LOCUS MUSIGHML 775 bp mRNA linear ROD 27-APR-1993 DEFINITION Mouse Ig rearranged U10 H-chain mRNA V-region (V-D-J-CH1). ACCESSION M24452 VERSION M24452.1 KEYWORDS C-region; D-region; J-region; V-region; immunoglobulin heavy chain; processed gene. SOURCE Mus musculus domesticus (western European house mouse) ORGANISM Mus musculus domesticus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 775) AUTHORS Chien,N.C., Roberts,V.A., Giusti,A.M., Scharff,M.D. and Getzoff,E.D. TITLE Significant structural and functional change of an antigen-binding site by a distant amino acid substitution: proposal of a structural mechanism JOURNAL Proc. Natl. Acad. Sci. U.S.A. 86 (14), 5532-5536 (1989) PUBMED 2748602 COMMENT Original source text: Mouse (strain BALB/c) myeloma cell line S107.3.4, cDNA to mRNA. Draft entry and computer-readable copy of sequence [1] kindly provided by E.D.Getzoff, 08-JUN-1989. D-J-region recomb site changed at request of V.A.Roberts, 08-SEP-1989. FEATURES Location/Qualifiers source 1..775 /organism="Mus musculus domesticus" /mol_type="mRNA" /strain="BALB/c" /sub_species="domesticus" /db_xref="taxon:10092" /cell_line="S107.3.4" /tissue_type="myeloma" CDS 103..775 /note="Ig heavy chain V-region (V-D-J-CH1) (5' end unsure)" /codon_start=1 /protein_id="AAA38383.1" /translation="EVKLVESGGGLVQPGGSLRLSCATSGFTFSDFYMEWVRQPPGKR LEWIAASRNKANDYTTEYSASVKGRFIVSRDTSQSILYLQMNALRAEDTAIYYCARDY YGSSYWYFAVWGAGTTVTVSSESARNPTIYPLTLPPVLCSDPVIIGCLIHDYFPFGTM NVTWGKSGKDITTVNFPPALASGGRYTMSSQLTLPAVECPEGESVKCSVQHDSNPVQE LDVNCS" BASE COUNT 185 a 198 c 196 g 196 t ORIGIN 1 tgtcccaatc ttcacattca gaaatcagca ctcagtcctg tcactatgaa gttgtggtta 61 aactgggttt ttcttttaac acttttacat ggtatccagt gtgaggtgaa gctggtggaa 121 tctggaggag gcttggtaca gcctgggggt tctctgagac tctcctgtgc aacttctggg 181 ttcaccttca gtgatttcta catggagtgg gtccgccagc ctccagggaa gagactggag 241 tggattgctg caagtagaaa caaagctaat gattatacaa cagagtacag tgcatctgtg 301 aagggtcggt tcatcgtctc cagagacact tcccaaagca tcctctacct tcagatgaat 361 gccctgagag ctgaggacac tgccatttat tactgtgcaa gagattacta cggtagtagc 421 tactggtact tcgctgtctg gggcgcaggg accacggtca ccgtctcctc agagtctgcg 481 agaaatccca ccatctaccc actgacactc ccaccagtcc tgtgcagtga tcccgtgata 541 atcggctgcc tgattcacga ttacttccct ttcggcacga tgaatgtgac ctggggaaag 601 agtgggaagg atataaccac cgtgaacttt ccacctgccc tcgcctctgg gggacggtac 661 accatgagca gccagttaac cctgccagct gtcgagtgcc cagaaggaga gtccgtgaaa 721 tgttccgtgc aacatgactc taaccccgtc caagaattgg atgtgaattg ctctg //