LOCUS       HUMIRGT                 2128 bp    mRNA    linear   HUM 06-JAN-1995
DEFINITION  Human insulin-responsive glucose transporter (GLUT4) mRNA, complete
            cds.
ACCESSION   M20747
VERSION     M20747.1
KEYWORDS    insulin-responsive glucose transporter.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2128)
  AUTHORS   Fukumoto,H., Kayano,T., Buse,J.B., Edwards,Y., Pilch,P.F.,
            Bell,G.I. and Seino,S.
  TITLE     Cloning and characterization of the major insulin-responsive
            glucose transporter expressed in human skeletal muscle and other
            insulin-responsive tissues
  JOURNAL   J. Biol. Chem. 264 (14), 7776-7779 (1989)
   PUBMED   2656669
COMMENT     Original source text: Human jejunum and muscle, cDNA to mRNA,
            clones lambda-h-[JHT-3, AMT-6, FMT-1].
            Draft entry and computer-readable sequence for [1] kindly provided
            by G.I.Bell, 19-APR-1989.
FEATURES             Location/Qualifiers
     source          1..2128
                     /db_xref="H-InvDB:HIT000194752"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /map="17p13"
     gene            1..2128
                     /gene="GLUT4"
     CDS             146..1675
                     /gene="GLUT4"
                     /note="insulin-responsive glucose transporter"
                     /codon_start=1
                     /protein_id="AAA59189.1"
                     /db_xref="GI:307076"
                     /db_xref="GDB:G00-119-997"
                     /translation="MPSGFQQIGSEDGEPPQQRVTGTLVLAVFSAVLGSLQFGYNIGV
                     INAPQKVIEQSYNETWLGRQGPEGPSSIPPGTLTTLWALSVAIFSVGGMISSFLIGII
                     SQWLGRKRAMLVNNVLAVLGGSLMGLANAAASYEMLILGRFLIGAYSGLTSGLVPMYV
                     GEIAPTHLRGALGTLNQLAIVIGILIAQVLGLESLLGTASLWPLLLGLTVLPALLQLV
                     LLPFCPESPRYLYIIQNLEGPARKSLKRLTGWADVSGVLAELKDEKRKLERERPLSLL
                     QLLGSRTHRQPLIIAVVLQLSQQLSGINAVFYYSTSIFETAGVGQPAYATIGAGVVNT
                     VFTLVSVLLVERAGRRTLHLLGLAGMCGCAILMTVALLLLERVPAMSYVSIVAIFGFV
                     AFFEIGPGPIPWFIVAELFSQGPRPAAMAVAGFSNWTSNFIIGMGFQYVAEAMGPYVF
                     LLFAVLLLGFFIFTFLRVPETRGRTFDQISAAFHRTPSLLEQEVKPSTELEYLGPDEN
                     D"
BASE COUNT          362 a          664 c          601 g          501 t
ORIGIN      
        1 gggggtccca tcgggcccgc cctcgcacgt cactccggga cccccgcggc ctccgcaggt
       61 tctgcgctcc aggccggagt cagagactcc aggatcggtt ctttcatctt cgccgcccct
      121 gcgcgtccag ctcttctaag acgagatgcc gtcgggcttc caacagatag gctccgaaga
      181 tggggaaccc cctcagcagc gagtgactgg gaccctggtc cttgctgtgt tctctgcggt
      241 gcttggctcc ctgcagtttg ggtacaacat tggggtcatc aatgcccctc agaaggtgat
      301 tgaacagagc tacaatgaga cgtggctggg gaggcagggg cctgagggac ccagctccat
      361 ccctccaggc accctcacca ccctctgggc cctctccgtg gccatctttt ccgtgggcgg
      421 catgatttcc tccttcctca ttggtatcat ctctcagtgg cttggaagga aaagggccat
      481 gctggtcaac aatgtcctgg cggtgctggg gggcagcctc atgggcctgg ccaacgctgc
      541 tgcctcctat gaaatgctca tccttggacg attcctcatt ggcgcctact cagggctgac
      601 atcagggctg gtgcccatgt acgtggggga gattgctccc actcacctgc ggggcgccct
      661 ggggacgctc aaccaactgg ccattgttat cggcattctg atcgcccagg tgctgggctt
      721 ggagtccctc ctgggcactg ccagcctgtg gccactgctc ctgggcctca cagtgctacc
      781 tgccctcctg cagctggtcc tgctgccctt ctgtcccgag agcccccgct acctctacat
      841 catccagaat ctcgaggggc ctgccagaaa gagtctgaag cgcctgacag gctgggccga
      901 tgtttctgga gtgctggctg agctgaagga tgagaagcgg aagctggagc gtgagcggcc
      961 actgtccctg ctccagctcc tgggcagccg tacccaccgg cagcccctga tcattgcggt
     1021 cgtgctgcag ctgagccagc agctctctgg catcaatgct gttttctatt attcgaccag
     1081 catcttcgag acagcagggg taggccagcc tgcctatgcc accataggag ctggtgtggt
     1141 caacacagtc ttcaccttgg tctcggtgtt gttggtggag cgggcggggc gccggacgct
     1201 ccatctcctg ggcctggcgg gcatgtgtgg ctgtgccatc ctgatgactg tggctctgct
     1261 cctgctggag cgagttccag ccatgagcta cgtctccatt gtggccatct ttggcttcgt
     1321 ggcatttttt gagattggcc ctggccccat tccttggttc atcgtggccg agctcttcag
     1381 ccagggaccc cgcccggcag ccatggctgt ggctggtttc tccaactgga cgagcaactt
     1441 catcattggc atgggtttcc agtatgttgc ggaggctatg gggccctacg tcttccttct
     1501 atttgcggtc ctcctgctgg gcttcttcat cttcaccttc ttaagagtac ctgaaactcg
     1561 aggccggacg tttgaccaga tctcagctgc cttccaccgg acaccctctc ttttagagca
     1621 ggaggtgaaa cccagcacag aacttgagta tttagggcca gatgagaacg actgaggggc
     1681 caggcagggg tgggagagcc agctctctct acccggccca gagacccctt cctttcctct
     1741 gcagcacttt aaccctctct tccctattat ttccgggtgg aaaagaatcc ctgcagcctg
     1801 gtagaattgg gaagctgggg gaagggtggt ctgagcaccc cctcattccc ctcgtgtgac
     1861 tctcttggat tatttatgtg ttgtggtttg gccgtggcca tcagggtggg ccactctccc
     1921 ctccctcttc cttcccccat cccctttcct ccccaccttc cccagactca gctccagaat
     1981 accttcttcg ctgctagaga agggggattg gagggaagac aggtctagac tttctcagtg
     2041 ggacaaacca gagcagagag caggacagga gacaagaaat ccagtttccc accaccttgg
     2101 actcctccca caatctggga ctttcact
//