LOCUS       HUMNUMB23               1293 bp    mRNA    linear   HUM 27-APR-1993
DEFINITION  Human nucleolar protein (B23) mRNA, complete cds.
ACCESSION   M26697
VERSION     M26697.1
KEYWORDS    B23 gene; nucleolar phosphoprotein; nucleolar protein; numatrin.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1293)
  AUTHORS   Zhang,X.X., Thomis,D.C. and Samuel,C.E.
  TITLE     Isolation and characterization of a molecular cDNA clone of a human
            mRNA from interferon-treated cells encoding nucleolar protein B23,
            numatrin
  JOURNAL   Biochem. Biophys. Res. Commun. 164 (1), 176-184 (1989)
   PUBMED   2478125
COMMENT     Original source text: Human amnion cell line U, cDNA to mRNA, clone
            lambda-Zap.
            Draft entry and computer-readable copy of sequence [1] kindly
            submitted by C.E.Samuel, 03-AUG-1989.
FEATURES             Location/Qualifiers
     source          1..1293
                     /db_xref="H-InvDB:HIT000195078"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /cell_line="U"
                     /tissue_type="amnion"
     CDS             91..975
                     /codon_start=1
                     /product="nucleolar protein B23"
                     /protein_id="AAA36385.1"
                     /db_xref="GI:189312"
                     /translation="MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSL
                     RTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRL
                     KCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAA
                     DEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSS
                     TPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCF
                     RMTDQEAIQDLWQWRKSL"
     polyA_signal    1268..1273
     polyA_signal    1286..1291
BASE COUNT          422 a          223 c          310 g          337 t
ORIGIN      
        1 cgggattccg tcctgcgcgg ttgttctctg gagcagcgtt cttttatctc cgtccgcctt
       61 ctctcctacc taagtgcgtg ccgccacccg atggaagatt cgatggacat ggacatgagc
      121 cccctgaggc cccagaacta tcttttcggt tgtgaactaa aggccgacaa agattatcac
      181 tttaaggtgg ataatgatga aaatgagcac cagttatctt taagaacggt cagtttaggg
      241 gctggtgcaa aggatgagtt gcacattgtt gaagcagagg caatgaatta cgaaggcagt
      301 ccaattaaag taacactggc aactttgaaa atgtctgtac agccaacngt ttcccttggg
      361 ggctttgaaa taacaccacc agtggtctta aggttgaagt gtggttcagg gccagtgcat
      421 attagtggac agcacttagt agctgtggag gaagatgcag agtcagaaga tgaagaggag
      481 gaggatgtga aactcttaag tatatctgga aagcggtctg cccctggagg tggtagcaag
      541 gttccacaga aaaaagtaaa acttgctgct gatgaagatg atgacgatga tgatgaagag
      601 gatgatgatg aagatgatga tgatgatgat tttgatgatg aggaagctga agaaaaagcg
      661 ccagtgaaga aatctatacg agatactcca gccaaaaatg cacaaaagtc aaatcagaat
      721 ggaaaagact caaaaccatc atcaacacca agatcaaaag gacaagaatc cttcaagaaa
      781 caggaaaaaa ctcctaaaac accaaaagga cctagttctg tagaagacat taaagcaaaa
      841 atgcaagcaa gtatagaaaa aggtggttct cttcccaaag tggaagccaa attcatcaat
      901 tatgtgaaga attgcttccg gatgactgac caagaggcta ttcaagatct ctggcagtgg
      961 aggaagtctc tttaagaaaa tagtttaaac aatttgttaa aaaattttcc gtcttatttc
     1021 atttctgtaa cagttgatat ctggctgtcc tttttataat gcagagtgag aactttccct
     1081 accgtgtttg ataaatgttg tccaggttct attgccaaga atgtgttgtc caaaatgcct
     1141 gtttagtttt taaagatgga actccaccct ttgcttggtt ttaagtatgt atggaatgtt
     1201 atgataggac atagtagtag cggtggtcag acatggaaat ggtggggaga caaaaatata
     1261 catgtgaaat aaaactcagt attttaataa agt
//