LOCUS       MUSMHLYT2               6316 bp    DNA     linear   ROD 27-APR-1993
DEFINITION  Mouse MHC class I Lyt-2-a gene encoding lyt-2.1 T-cell surface
            alloantigen, complete cds.
ACCESSION   M22064
VERSION     M22064.1
KEYWORDS    cell surface antigen; cell surface glycoprotein; class I gene;
            integral membrane protein; major histocompatibility complex.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 6316)
  AUTHORS   Youn,H.J., Harriss,J.V. and Gottlieb,P.D.
  TITLE     Nucleotide sequence analysis of the C.AKR Lyt-2a gene: structural
            polymorphism in alleles encoding the Lyt-2.1 T-cell surface
            alloantigen
  JOURNAL   Immunogenetics 28 (5), 345-352 (1988)
   PUBMED   3267233
COMMENT     Original source text: Mouse (strain C.AKR) adult liver DNA, clone
            CAK292.
            Draft entry and computer-readable copy of sequence [1] kindly
            provided by H.J.Youn, 10-JAN-1989.
FEATURES             Location/Qualifiers
     source          1..6316
                     /organism="Mus musculus"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:10090"
     prim_transcript 2006..>6156
                     /note="Lyt-2.1 mRNA + introns (alt.)"
     prim_transcript 2006..>6067
                     /note="Lyt-2.1 mRNA + introns (alt.)"
     CDS             join(2006..2450,2955..3059,3212..3322,4340..4370,
                     5332..5383)
                     /note="Lyt-2.1 T-cell surface alloantigen"
                     /codon_start=1
                     /protein_id="AAA39665.1"
                     /translation="MASPLTRFLSLNLLLLGESIILGSGEAKPQAPELRIFPKKMDAE
                     LGQKVDLVCEVLGSVSQGCSWLFQNSSSKLPQPTFVVYMASSHNKITWDEKLNSSKLF
                     SAVRDTNNKYVLTLNKFSKENEGYYFCSVISNSVMYFSSVVPVLQKVNSTTTKPVLRT
                     PSPVHPTGTSQPQRPEDCRPRGSVKGTGLDFACDIYIWAPLAGICVAPLLSLIITLIC
                     YHRSRKRVCKCPRPLVRQEGKPRPSEKIV"
     exon            <2006..2450
                     /note="Lyt-2.1 T-cell surface alloantigen"
                     /number=1
     intron          2451..2954
                     /note="Lyt-2.1, intron A"
     exon            2955..3059
                     /number=2
     intron          3060..3211
                     /note="Lyt-2.1, intron B"
     exon            3212..3322
                     /number=3
     intron          3323..4339
                     /note="Lyt-2.1, intron C"
     exon            4340..4370
                     /number=4
     intron          4371..5331
                     /note="Lyt-2.1, intron D"
     exon            5332..>5383
                     /note="Lyt-2.1 T-cell surface alloantigen"
                     /number=5
BASE COUNT         1626 a         1545 c         1581 g         1561 t
ORIGIN      Chromosome 6.
        1 aagccacttt ggaagccata gtaggtactg tgctgtccac aaaggctgtt gacctaagtt
       61 ccatccccag aaggaagcca tgaagaggtg ggagaagaga actgactcca cagagctgtt
      121 ctctgatttc cacactcatg ctgtaacatg tctgtcccct cccaggcaca cacatcacac
      181 acattaacac aaaataacaa taaactacat taaaattgta ctttaaacaa ctctaaacat
      241 aaaatgttag agtcagcatt tgggtattct taagagtagg gaatactgag accaagcagt
      301 ttctaaagcc cacccaatac ttgtttgtat atattagcca tacagagctt ggtggctcaa
      361 gcttgtaatc ctagcaccct ggagactaat gcaattggac tatcatgaaa ctagggcctg
      421 cttgaactat gtcgtaagtt ccaggccagc ctatttgaga tcttgtcatc aaacataaac
      481 aatgacaaaa ggcaaaccta ttcagagggg tgcagttcag taaacacaaa taagaatata
      541 acatcaacaa cacacttgtt tgtgtaaact ggacatggtg gccataccca gcactgtggc
      601 ggttatggta aacagcgtgc cactgggcag aactcagatg tggggtagag actgccaggc
