LOCUS       APHOVP1L                 300 bp    RNA     linear   VRL 28-APR-1993
DEFINITION  Foot and mouth disease virus (serotype O) variant VP1 capsid
            protein gene, partial cds.
ACCESSION   M15985
VERSION     M15985.1
KEYWORDS    vp1; vp1 capsid protein.
SOURCE      Foot-and-mouth disease virus
  ORGANISM  Foot-and-mouth disease virus
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Picornaviridae; Aphthovirus.
REFERENCE   1  (bases 1 to 300)
  AUTHORS   Beck,E. and Strohmaier,K.
  TITLE     Subtyping of European foot-and-mouth disease virus strains by
            nucleotide sequence determination
  JOURNAL   J. Virol. 61 (5), 1621-1629 (1987)
   PUBMED   3033288
COMMENT     Original source text: Foot and mouth disease virus (serotype
            O/Israel(IL)/1981), cDNA to viral RNA.
FEATURES             Location/Qualifiers
     source          1..300
                     /organism="Foot-and-mouth disease virus"
                     /mol_type="genomic RNA"
                     /db_xref="taxon:12110"
     CDS             <1..>300
                     /note="VP1 capsid protein"
                     /codon_start=1
                     /protein_id="AAA42648.1"
                     /translation="EIRRQDVSFILDKVPKDINVLLQTPAHTLVALLRAATYALLAVK
                     GNVPNGAPETALDTAKALTRLALPTAPRVLATVGNCRYGNVATNVRLQVLAQAART"
BASE COUNT           72 a           82 c           85 g           61 t
ORIGIN      
        1 gagatcagac gccaagatgt ctcattcata ttggataagg tgccaaaaga cattaatgtg
       61 ttactgcaaa cccccgctca cactctggtg gcactccttc gcgctgctac ctatgctttg
      121 ttggcggtga aaggaaacgt cccgaacggg gcgcctgaaa cagcgctgga cacagcaaag
      181 gcacttaccc ggcttgcact gcccacggca ccacgcgtgt tggctactgt tgggaactgc
      241 aggtatggta acgttgcgac caacgtgaga ctgcaagtgt tggcccaggc ggcgagaacg
//