETSGVPDLSGQPSGLPGFSGATSGVPDLVSGTTSGSGESSGITFVDTSLVEVAP
                     TTFKEEEGLGSVELSGLPSGEADLSGKSGMVDVSGQFSGTVDSSGFTSQTPEFSGLPS
                     GIAEVSGESSRAEIGSSLPSGAYYGSGTPSSFPTVSLVDRTLVESVTQAPTAQEAGEG
                     PSGILELSGAHSGAPDMSGEHSGFLDLSGLQSGLIEPSGEPPGTPYFSGDFASTTNVS
                     GESSVAMGTSGEASGLPEVTLITSEFVEGVTEPTISQELGQRPPVTHTPQLFESSGKV
                     STAGDISGATPVLPGSGVEVSSVPESSSETSAYPEAGFGASAAPEASREDSGSPDLSE
                     TTSAFHEANLERSSGLGVSGSTLTFQEGEASAAPEVSGESTTTSDVGTEAPGLPSATP
                     TASGDRTEISGDLSGHTSQLGVVISTSIPESEWTQQTQRPAETHLEIESSSLLYSGEE
                     THTVETATSPTDASIPASPEWKRESESTAADQEVCEEGWNKYQGHCYRHFPDRETWVD
                     AERRCREQQSHLSSIVTPEEQEFVNNNAQDYQWIGLNDRTIEGDFRWSDGHPMQFENW
                     RPNQPDNFFAAGEDCVVMIWHEKGEWNDVPCNYHLPFTCKKGTATTYKRRLQKRSSRH
                     PRRSRPSTAH"
BASE COUNT         1567 a         2010 c         2078 g         1482 t
ORIGIN      
        1 cggccaggtg tgtgggactg aagttcttgg agaagggagt ccaactcttc aaggtgaact
       61 atgaccactt tactctgggt tttcgtgact ctgagggtca tcactgcagc tgtcactgta
      121 gaaacttcag accatgacaa ctcgctgagt gtcagcatcc cccaaccgtc cccgctgagg
      181 gtcctcctgg ggacctccct caccatcccc tgctatttca tcgaccccat gcaccctgtg
      241 accaccgccc cttctaccgc cccactggcc ccaagaatca agtggagccg tgtgtccaag
      301 gagaaggagg tagtgctgct ggtggccact gaagggcgcg tgcgggtcaa cagtgcctat
      361 caggacaagg tctcactgcc caactacccg gccatcccca gtgacgccac cttggaagtc
      421 cagagcctgc gctccaatga ctctggggtc taccgctgcg aggtgatgca tggcatcgag
      481 gacagcgagg ccaccctgga agtcgtggtg aaaggcatcg tgttccatta cagagccatc
      541 tctacacgct acaccctcga ctttgacagg gcgcagcggg cctgcctgca gaacagtgcc
      601 atcattgcca cgcctgagca gctgcaggcc gcctacgaag acggcttcca ccagtgtgac
      661 gccggctggc tggctgacca gactgtcaga taccccatcc acactccccg ggaaggctgc
      721 tatggagaca aggatgagtt tcctggtgtg aggacgtatg gcatccgaga caccaacgag
      781 acctatgatg tgtactgctt cgccgaggag atggagggtg aggtctttta tgcaacatct
      841 ccagagaagt tcaccttcca ggaagcagcc aatgagtgcc ggcggctggg tgcccggctg
      901 gccaccacgg gccacgtcta cctggcctgg caggctggca tggacatgtg cagcgccggc
      961 tggctggccg accgcagcgt gcgctacccc atctccaagg cccggcccaa ctgcggtggc
     1021 aacctcctgg gcgtgaggac cgtctacgtg catgccaacc agacgggcta ccccgacccc
     1081 tcatcccgct acgacgccat ctgctacaca ggtgaagact ttgtggacat cccagaaaac
     1141 ttctttggag tggggggtga ggaggacatc accgtccaga cagtgacctg gcctgacatg
     1201 gagctgccac tgcctcgaaa catcactgag ggtgaagccc gaggcagcgt gatccttacc
     1261 gtaaagccca tcttcgaggt ctcccccagt cccctggaac ccgaggagcc cttcacgttt
     1321 gcccctgaaa taggggccac tgccttcgct gaggttgaga atgagactgg agaggccacc
     1381 aggccctggg gctttcccac acctggcctg ggccctgcca cggcattcac cagtgaggac
     1441 ctcgtcgtgc aggtgaccgc tgtccctggg cagccgcatt tgccaggggg ggtcgtcttc
     1501 cactaccgcc cgggacccac ccgctactcg ctgacctttg aggaggcaca gcaggcctgc
     1561 cctggcacgg gggcggtcat tgcctcgccg gagcagctcc aggccgccta cgaagcaggc
     1621 tatgagcagt gtgacgccgg ctggctgcgg gaccagaccg tcagataccc cattgtgagc
     1681 ccacggaccc catgcgtggg tgacaaggac agcagcccag gggtcaggac ctatggcgtg
     1741 cgcccatcaa cagagaccta cgatgtctac tgctttgtag acagacttga gggggaggtg
     1801 ttcttcgcca cacgccttga gcagttcacc ttccaggaag cactggagtt ctgtgaatct
