LOCUS       HUMANDREC               3569 bp    mRNA    linear   HUM 31-OCT-1994
DEFINITION  Human androgen receptor (AR) mRNA, complete cds.
ACCESSION   M20132 J03180
VERSION     M20132.1
KEYWORDS    androgen receptor.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 3569)
  AUTHORS   Lubahn,D.B., Joseph,D.R., Sar,M., Tan,J., Higgs,H.N., Larson,R.E.,
            French,F.S. and Wilson,E.M.
  TITLE     The human androgen receptor: complementary deoxyribonucleic acid
            cloning, sequence analysis and gene expression in prostate
  JOURNAL   Mol. Endocrinol. 2 (12), 1265-1275 (1988)
   PUBMED   3216866
COMMENT     Original source text: Human, epididymal cDNA to mRNA, clones
            ARHEL[1-3] and ARHFL1.
            Draft entry and computer readable sequence [1] kindly submitted by
            E.M.Wilson, 18-AUG-1988.
FEATURES             Location/Qualifiers
     source          1..3569
                     /db_xref="H-InvDB:HIT000194715"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /map="Xq11.2-q12"
     gene            1..3569
                     /gene="AR"
     CDS             363..3122
                     /gene="AR"
                     /note="androgen receptor"
                     /codon_start=1
                     /protein_id="AAA51729.1"
                     /db_xref="GI:178628"
                     /db_xref="GDB:G00-120-556"
                     /translation="MEVQLGLGRVYPRPPSKTYRGAFQNLFQSVREVIQNPGPRHPEA
                     ASAAPPGASLLLLQQQQQQQQQQQQQQQQQQQQQETSPRQQQQQQGEDGSPQAHRRGP
                     TGYLVLDEEQQPSQPQSALECHPERGCVPEPGAAVAASKGLPQQLPAPPDEDDSAAPS
                     TLSLLGPTFPGLSSCSADLKDILSEASTMQLLQQQQQEAVSEGSSSGRAREASGAPTS
                     SKDNYLGGTSTISDNAKELCKAVSVSMGLGVEALEHLSPGEQLRGDCMYAPLLGVPPA
                     VRPTPCAPLAECKGSLLDDSAGKSTEDTAEYSPFKGGYTKGLEGESLGCSGSAAAGSS
                     GTLELPSTLSLYKSGALDEAAAYQSRDYYNFPLALAGPPPPPPPPHPHARIKLENPLD
                     YGSAWAAAAAQCRYGDLASLHGAGAAGPGSGSPSAAASSSWHTLFTAEEGQLYGPCGG
                     GGGGGGGGGGGGGGGGGGGGGGEAGAVAPYGYTRPPQGLAGQESDFTAPDVWYPGGMV
                     SRVPYPSPTCVKSEMGPWMDSYSGPYGDMRLETARDHVLPIDYYFPPQKTCLICGDEA
                     SGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGM
                     TLGARKLKKLGNLKLQEEGEASSTTSPTEETTQKLTVSHIEGYECQPIFLNVLEAIEP
                     GVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYS
                     WMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQ
                     ITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRF
                     YQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPI
                     YFHTQ"
BASE COUNT          796 a         1009 c          974 g          790 t
ORIGIN      
        1 taataactca gttcttattt gcacctactt cagtggacac tgaatttgga aggtggagga
       61 ttttgttttt ttcttttaag atctgggcat cttttgaatc tacccttcaa gtattaagag
      121 acagactgtg agcctagcag ggcagatctt gtccaccgtg tgtcttcttc tgcacgagac
      181 tttgaggctg tcagagcgct ttttgcgtgg ttgctcccgc aagtttcctt ctctggagct
      241 tcccgcaggt gggcagctag ctgcagcgac taccgcatca tcacagcctg ttgaactctt
      301 ctgagcaaga gaaggggagg cggggtaagg gaagtaggtg gaagattcag ccaagctcaa
      361 ggatggaagt gcagttaggg ctgggaaggg tctaccctcg gccgccgtcc aagacctacc
      421 gaggagcttt ccagaatctg ttccagagcg tgcgcgaagt gatccagaac ccgggcccca
      481 ggcacccaga ggccgcgagc gcagcacctc ccggcgccag tttgctgctg ctgcagcagc
      541 agcagcagca gcagcagcag cagcagcagc agcagcagca gcagcagcag cagcaagaga
      601 ctagccccag gcagcagcag cagcagcagg gtgaggatgg ttctccccaa gcccatcgta
      661 gaggccccac aggctacctg gtcctggatg aggaacagca accttcacag ccgcagtcgg
