LOCUS       HUMMCR                  5749 bp    mRNA    linear   HUM 07-JAN-1995
DEFINITION  Human mineralocorticoid receptor mRNA (hMR), complete cds.
ACCESSION   M16801
VERSION     M16801.1
KEYWORDS    mineralocorticoid receptor; steroid receptor.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 5749)
  AUTHORS   Arriza,J.L., Weinberger,C., Cerelli,G., Glaser,T.M., Handelin,B.L.,
            Housman,D.E. and Evans,R.M.
  TITLE     Cloning of human mineralocorticoid receptor complementary DNA:
            structural and functional kinship with the glucocorticoid receptor
  JOURNAL   Science 237 (4812), 268-275 (1987)
   PUBMED   3037703
COMMENT     Original source text: Human kidney cDNA to mRNA, clones
            lambda-hk[10,2].
            Draft entry and clean copy of sequence [1] kindly provided by
            J.L.Arriza, (25-AUG-1987).
FEATURES             Location/Qualifiers
     source          1..5749
                     /db_xref="H-InvDB:HIT000194482"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /map="4q31"
     gene            1..5749
                     /gene="MLR"
     mRNA            1..5749
                     /gene="MLR"
                     /product="mineralocorticoid receptor mRNA"
     CDS             217..3171
                     /gene="MLR"
                     /note="mineralocorticoid receptor"
                     /codon_start=1
                     /protein_id="AAA59571.1"
                     /db_xref="GI:307166"
                     /db_xref="GDB:G00-120-188"
                     /translation="METKGYHSLPEGLDMERRWGQVSQAVERSSLGPTERTDENNYME
                     IVNVSCVSGAIPNNSTQGSSKEKQELLPCLQQDNNRPGILTSDIKTELESKELSATVA
                     ESMGLYMDSVRDADYSYEQQNQQGSMSPAKIYQNVEQLVKFYKGNGHRPSTLSCVNTP
                     LRSFMSDSGSSVNGGVMRAIVKSPIMCHEKSPSVCSPLNMTSSVCSPAGINSVSSTTA
                     SFGSFPVHSPITQGTPLTCSPNAENRGSRSHSPAHASNVGSPLSSPLSSMKSSISSPP
                     SHCSVKSPVSSPNNVTLRSSVSSPANINNSRCSVSSPSNTNNRSTLSSPAASTVGSIC
                     SPVNNAFSYTASGTSAGSSTLRDVVPSPDTQEKGAQEVPFPKTEEVESAISNGVTGQL
                     NIVQYIKPEPDGAFSSSCLGGNSKINSDSSFSVPIKQESTKHSCSGTSFKGNPTVNPF
                     PFMDGSYFSFMDDKDYYSLSGILGPPVPGFDGNCEGSGFPVGIKQEPDDGSYYPEASI
                     PSSAIVGVNSGGQSFHYRIGAQGTISLSRSARDQSFQHLSSFPPVNTLVESWKSHGDL
                     SSRRSDGYPVLEYIPENVSSSTLRSVSTGSSRPSKICLVCGDEASGCHYGVVTCGSCK
                     VFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRLQKCLQAGMNLGARKSKKLGKLK
                     GIHEEQPQQQQPPPPPPPPQSPEEGTTYIAPAKEPSVNTALVPQLSTISRALTPSPVM
                     VLENIEPEIVYAGYDSSKPDTAENLLSTLNRLAGKQMIQVVKWAKVLPGFKNLPLEDQ
                     ITLIQYSWMCLSSFALSWRSYKHTNSQFLYFAPDLVFNEEKMHQSAMYELCQGMHQIS
                     LQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKSQAAFEEMRTNYIKELRKMVTKCPNNS
                     GQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRESHALKVEFPAMLVEIISDQLPKVE
                     SGNAKPLYFHRK"
BASE COUNT         1627 a         1268 c         1255 g         1599 t
ORIGIN      73 bp upstream of AvaI site; chromosome 4.
