LOCUS APHAVP1M 294 bp RNA linear VRL 28-APR-1993 DEFINITION Foot and mouth disease virus (serotype A) variant VP1 capsid protein gene, partial cds. ACCESSION M16093 VERSION M16093.1 KEYWORDS vp1; vp1 capsid protein. SOURCE Foot-and-mouth disease virus ORGANISM Foot-and-mouth disease virus Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes; Picornavirales; Picornaviridae; Caphthovirinae; Aphthovirus. REFERENCE 1 (bases 1 to 294) AUTHORS Beck,E. and Strohmaier,K. TITLE Subtyping of European foot-and-mouth disease virus strains by nucleotide sequence determination JOURNAL J. Virol. 61 (5), 1621-1629 (1987) PUBMED 3033288 COMMENT Original source text: Foot and mouth disease virus (serotype A/Ostdeutchland(DDR)/1947), cDNA to viral RNA. FEATURES Location/Qualifiers source 1..294 /organism="Foot-and-mouth disease virus" /mol_type="genomic RNA" /db_xref="taxon:12110" CDS <1..>294 /note="VP1 capsid protein" /codon_start=1 /protein_id="AAA42614.1" /translation="LATVYNGTSKYSASGLGPGDLGSPAARVATQLPASFNYGAIRAQ TIHELLVRMKRAELYCPRPLLAIEVSSQDRHKQKIIAPAKQLLNFDLLQLAGDV" BASE COUNT 67 a 86 c 82 g 59 t ORIGIN 1 ttggcaactg tgtacaacgg gacaagcaag tactccgcga gcggtttggg accaggcgac 61 ctggggtccc ccgcggcgcg agtcgcgaca cagcttcctg cttcttttaa ctacggtgca 121 atcagggccc agaccatcca cgagcttctc gtgcgcatga aacgggccga gctctactgt 181 cccaggccac tgctggcaat agaggtgtct tcgcaagaca ggcacaagca aaagatcatt 241 gcacccgcaa aacagctgtt gaactttgac ctacttcagt tggcgggtga cgtt //