      661 aacctgtctc caactagaat gaagcagtaa cgtgggaggc acaccctgta tggggttcca
      721 agtggaaaac cccactaagt acaagccaca tacaagcaag aagaaagcac atccctgaga
      781 ctggcagctt tcaggactgc agtgggcaag aaagaatgaa gtctatgtgt gccagggaca
      841 gagaagagta aatgcctgca cccaagattc acccaggaca cacacatgca tacaagcaac
      901 agagaaagtc aaaggcccaa gtcagatggc aggggcccag catttgccag gcagagagca
      961 gcaagacctt aaaaacgtag aaataagtaa ccagggaagt gtctgtctat gaggcagtgg
     1021 ctgcaggcgg gcacatggca aagcagggat ggtggcttgg gtggagccag cacctatcca
     1081 agggctagtc cccaaccaag tcagagaggt gttttcctct agctgtgcag gccatggggt
     1141 gatgctgtca gatccccctg gataagaatg agggtcaaag tgtgtagctg gatcatccag
     1201 ttggcgagca tttggtgtgg aggctgttgc atggttctaa gaagggatga gactgggagg
     1261 tgagctttgc tccctgggtg ggaggccagg gaaggatatt gtcagcagct aagagtgcca
     1321 ctcaaggttc ccattgaact gcccccttgc aagtcccctt gatgggaggt gcaagtccct
     1381 tctggttagt gtctggtctg ctctgctgga atctctgtac attttctttc cactcaacct
     1441 ccagacaaga agcaaaaaca caaaaagaca ctactgccag caaaagaagt ggaagggcag
     1501 gagggctcag aattcaaggc caacctttgc catgaagtga gtctgaagca agcttgggga
     1561 acccaagaac ctatctacaa gaaaaagaaa agggagagtg ggcactcctc tcccttcatg
     1621 tcctgtcact ctcatatttt ttttattaag atttaatctt tatccttctt ctttcagcca
     1681 ctcttgcaga agaacaattc ctaagggtcc cttccaagtg ttttctcttc cccaaatctc
     1741 agttttcaat tcctcccact tgctctgcaa gggtgcattc tcactctgag ttcccaggcc
     1801 cctaaaaggt ggttgacact ctttggtggg gactttgggt gacatcatat cctcacatag
     1861 gaaatcagct ctgtctgcag ctggctaaag gagcagtttc cccgacccta cacgcctccc
     1921 ccaccgcacc tcctccgccc tgttcctggg cccctcccct agagccctag cttgacctaa
     1981 gctgcttgct ggtggagagc acaccatggc ctcaccgttg acccgctttc tgtcgctgaa
     2041 cctgctgctg ctgggtgagt cgattatcct ggggagtgga gaagctaagc cacaggcacc
     2101 cgaactccga atctttccaa agaaaatgga cgccgaactt ggccagaagg tggacctggt
     2161 atgtgaagtg ttggggtccg tttcgcaagg atgctcttgg ctcttccaga actccagctc
     2221 caaactcccc cagcccacct tcgttgtcta tatggcttca tcccacaaca agataacgtg
     2281 ggacgagaag ctgaattcgt cgaaactgtt ttctgccgtg agggacacga ataataagta
     2341 cgttctcacc ctgaacaagt tcagcaagga aaacgaaggc tactatttct gctcagtcat
     2401 cagcaactcg gtgatgtact tcagttctgt cgtgccagtc cttcagaaag gtttggaagt
     2461 ggaggttccc gtctcctggg ttttaggggt cacatctgaa caagtttcac gcagattccc
     2521 tcttcttaaa tctcttgggg cctcttggag gtgatttcta tactgtcccc attttacaga
     2581 ccaaaaactg aggctgaggt gctgggtggg attggaagtg atttttaaac gccctggatc
     2641 tgggctggag tctggatgca tgtgtgatcc tgcccctgtt ggctccagga tagaattttg
     2701 gtattgactc cagctttggg ttggtggagg gccgcagtcg cttagctgct ggatctgatc
     2761 taggcacatt ggccccaaat cacacttggc tccgcgtgtg cgagcagcgg agtagcccag
     2821 cacgtatcca ggggttcctt cttcctctag ttaaaagcta ggaaacggct ccttcttggg
     2881 taaaggctaa gtggaaaggg gctggtgcat ccacaattcc agcttgaccc gcaggcaccc
     2941 tattgctttt gcagtgaact ctactactac caagccagtg ctgcgaactc cctcacctgt
     3001 gcaccctacc gggacatctc agccccagag accagaagat tgtcggcccc gtggctcagg
     3061 ttaggtgctc tcaagcgatt gagataagca gatagcctgg ggtggaaaaa tcctgatctt
     3121 ggagggagac ctggaccggg agacgtgctg ggggcagggt tgggggctgt cccagagggt
     3181 ttctaaattc cattcattcg gatcttgtca gtgaagggga ccggattgga cttcgcctgt
     3241 gatatttaca tctgggcacc cttggccgga atctgcgtgg cccctctgct gtccttgatc
     3301 atcactctca tctgctacca cagtaagttc tggggagttc cccccatcca gccccccacc
     3361 caccccccca ccccaccccc gccaagagac tgctttgtgc tccaggagga gtctgtactt
     3421 tgtgcctgct ccagacagcc ttcagggaga ttacttttag gttggggaaa agggggaggg
