LOCUS       HUMCHEB                 2416 bp    mRNA    linear   HUM 24-APR-1996
DEFINITION  Human butyrylcholinesterase, mRNA, complete cds.
ACCESSION   M16541 J02964
VERSION     M16541.1
KEYWORDS    butyrylcholinesterase; cholinesterase.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2416)
  AUTHORS   McTiernan,C., Adkins,S., Chatonnet,A., Vaughan,T.A., Bartels,C.F.,
            Kott,M., Rosenberry,T.L., La Du,B.N. and Lockridge,O.
  TITLE     Brain cDNA clone for human cholinesterase
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 84 (19), 6682-6686 (1987)
   PUBMED   3477799
COMMENT     On Apr 25, 1996 this sequence version replaced gi:180483.
            Original source text: Human 1-day old female basal gangaglia, cDNA
            to mRNA, clones Oh57,z35, z3, z2 and z13.
            Draft entry and computer-readable copy of sequence in [1] kindly
            provided by S.Adkins, 29-JUL-1987.  ATG codons were found at
            nucleotides 7-9, 73-75, 130-132 and 190-192 but the triplet at
            bases 130-132 was confirmed as the initiation codon.
FEATURES             Location/Qualifiers
     source          1..2416
                     /db_xref="H-InvDB:HIT000194458"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /map="3q26"
     gene            1..2416
                     /gene="BCHE"
     mRNA            1..2416
                     /gene="BCHE"
                     /product="BCHE mRNA"
     CDS             130..1938
                     /gene="BCHE"
                     /note="cholinesterase (EC 3.1.1.8)"
                     /codon_start=1
                     /protein_id="AAA98113.1"
                     /db_xref="GI:180484"
                     /db_xref="GDB:G00-120-558"
                     /translation="MHSKVTIICIRFLFWFLLLCMLIGKSHTEDDIIIATKNGKVRGM
                     NLTVFGGTVTAFLGIPYAQPPLGRLRFKKPQSLTKWSDIWNATKYANSCCQNIDQSFP
                     GFHGSEMWNPNTDLSEDCLYLNVWIPAPKPKNATVLIWIYGGGFQTGTSSLHVYDGKF
                     LARVERVIVVSMNYRVGALGFLALPGNPEAPGNMGLFDQQLALQWVQKNIAAFGGNPK
                     SVTLFGESAGAASVSLHLLSPGSHSLFTRAILQSGSFNAPWAVTSLYEARNRTLNLAK
                     LTGCSRENETEIIKCLRNKDPQEILLNEAFVVPYGTPLSVNFGPTVDGDFLTDMPDIL
                     LELGQFKKTQILVGVNKDEGTAFLVYGAPGFSKDNNSIITRKEFQEGLKIFFPGVSEF
                     GKESILFHYTDWVDDQRPENYREALGDVVGDYNFICPALEFTKKFSEWGNNAFFYYFE
                     HRSSKLPWPEWMGVMHGYEIEFVFGLPLERRDNYTKAEEILSRSIVKRWANFAKYGNP
                     NETQNNSTSWPVFKSTEQKYLTLNTESTRIMTKLRAQQCRFWTSFFPKVLEMTGNIDE
                     AEWEWKAGFHRWNNYMMDWKNQFNDYTSKKESCVGL"
     sig_peptide     130..213
                     /gene="BCHE"
                     /note="cholinesterase signal peptide"
     mat_peptide     214..1935
                     /gene="BCHE"
                     /product="cholinesterase mature peptide"
BASE COUNT          774 a          431 c          478 g          733 t
ORIGIN      303 bp upstream of EcoRI site; HGML map location 3q21-qter.
