LOCUS APHOVP1L 300 bp RNA linear VRL 28-APR-1993 DEFINITION Foot and mouth disease virus (serotype O) variant VP1 capsid protein gene, partial cds. ACCESSION M15985 VERSION M15985.1 KEYWORDS vp1; vp1 capsid protein. SOURCE Foot-and-mouth disease virus ORGANISM Foot-and-mouth disease virus Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes; Picornavirales; Picornaviridae; Aphthovirus. REFERENCE 1 (bases 1 to 300) AUTHORS Beck,E. and Strohmaier,K. TITLE Subtyping of European foot-and-mouth disease virus strains by nucleotide sequence determination JOURNAL J. Virol. 61 (5), 1621-1629 (1987) PUBMED 3033288 COMMENT Original source text: Foot and mouth disease virus (serotype O/Israel(IL)/1981), cDNA to viral RNA. FEATURES Location/Qualifiers source 1..300 /organism="Foot-and-mouth disease virus" /mol_type="genomic RNA" /db_xref="taxon:12110" CDS <1..>300 /note="VP1 capsid protein" /codon_start=1 /protein_id="AAA42648.1" /translation="EIRRQDVSFILDKVPKDINVLLQTPAHTLVALLRAATYALLAVK GNVPNGAPETALDTAKALTRLALPTAPRVLATVGNCRYGNVATNVRLQVLAQAART" BASE COUNT 72 a 82 c 85 g 61 t ORIGIN 1 gagatcagac gccaagatgt ctcattcata ttggataagg tgccaaaaga cattaatgtg 61 ttactgcaaa cccccgctca cactctggtg gcactccttc gcgctgctac ctatgctttg 121 ttggcggtga aaggaaacgt cccgaacggg gcgcctgaaa cagcgctgga cacagcaaag 181 gcacttaccc ggcttgcact gcccacggca ccacgcgtgt tggctactgt tgggaactgc 241 aggtatggta acgttgcgac caacgtgaga ctgcaagtgt tggcccaggc ggcgagaacg //