LOCUS       EMEGPDAA                3193 bp    DNA     linear   PLN 27-APR-1993
DEFINITION  A.nidulans glyceraldehyde-3-phosphate dehydrogenase (gpdA) mRNA,
            exons 1-7.
ACCESSION   M33539
VERSION     M33539.1
KEYWORDS    glyceraldehyde-3-phosphate dehydrogenase.
SOURCE      Aspergillus nidulans
  ORGANISM  Aspergillus nidulans
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Eurotiomycetes; Eurotiomycetidae; Eurotiales; Aspergillaceae;
            Aspergillus.
REFERENCE   1  (bases 1 to 3193)
  AUTHORS   Punt,P.J., Dingemanse,M.A., Kuyvenhoven,A., Soede,R.D.,
            Pouwels,P.H. and van den Hondel,C.A.
  TITLE     Functional elements in the promoter region of the Aspergillus
            nidulans gpdA gene encoding glyceraldehyde-3-phosphate
            dehydrogenase
  JOURNAL   Gene 93 (1), 101-109 (1990)
   PUBMED   2121607
COMMENT     Original source text: A.nidulans (strain FGSC4), cDNA to mRNA,
            clone pAN5-22.
            Draft entry and computer-readable sequence for [Gene (1990) In
            press] kindly submitted
            by P.J.Punt, 04-APR-1990.
FEATURES             Location/Qualifiers
     source          1..3193
                     /organism="Aspergillus nidulans"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:162425"
                     /note="teleomorph: Emericella nidulans"
     prim_transcript 1148..2924
                     /note="gpdA mRNA and introns"
     intron          1196..1311
                     /note="gpdA intron A"
     CDS             join(1320..1331,1396..1431,1488..1501,1611..1674,
                     1733..2417,2472..2642,2694..2722)
                     /note="glyceraldehyde-3-phosphate dehydrogenase (gpdA)"
                     /codon_start=1
                     /protein_id="AAA33308.1"
                     /translation="MAPKVGINGFGRIGRIVFRNAIEAGTVDVVAVNDPFIETHYAAY
                     MLKYDSQHGQFKGTIETYDEGLIVNGKKIRFHTERDPANIPWGQDGAEYIVESTGVFT
                     TQEKASAHLKGGAKKVVISAPSADAPMFVMGVNNETYKKDIQVLSNASCTTNCLAPLA
                     KVINDNFGIIEGLMTTVHSYTATQKVVDGPSAKDWRGGRTAATNIIPSSTGAAKAVGK
                     VIPSLNGKLTGMAMRVPTSNVSVVDLTVRTEKAVTYDQIKDAVKKASENELKGILGYT
                     EDDIVSTDLNGDTRSSIFDAKAGIALNSNFIKLVSWYDNEWGYSRRVVDLITYISKVD
                     AQ"
     exon            <1320..1331
                     /note="glyceraldehyde-3-phosphate dehydrogenase (gpdA)"
                     /number=1
     intron          1332..1395
                     /note="gpdA intron B"
     exon            1396..1431
                     /note="glyceraldehyde-3-phosphate dehydrogenase"
                     /number=2
     intron          1432..1487
                     /note="gpdA intron C"
     exon            1488..1501
                     /note="glyceraldehyde-3-phosphate dehydrogenase"
                     /number=3
     intron          1502..1610
                     /note="gpdA intron D"
     exon            1611..1674
                     /note="glyceraldehyde-3-phosphate dehydrogenase"
                     /number=4
     intron          1675..1732
                     /note="gpdA intron E"
     exon            1733..2417
                     /note="glyceraldehyde-3-phosphate dehydrogenase"
                     /number=5
     intron          2418..2471
                     /note="gpdA intron F"
     exon            2472..2642
                     /note="glyceraldehyde-3-phosphate dehydrogenase"
                     /number=6
     intron          2643..2693
                     /note="gpdA intron G"
     exon            2694..>2722
                     /note="glyceraldehyde-3-phosphate dehydrogenase"
                     /number=7
BASE COUNT          753 a          883 c          744 g          813 t
ORIGIN      
        1 ccacaaagtc agagcgctaa ccaaaagtca cacaacacaa gctgtaagga tttcggcacg
       61 gctacggaag acggagaagc caccttcagt ggactcgagt accatttaat tctatttgtg