        1 cgcgggagcc aacttcaggc tgctcagagg aagcccgtgc agtcagtcac ctgggtgcaa
       61 gagcgttgct gcctcgggct ctcccgctgc agggagagcg gcactcgctg gcctggatgt
      121 ggttggattt aggggggctc cgcagcaggg gtttcgtggc ggtggcaagc gctgcaacag
      181 gtagacggcg agagacggac cccggccgag gcagggatgg agaccaaagg ctaccacagt
      241 ctccctgaag gtctagatat ggaaagacgg tggggtcaag tttctcaggc tgtggagcgt
      301 tcttccctgg gacctacaga gaggaccgat gagaataact acatggagat tgtcaacgta
      361 agctgtgttt ccggtgctat tccaaacaac agtactcaag gaagcagcaa agaaaaacaa
      421 gaactactcc cttgccttca gcaagacaat aatcggcctg ggattttaac atctgatatt
      481 aaaactgagc tggaatctaa ggaactttca gcaactgtag ctgagtccat gggtttatat
      541 atggattctg taagagatgc tgactattcc tatgagcagc agaaccaaca aggaagcatg
      601 agtccagcta agatttatca gaatgttgaa cagctggtga aattttacaa aggaaatggc
      661 catcgtcctt ccactctaag ttgtgtgaac acgcccttga gatcatttat gtctgactct
      721 gggagctccg tgaatggtgg cgtcatgcgc gccattgtta aaagccctat catgtgtcat
      781 gagaaaagcc cgtctgtttg cagccctctg aacatgacat cttcggtttg cagccctgct
      841 ggaatcaact ctgtgtcctc caccacagcc agctttggca gttttccagt gcacagccca
      901 atcacccagg gaactcctct gacatgctcc cctaatgctg aaaatcgagg ctccaggtcg
      961 cacagccctg cacatgctag caatgtgggc tctcctctct caagtccgtt aagtagcatg
     1021 aaatcctcaa tttccagccc tccaagtcac tgcagtgtaa aatctccagt ctccagtccc
     1081 aataatgtca ctctgagatc ctctgtgtct agccctgcaa atattaacaa ctcaaggtgc
     1141 tctgtttcca gcccttcgaa cactaataac agatccacgc tttccagtcc ggcagccagt
     1201 actgtgggat ctatctgtag ccctgtaaac aatgccttca gctacactgc ttctggcacc
     1261 tctgctggat ccagtacatt gcgggatgtg gttcccagtc cagacacgca ggagaaaggt
     1321 gctcaagagg tcccttttcc taagactgag gaagtagaga gtgccatctc aaatggtgtg
     1381 actggccagc ttaatattgt ccagtacata aaaccagaac cagatggagc ttttagcagc
     1441 tcatgtctag gaggaaatag caaaataaat tcggattctt cattctcagt accaataaag
     1501 caagaatcaa ccaagcattc atgttcaggc acctctttta aagggaatcc aacagtaaac
     1561 ccgtttccat ttatggatgg ctcgtatttt tcctttatgg atgataaaga ctattattcc
     1621 ctatcaggaa ttttaggacc acctgtgccc ggctttgatg gtaactgtga aggcagcgga
     1681 ttcccagtgg gtattaaaca agaaccagat gacgggagct attacccaga ggccagcatc
     1741 ccttcctctg ctattgttgg ggtgaattca ggtggacagt ccttccacta caggattggt
     1801 gctcaaggta caatatcttt atcacgatcg gctagagacc aatctttcca acacctgagt
     1861 tcctttcctc ctgtcaatac tttagtggag tcatggaaat cacacggcga cctgtcgtct
     1921 agaagaagtg atgggtatcc ggtcttagaa tacattccag aaaatgtatc aagctctact
     1981 ttacgaagtg tttctactgg atcttcaaga ccttcaaaaa tatgtttggt gtgtggggat
     2041 gaggcttcag gatgccatta tggggtagtc acctgtggca gctgcaaagt tttcttcaaa
     2101 agagcagtgg aagggcaaca caactattta tgtgctggaa gaaatgattg catcattgat
     2161 aagattcgac gaaagaattg tcctgcttgc agacttcaga aatgtcttca agctggaatg
     2221 aatttaggag cacgaaagtc aaagaagttg ggaaagttaa aagggattca cgaggagcag
     2281 ccacagcagc agcagccccc acccccaccc ccacccccgc aaagcccaga ggaagggaca
     2341 acgtacatcg ctcctgcaaa agaaccctcg gtcaacacag cactggttcc tcagctctcc
     2401 acaatctcac gagcgctcac accttccccc gttatggtcc ttgaaaacat tgaacctgaa
     2461 attgtatatg caggctatga cagctcaaaa ccagatacag ccgaaaatct gctctccacg
     2521 ctcaaccgct tagcaggcaa acagatgatc caagtcgtga agtgggcaaa ggtacttcca
     2581 ggatttaaaa acttgcctct tgaggaccaa attaccctaa tccagtattc ttggatgtgt
     2641 ctatcatcat ttgccttgag ctggagatcg tacaaacata cgaacagcca atttctctat
     2701 tttgcaccag acctagtctt taatgaagag aagatgcatc agtctgccat gtatgaacta
     2761 tgccagggga tgcaccaaat cagccttcag ttcgttcgac tgcagctcac ctttgaagaa
     2821 tacaccatca tgaaagtttt gctgctacta agcacaattc caaaggatgg cctcaaaagc
