LOCUS       HUMCBF                  3216 bp    mRNA    linear   HUM 31-OCT-1994
DEFINITION  Human CCAAT-box-binding factor (CBF) mRNA, complete cds.
ACCESSION   M37197
VERSION     M37197.1
KEYWORDS    CCAAT-box-binding factor; transcription factor.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 3216)
  AUTHORS   Lum,L.S., Sultzman,L.A., Kaufman,R.J., Linzer,D.I. and Wu,B.J.
  TITLE     A cloned human CCAAT-box-binding factor stimulates transcription
            from the human hsp70 promoter
  JOURNAL   Mol. Cell. Biol. 10 (12), 6709-6717 (1990)
   PUBMED   2247079
COMMENT     Original source text: Human W138 and U2-OS cell lines, cDNA to
            mRNA.
            Draft entry and computer-readable sequence for [Unpublished (1990)]
            kindly submitted
            by B.Wu, 01-AUG-1990.
               Author address:  B.Wu
               Dept. of  Biochemistry
               Northwestern University
               2153 Sheridan Rd.
               Evanston, IL 60208.
FEATURES             Location/Qualifiers
     source          1..3216
                     /db_xref="H-InvDB:HIT000195711"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /map="Unassigned"
                     /cell_line="W38 and U2-OS"
                     /tissue_lib="lambda-gt11 and lambda-ZAP"
     gene            1..3216
                     /gene="CBF"
     mRNA            1..3216
                     /gene="CBF"
                     /product="CCAAT-box-binding factor"
     gene            12..3008
                     /gene="CEBP"
     CDS             12..3008
                     /gene="CEBP"
                     /codon_start=1
                     /product="CCAAT-box-binding factor"
                     /protein_id="AAA51924.1"
                     /db_xref="GI:179969"
                     /db_xref="GDB:G00-128-839"
                     /translation="MAAVKEPLEFHAKRPWRPEEAVEDPDEEDEDNTSEAENGFSLEE
                     VLRLGGTKQDYLMLATLDENEEVIDGGKKGAIDDLQQGELEAFIQNLNLAKYTKASLI
                     EEDEPAEKENSSKKEVKIPKINNKNTAESQRTSVNKVKNKNRPEPHSDENGSTTPKVK
                     KDKQNIFEFFERQTLLLRPGGKWYDLEYSNEYSLKPQPQDVVSKYKTLAQKLYQHEIN
                     LFKSKTNSQKGASSTWMKAIVSSGTLGDRMAAMILLIQDDAVHTLQFVETLVNLVKKK
                     GSKQQCLMALDTFKELLITDLLPDNRKLRIFSQRPFDKLEQLSSGNKDSRDRRLILWY
                     FEHQLKHLVAEFVQVLETLSHDTLVTTKTRALTVAHELLCNKPEEEKALLVQVVNKLG
                     DPQNRIATKASHLLETLLCKHPNMKGVVSGEVERLLFRSNISSKAQYYAICFLNQMAL
                     SHEESELANKLITVYFCFFRTCVKKKDVESKMLSALLTGVNRAYPYSQTGDDKVREQI
                     DTLFKVLHIVNFNTSVQALMLLFQVMNSQQTISDRYYTALYRKMLDPGLMTCSKQAMF
                     LNLVYKSLKADIVLRRVKAFVKGLLQVTCQQMPPFICGALYLVSEILKAKPGLRSQLD
                     DHPESDDEENFIDANDDEDMEKFTDADKETEIVKKLETEETVPETDVETKKPEVASWV
                     HFDNLKGGKQLNKYDPFSRNPLFCGAENTSLWELKKLSVHFHPSVALFAKTILQGNYI
                     QYSGDPLQDFTLMRFLDRFVYRNPKPHKGKENTDSVVMQPKRKHFIKDIRHLPVNSKE
                     FLAKEESQIPVDEVFFHRYYKKVAVKEKQKRDADEESIEDVDDEEFEELIDTFEDDNC
                     FSSGKDDMDFAGNVKKRTKGAKDNTLDEDSEGSDDELGNLDDDEVSLGSMDDEEFAEV
                     DEDGGTFMDVLDDESESVPELEVHSKVSTKKSKRKGTDDFDFAGSFQGPRKKKRNLND
                     SSLFVSAEEFGHLLDENMGSKFDNIA"
BASE COUNT         1123 a          539 c          722 g          832 t
ORIGIN      
        1 gctttgccgc catggccgca gtcaaggagc ctttggagtt ccatgccaag cggccttggc
       61 gccccgagga ggcagtagaa gatccggacg aggaggatga ggataatact agtgaagccg
      121 agaatgggtt ctccctggag gaagtgttac ggctcggagg caccaagcaa gattacctta
      181 tgctggctac tttggatgag aatgaggaag tgatagatgg aggcaaaaaa ggagcaatcg
      241 atgaccttca gcaaggtgaa ttggaagcat ttattcaaaa tcttaatttg gcgaagtata
