LOCUS       HUMGNAI1                3143 bp    mRNA    linear   HUM 08-NOV-1994
DEFINITION  Human guanine nucleotide-binding protein (Gi) alpha subunit mRNA,
            complete cds.
ACCESSION   M27543
VERSION     M27543.1
KEYWORDS    guanine nucleotide-binding protein.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 3143)
  AUTHORS   Didsbury,J.R. and Snyderman,R.
  TITLE     Molecular cloning of a new human G protein. Evidence for two Gi
            alpha-like protein families
  JOURNAL   FEBS Lett. 219 (1), 259-263 (1987)
   PUBMED   3109953
COMMENT     Original source text: Human cell line HL-60, cDNA to mRNA, clone
            pJDHL9.
FEATURES             Location/Qualifiers
     source          1..3143
                     /db_xref="H-InvDB:HIT000195175"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /map="7q21-q22"
     gene            1..3143
                     /gene="GNAI1"
     mRNA            <1..3143
                     /gene="GNAI1"
                     /product="G protein mRNA"
     CDS             43..1107
                     /gene="GNAI1"
                     /note="guanine nucleotide-binding protein (G) alpha
                     subunit"
                     /codon_start=1
                     /protein_id="AAA52579.1"
                     /db_xref="GI:183396"
                     /db_xref="GDB:G00-120-001"
                     /translation="MGCTLSAEDKAAVERSKMIDRNLREDGEKAAKEVKLLLLGAGES
                     GKSTIVKQMKIIHEDGYSEDECKQYKVVVYSNTIQSIIAIIRAMGRLKIDFGEAARAD
                     DARQLFVLAGSAEEGVMTPELAGVIKRLWRDGGVQACFSRSREYQLNDSASYYLNDLD
                     RISQSNYIPTQQDVLRTRVKTTGIVETHFTFKDLYFKMFDVGGQRSERKKWIHCFEGV
                     TAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEE
                     KIKRSPLTICYPEYTGSNTYEEAAAYIQCQFEDLNRRKDTKEIYTHFTCATDTKNVQF
                     VFDAVTDVIIKNNLKECGLY"
BASE COUNT          917 a          535 c          660 g         1031 t
ORIGIN      
        1 tgtgagtgag tccgggcccg tgtcccctct cccgccgccg ccatgggctg cacgttgagc
       61 gccgaagaca aggcggcagt ggagcgaagc aagatgatcg accgcaactt acgggaggac
      121 ggggaaaaag cggccaaaga agtgaagctg ctgctactcg gtgctggaga atctggtaaa
      181 agcaccattg tgaaacagat gaaaatcatt catgaggatg gctattcaga ggatgaatgt
      241 aaacaatata aagtagttgt ctacagcaat actatacagt ccatcattgc aatcataaga
      301 gccatgggac ggctaaagat tgactttggg gaagctgcca gggcagatga tgcccggcaa
      361 ttatttgttt tagctggcag tgctgaagaa ggagtcatga ctccagaact agcaggagtg
      421 attaaacggt tatggcgaga tggtggggta caagcttgct tcagcagatc cagggaatat
      481 cagctcaatg attctgcttc atattatcta aatgatctgg atagaatatc ccagtctaac
      541 tacattccaa ctcagcaaga tgttcttcgg acgagagtga agaccacagg cattgtagaa
      601 acacatttca ccttcaaaga cctatacttc aagatgtttg atgtaggtgg ccaaagatca
      661 gaacgaaaaa agtggattca ctgttttgag ggagtgacag caattatctt ctgtgtggcc
      721 ctcagtgatt atgaccttgt tctggctgag gacgaggaga tgaaccgaat gcatgaaagc