     2881 caggctgcat ttgaagaaat gaggacaaat tacatcaaag aactgaggaa gatggtaact
     2941 aagtgtccca acaattctgg gcagagctgg cagaggttct accaactgac caagctgctg
     3001 gactccatgc atgacctggt gagcgacctg ctggaattct gcttctacac cttccgagag
     3061 tcccatgcgc tgaaggtaga gttccccgca atgctggtgg agatcatcag cgaccagctg
     3121 cccaaggtgg agtcggggaa cgccaagccg ctctacttcc accggaagtg actgcccgct
     3181 gcccagaaga actttgcctt aagtttccct gtgttgttcc acacccagaa ggacccaaga
     3241 aaacctgttt ttaacatgtg atggttgatt cacacttgtt caacagtttc tcaagtttaa
     3301 agtcatgtca gaggtttgga gccgggaaag ctgtttttcc gtggatttgg cgagaccaga
     3361 gcagtctgaa ggattcccca cctccaatcc cccagcgctt agaaacatgt tcctgttcct
     3421 cgggatgaaa agccatatct agtcaataac tctgattttg atattttcac agatggaaga
     3481 agttttaact atgccgtgta gtttctggta tcgttcgctt gttttaaaag ggttcaagga
     3541 ctaacgaacg ttttaaagct tacccttggt ttgcacataa aacgtatagt caatatgggg
     3601 cattaatatt cttttgttat taaaaaaaca caaaaaaata ataaaaaaat atatacagat
     3661 tcctgttgtg taataacaga actcgtggcg tggggcagca gctgcctctg agccctcgct
     3721 cgtccacggt cttctgcatc actggtatac acactcgtta gcgtccattt cttatttaat
     3781 tagaatggat aagatgatgt taaatgcctt ggtttgattt ctagtatcta ttgtgttggc
     3841 tttacaaata attttttgca gtcttttgct gtgctgtaca ttactgtatg tataaattat
     3901 gaaggacctg aaataaggta taaggatctt ttgtaaatga gacacataca aaaaaaatct
     3961 ttaatggtta ataggatgaa tgggaaagta tttttgaaag aattctattt tgctggagac
     4021 tatttaagta ctatctttgt ctaaacaagg taattttttt ttgtaaagtg caatgtcctg
     4081 catgcataat gaaccgttta cagtgtattt aagaaaggga aagctgtgcc ttttttagct
     4141 tcatatctaa tttaccatta ttttacagtc tctgttgtaa ataaccacac tgaaacctct
     4201 tcggttgtct tgaaaccttt ctactttttc tgtacttttt gttttgttct tggtctcccg
     4261 cttggggcat ttgtgggact ccagcacgtt ttctggcttc tgcttcatcc tgctccatcg
     4321 gggaatgaca cactgcggtg tctgcagctc ctggaaggtg tcatttgaca acacatgtgg
     4381 gagaggaggt ccttggagtg ctgcagcttt gggaaagcct gcctcgtttc ccttttcctc
     4441 tagaagcaga accagctcta cgagagtgag actgggaact tgatggctca gagagcatct
     4501 tttcctccca ttttagaaaa tcagattttc tcctgtggga aaaaaaaatt ccatgcactc
     4561 tctctctgtt aaagatcagc tattcccttc tgatcttgga aagaggttct gcactcctgg
     4621 aaccggtcac aggaacgcac agatcatggc aggatgcgct gggacggccc atcttggcaa
     4681 ggttcagtct gaatggcatg gagaccggga gatagagggg ttttagattt ttaaaaggta
     4741 ggttttaaaa ataagtttta tacataaaca gttttggaga aaaattacag atcatataag
     4801 caagacagtg gcactaaaat gtttaattca ttaatctgtt tgtttggcac tgatgcaatg
     4861 tatggctttt ctcttgcccc aaatcacaaa catatgtatc tttggggaaa ctaacaatat
     4921 gattgcacta aataaactac tttgaataga ggccaaatta atcttttaaa aatgatgata
     4981 atcatcaggt ttactcagtg aaatcatatt aattattttc caaaatctaa aagctgtagc
     5041 tggagaagcc catggccacg aggaagcagc aattaattag atcaacactt ttctccaggg
     5101 ttcaccatgc aggcaacatt accttgtctt tcaaaagaca cctgccttag tgcaagggga
     5161 aacctgtgaa agctgcactc agagggagga gtctttctta cataatttgc aatttcagga
     5221 atttaattta taggcagatc tttaaataca gtcaacttac ggtgcacagt aatatgaaag
     5281 ccacactttg aaggtaataa atacacagca tgcagactgg gagttgctag caaacaaatg
     5341 gcttacttac aaaagcagct tttagttcag acttagtttt tataaaatga gaattctgac
     5401 ttacttaacc aggtttggga tggagatggt ctgcatcagc tttttgtatt aacaaagtta
     5461 ctggctcttt gtgtgtctcc aggtaacttt gcttgattaa acagcaaagc catattctaa
     5521 attcactgtt gaatgcctgt cccagtccaa attgtctgtc tgctcttatt tttgtaccat
     5581 attgctctta aaaatcttgg tttggtacag ttcataattc accaaaaagt tcatataatt
     5641 taaagaaaca ctaaattagt ttaaaatgaa gcaatttata tctttatgca aaaacatatg
     5701 tctgtctttg caaaggactg taagcagatt acaataaatc ctttacttt
//