     1861 cacaatgcca ctgccaccac gggccagctc tacgccgcct ggagccgcgg cctggacaag
     1921 tgctatgccg gctggctggc cgacggcagc ctccgctacc ccatcgtcac cccaaggcct
     1981 gcctgcggtg gggacaagcc aggcgtgaga acggtctacc tctaccctaa ccagacgggc
     2041 ctcccagacc cactgtcccg gcaccatgcc ttctgcttcc gaggcatttc agcggttcct
     2101 tctccaggag aagaagaggg tggcacaccc acatcaccct ctggtgtgga ggagtggatc
     2161 gtgacccaag tggttcctgg tgtggctgct gtccccgtag aagaggagac aactgctgta
     2221 ccctcagggg agactactgc catcctagag ttcaccaccg agccagaaaa ccagacagaa
     2281 tgggaaccag cctatacccc agtgggcaca tccccgctgc cagggatcct tcctacttgg
     2341 cctcctactg gcgccgaaac agaggaaagt acagaaggcc cttctgcaac tgaagtgccc
     2401 tctgcctcag aggaaccatc cccctcagag gtgccattcc cctcagagga gccatccccc
     2461 tcagaggaac cattcccctc agtgaggcca ttcccctcag tggagctgtt cccctcagag
     2521 gagccattcc cctccaagga gccatccccc tcagaggaac catcagcctc agaagagccg
     2581 tatacacctt caccccccga gcccagctgg actgagctgc ccagctctgg ggaggaatct
     2641 ggggcccctg atgtcagtgg tgacttcaca ggcagtggag atgtttcagg acaccttgac
     2701 ttcagtgggc agctgtcagg ggacagggca agtggactgc cctctggaga cctggactcc
     2761 agtggtctta cttccacagt gggctcaggc ctgactgtgg aaagtggact accctcaggg
     2821 gatgaagaga gaattgagtg gcccagcact cctacggttg gtgaactgcc ctctggagct
     2881 gagatcctag agggctctgc ctctggagtt ggggatctca gtggacttcc ttctggagaa
     2941 gttctagaga cctctgcctc tggagtagga gacctcagtg ggcttccttc tggagaagtt
     3001 ctagagacca ctgcccctgg agtagaggac atcagcgggc ttccttctgg agaagttcta
     3061 gagaccactg cccctggagt agaggacatc agcgggcttc cttctggaga agttctagag
     3121 accactgccc ctggagtaga ggacatcagc gggcttcctt ctggagaagt tctagagacc
     3181 actgcccctg gagtagagga catcagcggg cttccttctg gagaagttct agagaccact
     3241 gcccctggag tagaggacat cagcgggctt ccttctggag aagttctaga gaccgctgcc
     3301 cctggagtag aggacatcag cgggcttcct tctggagaag ttctagagac cgctgcccct
     3361 ggagtagagg acatcagcgg gcttccttct ggagaagttc tagagaccgc tgcccctgga
     3421 gtagaggaca tcagcgggct tccttctgga gaagttctag agaccgctgc ccctggagta
     3481 gaggacatca gcgggcttcc ttctggagaa gttctagaga ccgctgcccc tggagtagag
     3541 gacatcagcg ggcttccttc tggagaagtt ctagagaccg ctgcccctgg agtagaggac
     3601 atcagcgggc ttccttctgg agaagttcta gagaccgctg cccctggagt agaggacatc
     3661 agcgggcttc cttctggaga agttctagag actgctgccc ctggagtaga ggacatcagc
     3721 gggcttcctt ctggagaagt tctagagact gctgcccctg gagtagagga catcagcggg
     3781 cttccttctg gagaagttct agagactgct gcccctggag tagaggacat cagcgggctt
     3841 ccttctggag aagttctaga gactgctgcc cctggagtag aggacatcag cgggcttcct
     3901 tctggagaag ttctagagac tactgcccct ggagtagagg agatcagcgg gcttccttct
     3961 ggagaagttc tagagactac tgcccctgga gtagatgaga tcagtgggct tccttctgga
     4021 gaagttctag agactactgc ccctggagta gaggagatca gcgggcttcc ttctggagaa
     4081 gttctagaga cttctacctc tgcggtaggg gacctcagtg gacttccttc tggaggagaa
     4141 gttctagaga tttctgtctc tggagtagag gacatcagtg ggcttccttc tggagaggtt
     4201 gtagagactt ctgcctctgg aatagaggat gtcagtgaac ttccttcagg agaaggtcta
     4261 gagacctctg cttctggagt agaggacctc agcaggctcc cttctggaga agaagttcta
     4321 gagatttctg cctctggatt tggggacctc agtggagttc cttctggagg agaaggtcta
     4381 gagacctctg cttctgaagt agggactgac ctcagtgggc ttccttctgg aagggagggt
     4441 ctagagactt cagcttctgg agctgaggac ctcagtgggt tgccttctgg aaaagaagac