      301 caaaagcttc cttaattgaa gaagatgaac cagctgaaaa agaaaattcc agcaaaaaag
      361 aagtaaaaat acctaaaata aataataaaa atacagcaga aagtcaaagg acatcagtta
      421 ataaggtgaa aaataagaat aggccagaac cacattctga tgagaatggc agtaccacac
      481 cgaaagtaaa gaaagataaa cagaacatct ttgaattttt tgagagacag actttgttac
      541 ttaggcctgg aggcaaatgg tatgatctgg agtacagcaa tgaatattct ttgaaacccc
      601 agcctcagga tgttgtatct aagtacaaaa cccttgctca gaagctgtat cagcatgaaa
      661 tcaacttatt caaaagtaag acgaatagtc aaaagggagc ctcttctacc tggatgaagg
      721 caattgtgtc atcggggaca ctaggtgaca ggatggcagc catgattctt cttattcagg
      781 atgatgccgt tcacacactt cagtttgtag aaactcttgt gaaccttgtt aaaaagaagg
      841 gcagcaaaca gcagtgcctt atggccttgg atactttcaa agagttgctt atcacagacc
      901 ttttgccaga caatcggaag ctgaggattt tcagccagcg tccttttgac aaactggaac
      961 agttgtccag tggcaacaag gactcaagag atagaagact gatattatgg tattttgaac
     1021 accagctgaa acacttagtg gctgaatttg tgcaggtctt agaaacttta agtcatgata
     1081 cattagtaac cactaaaact cgagccctta ccgtggctca tgagctgctt tgtaacaagc
     1141 ctgaggaaga aaaggctctt cttgtgcaag tggtaaataa actgggagat cctcagaaca
     1201 gaattgccac aaaagcatcc catctgttag agacattact ttgtaaacat cccaatatga
     1261 aaggagttgt gtctggtgaa gtagaaaggc tactcttccg ctcaaatatc agctccaaag
     1321 ctcaatatta tgcaatttgc tttttaaatc aaatggctct gtcccatgaa gaaagtgaat
     1381 tggctaacaa attaataact gtttactttt gcttttttcg gacttgtgtc aaaaaaaaag
     1441 atgttgaatc aaaaatgctt agcgcccttt taacaggtgt gaatagggca tacccttatt
     1501 cccagactgg tgatgacaaa gtaagggagc agattgacac actgtttaaa gtgttgcata
     1561 ttgtgaattt taataccagt gtccaggctt taatgttgct tttccaagta atgaattctc
     1621 agcagacaat atcggatcga tattacacag cattatacag gaagatgttg gatccagggt
     1681 tgatgacgtg ttccaagcaa gctatgtttc ttaaccttgt ctacaaatct ctgaaagctg
     1741 acattgtgtt gcgccgggtg aaggcttttg tgaaggggtt acttcaagtt acttgtcaac
     1801 agatgccacc atttatatgt ggagctttat atcttgtgtc tgagatcctt aaagcaaaac
     1861 caggtttaag aagccaacta gatgatcatc cggagtctga tgatgaagaa aattttattg
     1921 atgcaaatga tgatgaagac atggaaaaat tcactgatgc agacaaagaa acagagatag
     1981 tgaaaaaact tgagacagag gaaacagttc ctgaaactga tgtagaaacc aaaaaaccag
     2041 aggttgcttc ctgggtgcac tttgataatt tgaaaggtgg gaaacagtta aataaatacg
     2101 atccattcag tagaaaccct ctgttctgtg gagctgaaaa tacaagtctt tgggaactca
     2161 aaaagttatc tgtgcatttt catccctccg tggccctttt tgcaaagacc atccttcagg
     2221 gaaactatat tcagtattca ggggacccac tgcaggattt cactctaatg agatttttgg
     2281 atcgatttgt ataccgaaat ccaaagcccc ataaaggcaa agaaaacaca gatagtgttg
     2341 tgatgcagcc gaaaagaaaa cattttatta aggatattcg tcatcttcct gtgaacagta
     2401 aggagttcct tgcaaaagaa gaaagccaaa taccagtgga tgaagtgttt ttccacaggt
     2461 attataaaaa agttgctgtt aaagagaaac aaaaacggga tgcagatgaa gaaagtatag
     2521 aagacgtgga tgatgaagaa tttgaagagc tgattgacac atttgaagat gataactgtt
     2581 tcagctctgg aaaggatgat atggattttg ctggaaacgt gaaaaagaga acaaaaggag
     2641 ctaaggataa cacattagat gaagattcag aaggtagtga tgatgaactt ggtaacctgg
     2701 atgacgatga agtttcttta ggaagtatgg atgatgaaga atttgctgaa gttgatgaag
     2761 atggaggaac attcatggat gtgttagatg atgaaagtga gagcgttcca gaacttgaag
     2821 tccactccaa agtcagtact aagaaaagca agagaaaagg tacagatgat tttgactttg
     2881 ctggctcatt tcaagggcca agaaaaaaga aaagaaactt aaatgattcc agcctatttg
     2941 tatctgctga agagtttggc catctattgg atgaaaatat gggatccaag tttgataaca
     3001 ttgcatgaat gccatggcta acaaagataa tgcaagtctc aaacagctta gatgggaggc
     3061 tgaacgtgat gactggctac acaacagaga tgcaaaaagt atcatcaaga aaaagaaaca
     3121 ttttaaaaag aagaggatta aaaccactca aaaaactaaa aaacaaagga aatgagttat
     3181 taatgtaaat tatagattaa aattctactt acatct
//