LOCUS       HUMERCC3A               2751 bp    mRNA    linear   HUM 07-NOV-1994
DEFINITION  Human DNA repair helicase (ERCC3) mRNA, complete cds.
ACCESSION   M31899
VERSION     M31899.1
KEYWORDS    Cockayne's syndrome; DNA repair protein; excision repair protein;
            helicase.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2751)
  AUTHORS   Weeda,G., van Ham,R.C., Vermeulen,W., Bootsma,D., van der Eb,A.J.
            and Hoeijmakers,J.H.
  TITLE     A presumed DNA helicase encoded by ERCC-3 is involved in the human
            repair disorders xeroderma pigmentosum and Cockayne's syndrome
  JOURNAL   Cell 62 (4), 777-791 (1990)
   PUBMED   2167179
REFERENCE   2  (sites)
  AUTHORS   Weeda,G., van Ham,R.C., Masurel,R., Westerveld,A., Odijk,H., de
            Wit,J., Bootsma,D., van der Eb,A.J. and Hoeijmakers,J.H.
  TITLE     Molecular cloning and biological characterization of the human
            excision repair gene ERCC-3
  JOURNAL   Mol. Cell. Biol. 10 (6), 2570-2581 (1990)
   PUBMED   2111438
COMMENT     Original source text: Human lymphoid cell line K562 cDNA to mRNA.
            [2]  sites.
            Draft entry and computer-readable sequence for [2] kindly submitted
            by G. Weeda, 07-FEB-1990, for release after publication.
FEATURES             Location/Qualifiers
     source          1..2751
                     /db_xref="H-InvDB:HIT000195445"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /map="2q21"
     gene            1..2751
                     /gene="ERCC3"
     CDS             96..2444
                     /gene="ERCC3"
                     /note="DNA repair helicase"
                     /codon_start=1
                     /protein_id="AAA52396.1"
                     /db_xref="GI:182179"
                     /db_xref="GDB:G00-119-881"
                     /translation="MGKRDRADRDKKKSRKRHYEDEEDDEEDAPGNDPQEAVPSAAGK
                     QVDESGTKVDEYGAKDYRLQMPLKDDHTSRPLWVAPDGHIFLEAFSPVYKYAQDFLVA
                     IAEPVCRPTHVHEYKLTAYSLYAAVSVGLQTSDITEYLRKLSKTGVPDGIMQFIKLCT
                     VSYGKVKLVLKHNRYFVESCHPDVIQHLLQDPVIRECRLRNSEGEATELITETFTSKS
                     AISKTAESSGGPSTSRVTDPQGKSDIPMDLFDFYEQMDKDEEEEEETQTVSFEVKQEM
                     IEELQKRCIHLEYPLLAEYDFRNDSVNPDINIDLKPTAVLRPYQEKSLRKMFGNGRAR
                     SGVIVLPCGAGKSLVGVTAACTVRKRCLVLGNSAVSVEQWKAQFKMWSTIDDSQICRF
                     TSDAKDKPIGCSVAISTYSMLGHTTKRSWEAERVMEWLKTQEWGLMILDEVHTIPAKM
                     FRRVLTIVQAHCKLGLTATLVREDDKIVDLNFLIGPKLYEANWMELQNNGYIAKVQCA
                     EVWCPMSPEFYREYVAIKTKKRILLYTMNPNKFRACQFLIKFHERRNDKIIVFADNVF
                     ALKEYAIRLNKPYIYGPTSQGERMQILQNFKHNPKINTIFISKVGDTSFDLPEANVLI
                     QISSHGGSRRQEAQRLGRVLRAKKGMVAEEYNAFFYSLVSQDTQEMAYSTKRQRFLVD
                     QGYSFKVITKLAGMEEEDLAFSTKEEQQQLLQKVLAATDLDAEEEVVAGEFGSRSSQA
                     SRRFGTMSSMSGADDTVYMEYHSSRSKAPSKHVHPLFKRFRK"
BASE COUNT          727 a          668 c          726 g          630 t
ORIGIN      
        1 gggagcttcc ggattgagcc ggaagtcccc ccagagcgga tgccgcggcg ggcctgtggg
       61 agcggggtca tcttctctct gctgctgtag ctgccatggg caaaagagac cgagcggacc
      121 gcgacaagaa gaaatccagg aagcggcact atgaggatga agaggatgat gaagaggacg