     4501 ttggtggggt cagcttctgg agacttggac ttgggcaaac tgccttctgg aactctagga
     4561 agtgggcaag ctccagaaac aagtggtctt ccctctggat ttagtggtga gtattctggg
     4621 gtggaccttg gaagtggccc accctctggc ctgcctgact ttagtggact tccatctgga
     4681 ttcccaactg tttccctagt ggattctaca ttggtggaag tggtcacagc ctccactgca
     4741 agtgaactgg aagggagggg aaccattggc atcagtggtg caggagaaat atctggactg
     4801 ccctccagtg agctggacat tagtgggaga gctagtggac tcccttcagg aactgaactc
     4861 agtggccaag catctgggtc tcctgatgtc agtggggaaa tacctggact ctttggtgtc
     4921 agtggacagc catcagggtt tcctgacact agtggggaaa catctggagt gactgagctt
     4981 agcgggctgt cctctggaca accaggtgtt agtggagaag catctggagt tctttatggc
     5041 actagtcaac cctttggcat aactgatctg agtggagaaa catctggggt ccctgatctc
     5101 agtgggcagc cttcagggtt accagggttc agtggggcaa catcaggagt ccctgacctg
     5161 gtttctggta ccacgagtgg cagcggtgaa tcttctggga ttacatttgt ggacaccagt
     5221 ttggttgaag tggcccctac tacatttaaa gaagaagaag gcttagggtc tgtggaactc
     5281 agtggcctcc cttccggaga ggcagatctg tcaggcaaat ctgggatggt ggatgtcagt
     5341 ggacagtttt ctggaacagt cgattccagt gggtttacat cccagactcc ggaattcagt
     5401 ggcctaccaa gtggcatagc tgaggtcagt ggagaatcct ccagagctga gattgggagc
     5461 agcctgccct cgggagcata ttatggcagt ggaactccat ctagtttccc cacggtctct
     5521 cttgtagaca gaactttggt ggaatctgta acccaggctc caacagccca agaggcagga
     5581 gaagggcctt ctggcatttt agaactcagt ggtgctcatt ctggagcacc agacatgtct
     5641 ggggagcatt ctggatttct ggacctaagt gggctgcagt ccgggctgat agagcccagc
     5701 ggagagccac caggtactcc atattttagt ggggattttg ccagcaccac caatgtaagt
     5761 ggagaatcct ctgtagccat gggcaccagt ggagaggcct caggacttcc agaagttact
     5821 ttaatcactt ctgagttcgt ggagggtgtt actgaaccaa ctatttctca ggaactaggc
     5881 caaaggcccc ctgtgacaca cacaccccag ctttttgagt ccagtggaaa agtctccaca
     5941 gctggggaca ttagtggagc taccccagtg ctccctgggt ctggagtaga agtatcatca
     6001 gtcccagaat ctagcagtga gacgtccgcc tatcctgaag ctgggttcgg ggcatctgcc
     6061 gcccctgagg ccagcagaga agattctggg tcccctgatc tgagtgaaac cacctctgca
     6121 ttccacgaag ctaaccttga gagatcctct ggcctaggag tgagcggcag cactttgaca
     6181 tttcaagaag gcgaggcgtc cgctgcccca gaagtgagtg gagaatccac caccaccagt
     6241 gatgtgggga cagaggcacc aggcttgcct tcagccactc ccacggcttc tggagacagg
     6301 actgaaatca gcggagacct gtctggtcac acctcgcagc tgggcgttgt catcagcacc
     6361 agcatcccag agtctgagtg gacccagcag acccagcgcc ctgcagagac gcatctagaa
     6421 attgagtcct caagcctcct gtactcagga gaagagactc acacagtcga aacagccacc
     6481 tccccaacag atgcttccat cccagcttct ccggaatgga aacgtgaatc agaatcaact
     6541 gctgcagacc aggaggtatg tgaggagggc tggaacaagt accagggcca ctgttaccgc
     6601 cacttcccgg accgcgagac ctgggtggat gctgagcgcc ggtgtcggga gcagcagtca
     6661 cacctgagca gcatcgtcac ccccgaggag caggagtttg tcaacaacaa tgcccaagac
     6721 taccagtgga tcggcctgaa cgacaggacc atcgaagggg acttccgctg gtcagatgga
     6781 caccccatgc aatttgagaa ctggcgcccc aaccagcctg acaacttttt tgccgctgga
     6841 gaggactgtg tggtgatgat ctggcacgag aagggcgagt ggaatgatgt tccctgcaat
     6901 taccacctcc ccttcacgtg taaaaagggc acagccacca cctacaaacg cagactacag
     6961 aagcggagct cacggcaccc tcggaggagc cgccccagca cagcccactg agaagagctt
     7021 ccaggacgca cccaggacgc tgagcccagg agcctgccag gctgacgtgc atcccaccca
     7081 gacggtgtcc tcttcttgtc gctttttgtc atataaggaa tcccattaaa aaaaaaa
//