      721 ccctggagtg ccaccccgag agaggttgcg tcccagagcc tggagccgcc gtggccgcca
      781 gcaaggggct gccgcagcag ctgccagcac ctccggacga ggatgactca gctgccccat
      841 ccacgttgtc cctgctgggc cccactttcc ccggcttaag cagctgctcc gctgacctta
      901 aagacatcct gagcgaggcc agcaccatgc aactccttca gcaacagcag caggaagcag
      961 tatccgaagg cagcagcagc gggagagcga gggaggcctc gggggctccc acttcctcca
     1021 aggacaatta cttagggggc acttcgacca tttctgacaa cgccaaggag ttgtgtaagg
     1081 cagtgtcggt gtccatgggc ctgggtgtgg aggcgttgga gcatctgagt ccaggggaac
     1141 agcttcgggg ggattgcatg tacgccccac ttttgggagt tccacccgct gtgcgtccca
     1201 ctccttgtgc cccattggcc gaatgcaaag gttctctgct agacgacagc gcaggcaaga
     1261 gcactgaaga tactgctgag tattcccctt tcaagggagg ttacaccaaa gggctagaag
     1321 gcgagagcct aggctgctct ggcagcgctg cagcagggag ctccgggaca cttgaactgc
     1381 cgtctaccct gtctctctac aagtccggag cactggacga ggcagctgcg taccagagtc
     1441 gcgactacta caactttcca ctggctctgg ccggaccgcc gccccctccg ccgcctcccc
     1501 atccccacgc tcgcatcaag ctggagaacc cgctggacta cggcagcgcc tgggcggctg
     1561 cggcggcgca gtgccgctat ggggacctgg cgagcctgca tggcgcgggt gcagcgggac
     1621 ccggttctgg gtcaccctca gccgccgctt cctcatcctg gcacactctc ttcacagccg
     1681 aagaaggcca gttgtatgga ccgtgtggtg gtggtggggg tggtggcggc ggcggcggcg
     1741 gcggcggcgg cggcggcggc ggcggcggcg gcggcggcga ggcgggagct gtagccccct
     1801 acggctacac tcggccccct caggggctgg cgggccagga aagcgacttc accgcacctg
     1861 atgtgtggta ccctggcggc atggtgagca gagtgcccta tcccagtccc acttgtgtca
     1921 aaagcgaaat gggcccctgg atggatagct actccggacc ttacggggac atgcgtttgg
     1981 agactgccag ggaccatgtt ttgcccattg actattactt tccaccccag aagacctgcc
     2041 tgatctgtgg agatgaagct tctgggtgtc actatggagc tctcacatgt ggaagctgca
     2101 aggtcttctt caaaagagcc gctgaaggga aacagaagta cctgtgcgcc agcagaaatg
     2161 attgcactat tgataaattc cgaaggaaaa attgtccatc ttgtcgtctt cggaaatgtt
     2221 atgaagcagg gatgactctg ggagcccgga agctgaagaa acttggtaat ctgaaactac
     2281 aggaggaagg agaggcttcc agcaccacca gccccactga ggagacaacc cagaagctga
     2341 cagtgtcaca cattgaaggc tatgaatgtc agcccatctt tctgaatgtc ctggaagcca
     2401 ttgagccagg tgtagtgtgt gctggacacg acaacaacca gcccgactcc tttgcagcct
     2461 tgctctctag cctcaatgaa ctgggagaga gacagcttgt acacgtggtc aagtgggcca
     2521 aggccttgcc tggcttccgc aacttacacg tggacgacca gatggctgtc attcagtact
     2581 cctggatggg gctcatggtg tttgccatgg gctggcgatc cttcaccaat gtcaactcca
     2641 ggatgctcta cttcgcccct gatctggttt tcaatgagta ccgcatgcac aagtcccgga
     2701 tgtacagcca gtgtgtccga atgaggcacc tctctcaaga gtttggatgg ctccaaatca
     2761 ccccccagga attcctgtgc atgaaagcac tgctactctt cagcattatt ccagtggatg
     2821 ggctgaaaaa tcaaaaattc tttgatgaac ttcgaatgaa ctacatcaag gaactcgatc
     2881 gtatcattgc atgcaaaaga aaaaatccca catcctgctc aagacgcttc taccagctca
     2941 ccaagctcct ggactccgtg cagcctattg cgagagagct gcatcagttc acttttgacc
     3001 tgctaatcaa gtcacacatg gtgagcgtgg actttccgga aatgatggca gagatcatct
     3061 ctgtgcaagt gcccaagatc ctttctggga aagtcaagcc catctatttc cacacccagt
     3121 gaagcattgg aaaccctatt tccccacccc agctcatgcc ccctttcaga tgtcttctgc
     3181 ctgttataac tctgcactac tcctctgcag tgccttgggg aatttcctct attgatgtac
     3241 agtctgtcat gaacatgttc ctgaattcta tttgctgggc tttttttttc tctttctctc
     3301 ctttcttttt cttcttccct ccctatctaa ccctcccatg gcaccttcag actttgcttc
     3361 ccattgtggc tcctatctgt gttttgaatg gtgttgtatg cctttaaatc tgtgatgatc
     3421 ctcatatggc ccagtgtcaa gttgtgcttg tttacagcac tactctgtgc cagccacaca
     3481 aacgtttact tatcttatgc cacgggaagt ttagagagct aagattatct ggggaaatca
     3541 aaacaaaaaa caagcaaaca aaaaaaaaa
//