      181 ccccggggaa cgaccctcag gaagcggttc cctcggcggc ggggaagcag gtggatgagt
      241 caggcaccaa agtggatgaa tatggagcca aggactacag gctgcaaatg ccgctgaagg
      301 acgaccacac ctccaggccc ctctgggtgg ctcccgatgg ccatatcttc ttggaagcct
      361 tctctccagt ttacaaatat gcccaagact tcttggtggc tattgcagag ccagtgtgcc
      421 gaccaaccca tgtgcatgag tacaaactaa ctgcctactc cttgtatgca gctgtcagcg
      481 ttgggctgca aaccagtgac atcaccgagt acctcaggaa gctcagcaag actggagtcc
      541 ctgatggaat tatgcagttt attaagttgt gtactgtcag ctatggaaaa gtcaagctgg
      601 tcttgaagca caacagatac ttcgttgaaa gttgccaccc tgatgtaatc cagcatcttc
      661 tccaggaccc cgtgatccga gaatgccgct taagaaactc tgaaggggag gccactgagc
      721 tcatcacaga gactttcaca agcaaatctg ccatttctaa gactgctgaa agcagtggtg
      781 ggccctccac ttcccgagtg acagatccac agggtaaatc tgacatcccc atggacctgt
      841 ttgacttcta tgagcaaatg gacaaggatg aagaagaaga agaagagaca cagacagtgt
      901 cttttgaagt caagcaggaa atgattgagg aactccagaa acgttgcatc cacctggagt
      961 accctctgtt ggcagaatat gacttccgga atgattctgt caaccctgat atcaacattg
     1021 acctaaagcc cacagctgtc ctcagaccct atcaggagaa gagcttgcga aagatgtttg
     1081 gaaacgggcg tgcacgttcg ggggtcattg ttcttccctg cggtgctgga aagtccctgg
     1141 ttggtgtgac tgctgcatgc actgtcagaa aacgctgtct ggtgctgggc aactcagctg
     1201 tttctgtgga gcagtggaaa gcccagttca agatgtggtc caccattgac gacagccaga
     1261 tctgccggtt cacctccgat gccaaggaca agcccatcgg ctgctccgtt gccattagca
     1321 cctactccat gctgggccac accaccaaaa ggtcctggga ggccgagcga gtcatggagt
     1381 ggctcaagac ccaggagtgg ggcctcatga tcctggatga agtgcacacc ataccagcca
     1441 agatgttccg aagggtgctc accatcgtgc aggcccactg taagctgggt ttgactgcga
     1501 ccctcgtccg cgaagatgac aaaattgtgg atttaaattt tctgattggg cctaagctct
     1561 acgaagccaa ctggatggag ctgcagaata atggctacat cgccaaagtc cagtgtgctg
     1621 aggtctggtg ccctatgtct cctgaatttt accgggaata tgtggcaatc aaaaccaaga
     1681 aacgaatctt gctgtacacc atgaacccca acaaatttag agcttgccag tttctgatca
     1741 agtttcatga aaggaggaat gacaagatta ttgtctttgc tgacaatgtg tttgccctaa
     1801 aggaatatgc cattcgactg aacaaaccct atatctacgg acctacgtct cagggggaaa
     1861 ggatgcaaat tctccagaat ttcaagcaca accccaaaat taacaccatc ttcatatcca
     1921 aggtaggtga cacttcgttt gatctgccgg aagcaaatgt cctcattcag atctcatccc
     1981 atggtggctc caggcgtcag gaagcccaaa ggctagggcg ggtgcttcga gctaaaaaag
     2041 ggatggttgc agaagagtac aatgcctttt tctactcact ggtatcccag gacacacagg
     2101 aaatggctta ctcaaccaag cggcagagat tcttggtaga tcaaggttat agcttcaagg
     2161 tgatcacgaa actcgctggc atggaggagg aagacttggc gttttcgaca aaagaagagc
     2221 aacagcagct cttacagaaa gtcctggcag ccactgacct ggatgccgag gaggaggtgg
     2281 tggctgggga atttggctcc agatccagcc aggcatctcg gcgctttggc accatgagtt
     2341 ctatgtctgg ggccgacgac actgtgtaca tggagtacca ctcatcgcgg agcaaggcgc
     2401 ccagcaaaca tgtacacccg ctcttcaagc gctttaggaa atgatgctta ggcagggtac
     2461 ttcgttcaag accggcgctt ggcacccttg ttggaaaggg attttcagca taacattttc
     2521 cttccacctc tttgaccttc cctccagcgt tggccaaatt gtgctgagga agatgcatca
     2581 agggcttggc tgtgccttca taggtcatct agggttttat aaaggaggag gagacaatat
     2641 tttttcaaac tttttgggga gtggggtcat ttctgtatat aaaaaatgtt aatatttaag
     2701 gtgtatttat gttaccgttc tgaataaaca gaatggacca ttgaaccagt a
//