      781 atgaaactgt ttgacagcat ttgtaataac aaatggttta cagaaacttc aatcattctc
      841 ttccttaaca agaaagacct ttttgaggaa aaaataaaga ggagtccgtt aactatctgt
      901 tatccagaat acacaggttc caatacatat gaagaggcag ctgcctatat tcaatgccag
      961 tttgaagatc tgaacagaag aaaagatacc aaggagatct atactcactt cacctgtgcc
     1021 acagacacga agaatgtgca gtttgttttt gatgctgtta cagatgtcat cattaaaaac
     1081 aacttaaagg aatgtggact ttattgagaa gcatggatgt tagtgaaagt tactacagtg
     1141 tggagtgttg agaccagaca ccttttgctg tctcatgggg cagctacaag catgaacggg
     1201 accagggaat ggcagcagca tgcagaatct tagcactctt tagcacaata ttttgtatta
     1261 gggaactttt aattgacatc gagatgctaa agtcagacat tggaattgga agaactacta
     1321 aagtgtgatt cgatcgtcaa gacatcactt ggatttctta atcttaaatg cttatggaag
     1381 atgtgaagtt gaggtgctgc attctagaac ttcaatatgt agcttactct ttttttcccc
     1441 ccttcttaaa ccaccagtgg ttcattttta aggttttttc atcaagagaa gaataacttt
     1501 actaaatttt atttctttat ttgcaaaaga atctttatta aaacaaacaa tcttaactat
     1561 gcacatgatg tgaccagatc atcttgaaaa tattcctctt tagtaggaac tctttgtttt
     1621 taactcttgg tatggtcaga atataatact tccataatta cttataattc tttccggtta
     1681 ctggggctat aaatacaact ttttaaatga aatttatgtt attatcctgc tcaaagtacc
     1741 attatggttt ccatatggta attacattgg aaagttctgc aataagattc tagttctctc
     1801 ttttctttaa gcttatggtt gaaggttaac cttgtttgtg cagattacca aattactgct
     1861 gatgtagtat gataaagtca gcttcttgga tacagacaca cccagggcag ctgccaatca
     1921 gaaatgcaaa ttgctaaatt ccaaacagaa ccagtgactt tgctgctaca tatttactaa
     1981 attgaccact ttgattcttg cttgtttgtc tcagttatag ggagttttgt acatggtgcc
     2041 tcttgttttc catcttcatg gccttttctg ttgagaaaca tctaaagtgt attaacagtg
     2101 catgctttta ctttgtaaat gtggtgccaa atccctgttt gccatcgttt ttactgtacc
     2161 gatgttaact gtagtaatcc ttagccagta tgttcttttg ctgaaactgt tgcattttgg
     2221 gacttttttc cactttgtca tgtgtacatt tttaatctgt tatagttggc ggcagtatta
     2281 aaatggtgag taaagagccc aggtttgctc ctgtttgtaa ctagtctttt ctggaaatac
     2341 tgtcttctgt ttccttttgc ctttgcagaa tgtgctttag cctttgtctg agaatgggtt
     2401 taggtagaag ggtttcctga aagtctagtc ttttggtgta atagtattgt tgaaccttag
     2461 gttttatgtt atatctgcat atgagtgata tgtgatcatg attcattttg cagatttaca
     2521 ttttgcttgt gtggaaagtt acgttcactt caacctacag acccttttgt ataatgtaca
     2581 gcaaatgtca ttaaatattg aatgctctat tgggggaaga caaatgaaga gaatgcattt
     2641 tgagcatttc aaatcagtag tttgggcagt gccttttggg gtccaatctt tttggattgg
     2701 attctatttc atcttttgat gtgacttttc acctagttta caaaaaaaag gttggtggtc
     2761 aacaaaaaaa gcaagtcata gcagttcagt gcctttgttg gtagttttta actttttttg
     2821 tgattctttt tggaaaatca tagcttacag atggtataac tgtattatat aatggaattt
     2881 tctttaggtg tgggaaaaac ttgatctgaa agaaaattat cagcttcaat tggcgattga
     2941 ttcagtgccc acaatgtaaa cagggttggt agttgttact cattttgaat ataccttttc
     3001 cttattgtat tctgtaatat aggatcctgg aaatgagacc tggtggaata ttattttcaa
     3061 ctgtagtctt tctatactgt ggactaatga aatggtgttg ttgataaatc taaaataacc
     3121 aataatccaa aaaagttcat ttt
//