        1 tactgaatgt cagtgcagtc caatttacag gctggagcag cagctgcatc ctgcatttcc
       61 ccgaagtatt acatgatttt cactccttgc aaactttacc atctttgttg cagagaatcg
      121 gaaatcaata tgcatagcaa agtcacaatc atatgcatca gatttctctt ttggtttctt
      181 ttgctctgca tgcttattgg gaagtcacat actgaagatg acatcataat tgcaacaaag
      241 aatggaaaag tcagagggat gaacttgaca gtttttggtg gcacggtaac agcctttctt
      301 ggaattccct atgcacagcc acctcttggt agacttcgat tcaaaaagcc acagtctctg
      361 accaagtggt ctgatatttg gaatgccaca aaatatgcaa attcttgctg tcagaacata
      421 gatcaaagtt ttccaggctt ccatggatca gagatgtgga acccaaacac tgacctcagt
      481 gaagactgtt tatatctaaa tgtatggatt ccagcaccta aaccaaaaaa tgccactgta
      541 ttgatatgga tttatggtgg tggttttcaa actggaacat catctttaca tgtttatgat
      601 ggcaagtttc tggctcgggt tgaaagagtt attgtagtgt caatgaacta tagggtgggt
      661 gccctaggat tcttagcttt gccaggaaat cctgaggctc cagggaacat gggtttattt
      721 gatcaacagt tggctcttca gtgggttcaa aaaaatatag cagcctttgg tggaaatcct
      781 aaaagtgtaa ctctctttgg agaaagtgca ggagcagctt cagttagcct gcatttgctt
      841 tctcctggaa gccattcatt gttcaccaga gccattctgc aaagtggatc ctttaatgct
      901 ccttgggcgg taacatctct ttatgaagct aggaacagaa cgttgaactt agctaaattg
      961 actggttgct ctagagagaa tgagactgaa ataatcaagt gtcttagaaa taaagatccc
     1021 caagaaattc ttctgaatga agcatttgtt gtcccctatg ggactccttt gtcagtaaac
     1081 tttggtccga ccgtggatgg tgattttctc actgacatgc cagacatatt acttgaactt
     1141 ggacaattta aaaaaaccca gattttggtg ggtgttaata aagatgaagg gacagctttt
     1201 ttagtctatg gtgctcctgg cttcagcaaa gataacaata gtatcataac tagaaaagaa
     1261 tttcaggaag gtttaaaaat attttttcca ggagtgagtg agtttggaaa ggaatccatc
     1321 ctttttcatt acacagactg ggtagatgat cagagacctg aaaactaccg tgaggccttg
     1381 ggtgatgttg ttggggatta taatttcata tgccctgcct tggagttcac caagaagttc
     1441 tcagaatggg gaaataatgc ctttttctac tattttgaac accgatcctc caaacttccg
     1501 tggccagaat ggatgggagt gatgcatggc tatgaaattg aatttgtctt tggtttacct
     1561 ctggaaagaa gagataatta cacaaaagcc gaggaaattt tgagtagatc catagtgaaa
     1621 cggtgggcaa attttgcaaa atatgggaat ccaaatgaga ctcagaacaa tagcacaagc
     1681 tggcctgtct tcaaaagcac tgaacaaaaa tatctaacct tgaatacaga gtcaacaaga
     1741 ataatgacga aactacgtgc tcaacaatgt cgattctgga catcattttt tccaaaagtc
     1801 ttggaaatga caggaaatat tgatgaagca gaatgggagt ggaaagcagg attccatcgc
     1861 tggaacaatt acatgatgga ctggaaaaat caatttaacg attacactag caagaaagaa
     1921 agttgtgtgg gtctctaatt aatagattta ccctttatag aacatatttt cctttagatc
     1981 aaggcaaaaa tatcaggagc ttttttacac acctactaaa aaagttatta tgtagctgaa
     2041 acaaaaatgc cagaaggata atattgattc ctcacatctt taacttagta ttttacctag
     2101 catttcaaaa cccaaatggc tagaacatgt ttaattaaat ttcacaatat aaagttctac
     2161 agttaattat gtgcatatta aaacaatggc ctggttcaat ttctttcttt ccttaataaa
     2221 tttaagtttt ttccccccaa aattatcagt gctctgcttt tagtcacgtg tattttcatt
     2281 accactcgta aaaaggtatc ttttttaaat gaattaaata ttgaaacact gtacaccata
     2341 gtttacaata ttatgtttcc taattaaaat aagaattgaa tgtcaatatg agatattaaa
     2401 ataagcacag aaaatc
//