LOCUS       APHAVP1M                 294 bp    RNA     linear   VRL 28-APR-1993
DEFINITION  Foot and mouth disease virus (serotype A) variant VP1 capsid
            protein gene, partial cds.
ACCESSION   M16093
VERSION     M16093.1
KEYWORDS    vp1; vp1 capsid protein.
SOURCE      Foot-and-mouth disease virus
  ORGANISM  Foot-and-mouth disease virus
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Picornaviridae; Caphthovirinae; Aphthovirus.
REFERENCE   1  (bases 1 to 294)
  AUTHORS   Beck,E. and Strohmaier,K.
  TITLE     Subtyping of European foot-and-mouth disease virus strains by
            nucleotide sequence determination
  JOURNAL   J. Virol. 61 (5), 1621-1629 (1987)
   PUBMED   3033288
COMMENT     Original source text: Foot and mouth disease virus (serotype
            A/Ostdeutchland(DDR)/1947), cDNA to viral RNA.
FEATURES             Location/Qualifiers
     source          1..294
                     /organism="Foot-and-mouth disease virus"
                     /mol_type="genomic RNA"
                     /db_xref="taxon:12110"
     CDS             <1..>294
                     /note="VP1 capsid protein"
                     /codon_start=1
                     /protein_id="AAA42614.1"
                     /translation="LATVYNGTSKYSASGLGPGDLGSPAARVATQLPASFNYGAIRAQ
                     TIHELLVRMKRAELYCPRPLLAIEVSSQDRHKQKIIAPAKQLLNFDLLQLAGDV"
BASE COUNT           67 a           86 c           82 g           59 t
ORIGIN      
        1 ttggcaactg tgtacaacgg gacaagcaag tactccgcga gcggtttggg accaggcgac
       61 ctggggtccc ccgcggcgcg agtcgcgaca cagcttcctg cttcttttaa ctacggtgca
      121 atcagggccc agaccatcca cgagcttctc gtgcgcatga aacgggccga gctctactgt
      181 cccaggccac tgctggcaat agaggtgtct tcgcaagaca ggcacaagca aaagatcatt
      241 gcacccgcaa aacagctgtt gaactttgac ctacttcagt tggcgggtga cgtt
//