      121 tttgatcgag acctaataca gcccctacaa cgaccatcaa agtcgtatag ctaccagtga
      181 ggaagtggac tcaaatcgac ttcagcaaca tctcctggat aaactttaag cctaaactat
      241 acagaataag ataggtggag agcttatacc gagctcccaa atctgtccag atcatggttg
      301 accggtgcct ggatcttcct atagaatcat ccttattcgt tgacctagct gattctggag
      361 tgacccagag ggtcatgact tgagcctaaa atccgccgcc tccaccattt gtagaaaaat
      421 gtgacgaact cgtgagctct gtacagtgac cggtgactct ttctggcatg cggagagacg
      481 gacggacgca gagagaaggg ctgagtaata agccactggc cagacagctc tggcggctct
      541 gaggtgcagt ggatgattat taatccggga ccggccgccc ctccgccccg aagtggaaag
      601 gctggtgtgc ccctcgttga ccaagaatct attgcatcat cggagaatat ggagcttcat
      661 cgaatcaccg gcagtaagcg aaggagaatg tgaagccagg ggtgtatagc cgtcggcgaa
      721 atagcatgcc attaacctag gtacagaagt ccaattgctt ccgatctggt aaaagattca
      781 cgagatagta ccttctccga agtaggtaga gcgagtaccc ggcgcgtaag ctccctaatt
      841 ggcccatccg gcatctgtag ggcgtccaaa tatcgtgcct ctcctgcttt gcccggtgta
      901 tgaaaccgga aaggccgctc aggagctggc cagcggcgca gaccgggaac acaagctggc
      961 agtcgaccca tccggtgctc tgcactcgac ctgctgaggt ccctcagtcc ctggtaggca
     1021 gctttgcccc gtctgtccgc ccggtgtgtc ggcggggttg acaaggtcgt tgcgtcagtc
     1081 caacatttgt tgccatattt tcctgctctc cccaccagct gctcttttct tttctctttc
     1141 ttttcccatc ttcagtatat tcatcttccc atccaagaac ctttatttcc cctaagtaag
     1201 tactttgcta catccatact ccatccttcc catcccttat tcctttgaac ctttcagttc
     1261 gagctttccc acttcatcgc agcttgacta acagctaccc cgcttgagca gacatcacaa
     1321 tggctcccaa ggtacgacat ttagatgaac gggcttttac cacaaggtca attttactga
     1381 acttgttgct tccaggtcgg aatcaacggc ttcggtcgta ttggacgcat cgtgagttct
     1441 gctttgcccc caattccggc ctatctccta tctaacactg cctccaggtt ttccgtaacg
     1501 cgtgagtgtc acccaccata ttcaacagct atagcctata ttgctgggtg tttagctcgt
     1561 tgaatcgcga attttctcgt gtgaatatag gattctaaca atttttctag catcgaggcg
     1621 ggtaccgtcg atgttgttgc cgtcaacgac cctttcatcg agacccacta cgctgtatgc
     1681 tacttcgaat tctagggagc taattatgtt tagctaacgt cgtgtgatgt aggcctacat
     1741 gctcaagtat gactcacagc acggtcagtt caagggcacc attgagacct acgacgaggg
     1801 tcttattgtc aacggcaaga agatccgctt ccacaccgag cgtgaccccg ccaacatccc
     1861 ctggggccag gacggtgctg aatacattgt cgagtccacc ggtgtcttca ctacccagga
     1921 gaaggctagc gctcacctga agggtggtgc caagaaggtt gtcatctctg ccccatctgc
     1981 tgatgcccct atgttcgtca tgggtgtcaa caacgagacc tacaagaagg acattcaggt
     2041 cctctccaac gcttcttgca ccaccaactg ccttgcccct ctcgccaagg tcatcaacga
     2101 caacttcggt atcatcgagg gtctgatgac caccgtccac tcctacactg ctacccagaa
     2161 ggtcgtcgac ggcccctcgg ccaaggactg gcgtggtggc cgtaccgctg ctaccaacat
     2221 catcccctcc tccactggtg ctgccaaggc tgtcggcaag gtcattcctt cgctcaatgg
     2281 caagctcacc ggcatggcga tgcgtgttcc cacctccaac gtctccgttg ttgacctgac
     2341 cgtccgcacc gagaaggctg ttacctacga ccagatcaag gatgccgtca agaaggcttc
     2401 tgagaacgag ctcaagggta atgtgaatgt gcttttgctg ttggacatct tcgactaact
     2461 agttgattta ggcatccttg gctacaccga ggacgacatc gtctctaccg acctcaacgg
     2521 tgacacccgc tcttccatct tcgatgctaa ggcgggtatt gccctcaact ccaacttcat
     2581 caagctcgtt tcctggtacg acaacgagtg gggttactcc cgccgtgttg ttgacctcat
     2641 cagtaagtcc tcagttagat ggaacatttt gtgcgttgct aactcgcacc cagcctacat
     2701 ctccaaggtt gatgcccaat aggaaacagg tcggaagcca atggccagga gctccttgta
     2761 aaaaaatact ccttggtcta ttaagttgcc cattctttag caggagtgtg cagactatgt
     2821 ccgtatccac atgccgcaac tgcagattca taggagctgt tggggatatt ggcataggat
     2881 cccattgtta cgtactattt aatgacaaat acacgatcaa tttcaccact attgttcact
     2941 tctactggta gcttagacgt actatttctc gtggaatagc cagtacttgc tcttatattg
     3001 gccgtcgcga atttcggcgt cgacaacgag ctaccacatt tgttcatgcc aggcaggctg
     3061 aggaccttga aagccttgaa atgccgaagg tagtatatcc cgcgttcctt tatcagatta
     3121 gaacaaatgc cgttctatca tctgggtata cttagtcctt ttgaccgggg aaatatgtca
     3181 cgtgcaaggc gct
//