     3481 cgttccagct gacctatagg accagtgtag cgggttcttt cttgaaggca ggagacaggt
     3541 ataccacccc actgctcttt ccaccctctg ggaacttttc agaacagagc cctgttccag
     3601 gatccccaag agcagccaaa tcagcagtta gcacagccag gataacttaa gcacactaag
     3661 gaggggttta catagccctg agaccagggc ccaagaaggc tgagtcacaa ccatgactgg
     3721 cttgagattt gccttaatcc cacctcacaa accattcact cctctgagtc tatacaggtg
     3781 attacaccaa ccaggtcaac agattcccag agacactcac atctgcattt acaatgcctc
     3841 tcccttccca agaaagggtt tcctttcatg ttgtctagac tatcctacaa ctagttaggt
     3901 agcctaggat aaccccaaac ttctgatctg atccttctgc cttccttcat tttgggagtg
     3961 ctgggacaac gggcataggc caccaaacca aatttaaaat gttttctttt actatgtatt
     4021 tatgcattta tttatttggg ttttttttaa aggcagggtt tctctgtgta gccctggctg
     4081 tcctggaact cactctgtag accaggctgg cctcaaactc agaaatccgc ctgcctctgc
     4141 cttccaagtg ctgggattaa aggcgtgggt gaccacagcc tggctgaaat gttttatttt
     4201 taattggaac ttgaggaaag agtaggcaaa gtagtgttca ctccaagtct gaagagttct
     4261 gagactcaaa gttctggagc agaggaagct atagaaacgg tatctggcag gtattcattc
     4321 tcccttcttc cttgtctagg gagccgaaag cgtgtttgca aatgtcccag gtgagtaacg
     4381 tctctgatct gtaggtctgc tcacgctggg cagccgtggt cccagtggtg aggtttggga
     4441 atctttccta gagagagagg tcatgccagt gaagtcctgg tggcagggga ccaggagtca
     4501 gccagatcct gaactaggag aagcagaaag ctggtgaggt gctggaattc attcctgaga
     4561 aaaggaagga ccacagaagt gctcagtggg acagcagcag gactgagttg caggggacta
     4621 gctgaacgag gaaaggtgtt cagtattttc aggacctgga gtgagcttgg tagcttctgc
     4681 aagacaatta cttatgctta ctttttctga atactctcat tttgaaatgt aaaatagaaa
     4741 agcccgtcct tgcactaaac cccggagcta tgcaaattag ttccctagac agtcacaggt
     4801 ccaagtctca gcctaaaggc agagggtttc tacaggagcc actcaggtct ctcacttttc
     4861 gtgtgacatt aatctcagca ctgtgcttgg ttgagggtgc acctcacact cttctggatt
     4921 ctcagttttg ggctactggg ataagagtca ggccacccgc tgacttaaaa caaccagctt
     4981 ctaatctcac cctcctggga ctcaggaagg ttccaggaag cctaactggg catagatgct
     5041 acttcagctg cctgagagtt gtgtgacctg aggcagggtc tttaaactct cctgagcagt
     5101 gcagacccct ctttgggtgc cttgaggacg aaaggaaagg gtggctgagg taattcattc
     5161 attaatgtct aaggacaaat tctcaaagcc atcaaaaact gagtgtgtgt gtgtgtgtgc
     5221 gcgcgngnga nacgcgcgcg cgctcgcgcg cgcgctcgcg cgctggtact actttaaaga
     5281 ggttctagcc acaatgatag ttgatctctt gtgtatcttt gtctctttca ggccgctagt
     5341 cagacaggaa ggcaagccca gaccttcaga gaaaattgtg taaaatggca ccgccaggaa
     5401 gctacaacta ctacatgact tcagagatct cttcttgcaa gaggccaggc cctccttttt
     5461 caagtttcct gctgtcttat gtattgccct ctgtattgtt ttagtagggg tgtgatgggg
     5521 acagttcctt tttctttatg aattctcttt gacacaaagc atacttgtat gcatacaatg
     5581 ggagtaatga gcagactgta acaccagagc tagttccagt ttcggggtcc atgtcactgg
     5641 tggcctcagc acccacttga tataaatctc ctgtctgccc atcatataga agaagctgaa
     5701 gatcagaggt ggaaacagca ggatctgtag acccggagag aacccaagtt agaggaaccc
     5761 tcactgactg gtgcagggat ctcaccccca tcccctgagc tctctgttta ggtatgtgtc
     5821 tttagtatag catgcttgtg cctcaaactg caaggaagca agtggtatga atctgtgatc
     5881 tgctcagctc tggctgtgag catcagatgt aacaaatcaa agtcaggaga actgccttta
     5941 gcagtgcacc tggacatcag agccccttgt aagaactggg aaattgctgg cagtctagtg
     6001 gagcggtacg gtaaatctgg aaaacactcc cctctgtcac tgaaggctgt agtagaatcc
     6061 aattaaagct attcaaacca ctgccgcaga ccctctgggt ccctgtgtct gcgtggaatg
     6121 ggtctctcga gcaggtgggc aaagcgtagg attaaactga caaacagacg cacacaggag
     6181 aggcgttgaa tctgaatgta atgtcaggtc gaaatctgga ctttttataa tacagaaaaa
     6241 attccagggg cgatatgtca caccagacaa ggtacactga aatttaccag atacaagaga
     6301 atgacttcga aaggaa
//