LOCUS       APHAVP1C                 618 bp    RNA     linear   VRL 28-APR-1993
DEFINITION  Foot and mouth disease virus (serotype A) variant VP1 capsid
            protein gene, partial cds.
ACCESSION   M16081
VERSION     M16081.1
KEYWORDS    vp1; vp1 capsid protein.
SOURCE      Foot-and-mouth disease virus
  ORGANISM  Foot-and-mouth disease virus
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Picornaviridae; Aphthovirus.
REFERENCE   1  (bases 1 to 618)
  AUTHORS   Beck,E. and Strohmaier,K.
  TITLE     Subtyping of European foot-and-mouth disease virus strains by
            nucleotide sequence determination
  JOURNAL   J. Virol. 61 (5), 1621-1629 (1987)
   PUBMED   3033288
COMMENT     Original source text: Foot and mouth disease virus (serotype
            A5/Parma(I)/1962), cDNA to viral RNA.
FEATURES             Location/Qualifiers
     source          1..618
                     /organism="Foot-and-mouth disease virus"
                     /mol_type="genomic RNA"
                     /db_xref="taxon:12110"
     CDS             <1..>618
                     /note="VP1 capsid protein"
                     /codon_start=1
                     /protein_id="AAA42603.1"
                     /translation="YGGQTQTQRRHHTDVGFIMDRFVKINSLSPTHVIDLMQXXXHGL
                     VGALLRAATYYFSDLEIVVRHDGNLTWVPNGAPEAALSNTSNPTAYNKAPFTRLALPY
                     TAPHRVLATVYNGTNKYSTGGSRRGDTGSTTARAAKQLPASFNYGAIRADTIHELLVR
                     MKRAELYCPRPLLAIEVSSQDRHKQKIIAPAKQLLNFDLLKLAGDV"
BASE COUNT          148 a          177 c          162 g          122 t
ORIGIN      
        1 tacggcggtc agacacaaac ccagagacgg caccacacgg acgtcggttt catcatggac
       61 agatttgtga agataaacag tctgagtccc acgcatgtta ttgacctcat gcagnnnnnn
      121 nnncacgggc tggtgggtgc gctgttgcgt gcagccacgt actacttctc tgacttggag
      181 attgttgtgc ggcatgacgg caatttgact tgggtgccca atggtgcccc tgaagcagct
      241 ttgtcaaaca ccagcaaccc cactgcctac aacaaggcac cgttcacgag gctcgctctc
      301 ccttacactg cgccacaccg cgtgttggca accgtgtaca acgggacgaa caagtactcc
      361 acgggtggct cgagacgagg cgacacgggg tcgaccacgg cgcgggccgc gaaacaactt
      421 cctgcctctt ttaactacgg tgcaatcagg gccgacacca tccacgagct tctcgtgcgt
      481 atgaaacggg cagagcttta ctgccccagg ccactattgg caatagaggt gtcttcacaa
      541 gacaggcaca agcaaaagat cattgcaccc gcaaaacagc tgctgaactt tgacctactt
      601 aagttggctg gagacgtg
//