LOCUS       MUSIGHML                 775 bp    mRNA    linear   ROD 27-APR-1993
DEFINITION  Mouse Ig rearranged U10 H-chain mRNA V-region (V-D-J-CH1).
ACCESSION   M24452
VERSION     M24452.1
KEYWORDS    C-region; D-region; J-region; V-region; immunoglobulin heavy chain;
            processed gene.
SOURCE      Mus musculus domesticus (western European house mouse)
  ORGANISM  Mus musculus domesticus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 775)
  AUTHORS   Chien,N.C., Roberts,V.A., Giusti,A.M., Scharff,M.D. and
            Getzoff,E.D.
  TITLE     Significant structural and functional change of an antigen-binding
            site by a distant amino acid substitution: proposal of a structural
            mechanism
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 86 (14), 5532-5536 (1989)
   PUBMED   2748602
COMMENT     Original source text: Mouse (strain BALB/c) myeloma cell line
            S107.3.4, cDNA to mRNA.
            Draft entry and computer-readable copy of sequence [1] kindly
            provided by E.D.Getzoff, 08-JUN-1989.
            D-J-region recomb site changed at request of V.A.Roberts,
            08-SEP-1989.
FEATURES             Location/Qualifiers
     source          1..775
                     /organism="Mus musculus domesticus"
                     /mol_type="mRNA"
                     /strain="BALB/c"
                     /sub_species="domesticus"
                     /db_xref="taxon:10092"
                     /cell_line="S107.3.4"
                     /tissue_type="myeloma"
     CDS             103..775
                     /note="Ig heavy chain V-region (V-D-J-CH1) (5' end
                     unsure)"
                     /codon_start=1
                     /protein_id="AAA38383.1"
                     /translation="EVKLVESGGGLVQPGGSLRLSCATSGFTFSDFYMEWVRQPPGKR
                     LEWIAASRNKANDYTTEYSASVKGRFIVSRDTSQSILYLQMNALRAEDTAIYYCARDY
                     YGSSYWYFAVWGAGTTVTVSSESARNPTIYPLTLPPVLCSDPVIIGCLIHDYFPFGTM
                     NVTWGKSGKDITTVNFPPALASGGRYTMSSQLTLPAVECPEGESVKCSVQHDSNPVQE
                     LDVNCS"
BASE COUNT          185 a          198 c          196 g          196 t
ORIGIN      
        1 tgtcccaatc ttcacattca gaaatcagca ctcagtcctg tcactatgaa gttgtggtta
       61 aactgggttt ttcttttaac acttttacat ggtatccagt gtgaggtgaa gctggtggaa
      121 tctggaggag gcttggtaca gcctgggggt tctctgagac tctcctgtgc aacttctggg
      181 ttcaccttca gtgatttcta catggagtgg gtccgccagc ctccagggaa gagactggag
      241 tggattgctg caagtagaaa caaagctaat gattatacaa cagagtacag tgcatctgtg
      301 aagggtcggt tcatcgtctc cagagacact tcccaaagca tcctctacct tcagatgaat
      361 gccctgagag ctgaggacac tgccatttat tactgtgcaa gagattacta cggtagtagc
      421 tactggtact tcgctgtctg gggcgcaggg accacggtca ccgtctcctc agagtctgcg
      481 agaaatccca ccatctaccc actgacactc ccaccagtcc tgtgcagtga tcccgtgata
      541 atcggctgcc tgattcacga ttacttccct ttcggcacga tgaatgtgac ctggggaaag
      601 agtgggaagg atataaccac cgtgaacttt ccacctgccc tcgcctctgg gggacggtac
      661 accatgagca gccagttaac cctgccagct gtcgagtgcc cagaaggaga gtccgtgaaa
      721 tgttccgtgc aacatgactc taaccccgtc caagaattgg atgtgaattg ctctg
//