LOCUS       HUMTRPSGNA               800 bp    mRNA    linear   HUM 14-JAN-1995
DEFINITION  Human pancreatic trypsin 1 (TRY1) mRNA, complete cds.
ACCESSION   M22612
VERSION     M22612.1
KEYWORDS    trypsinogen.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 800)
  AUTHORS   Emi,M., Nakamura,Y., Ogawa,M., Yamamoto,T., Nishide,T., Mori,T. and
            Matsubara,K.
  TITLE     Cloning, characterization and nucleotide sequences of two cDNAs
            encoding human pancreatic trypsinogens
  JOURNAL   Gene 41 (2-3), 305-310 (1986)
   PUBMED   3011602
COMMENT     On Aug 4, 1994 this sequence version replaced gi:340723.
            Original source text: Homo sapiens pancreas cDNA to mRNA.
FEATURES             Location/Qualifiers
     source          1..800
                     /db_xref="H-InvDB:HIT000194852"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /map="7q32-qter"
                     /tissue_type="pancreas"
     gene            1..800
                     /gene="TRY1"
     CDS             7..750
                     /gene="TRY1"
                     /codon_start=1
                     /product="trypsinogen"
                     /protein_id="AAA61231.1"
                     /db_xref="GI:521216"
                     /db_xref="GDB:G00-119-620"
                     /translation="MNPLLILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLNSG
                     YHFCGGSLINEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRK
                     TLNNDIMLIKLSSRAVINARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQC
                     LDAPVLSQAKCEASYPGKITSNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGD
                     GCAQKNKPGVYTKVYNYVKWIKNTIAANS"
     sig_peptide     7..51
                     /gene="TRY1"
                     /note="G00-119-620"
     mat_peptide     76..747
                     /gene="TRY1"
                     /product="trypsinogen"
                     /note="G00-119-620"
     polyA_signal    781..786
                     /gene="TRY1"
                     /note="G00-119-620"
     polyA_site      800
                     /gene="TRY1"
                     /note="G00-119-620"
BASE COUNT          189 a          233 c          198 g          180 t
ORIGIN      
        1 accaccatga atccactcct gatccttacc tttgtggcag ctgctcttgc tgcccccttt
       61 gatgatgatg acaagatcgt tgggggctac aactgtgagg agaattctgt cccctaccag
      121 gtgtccctga attctggcta ccacttctgt ggtggctccc tcatcaacga acagtgggtg
      181 gtatcagcag gccactgcta caagtcccgc atccaggtga gactgggaga gcacaacatc
      241 gaagtcctgg aggggaatga gcagttcatc aatgcagcca agatcatccg ccacccccaa
      301 tacgacagga agactctgaa caatgacatc atgttaatca agctctcctc acgtgcagta
      361 atcaacgccc gcgtgtccac catctctctg cccaccgccc ctccagccac tggcacgaag
      421 tgcctcatct ctggctgggg caacactgcg agctctggcg ccgactaccc agacgagctg
      481 cagtgcctgg atgctcctgt gctgagccag gctaagtgtg aagcctccta ccctggaaag
      541 attaccagca acatgttctg tgtgggcttc cttgagggag gcaaggattc atgtcagggt
      601 gattctggtg gccctgtggt ctgcaatgga cagctccaag gagttgtctc ctggggtgat
      661 ggctgtgccc agaagaacaa gcctggagtc tacaccaagg tctacaacta cgtgaaatgg
      721 attaagaaca ccatagctgc caatagctaa agcccccagt atctcttcag tctctatacc
      781 aataaagtga ccctgttctc
//