LOCUS       APHOVP1G                 375 bp    RNA     linear   VRL 28-APR-1993
DEFINITION  Foot and mouth disease virus (serotype O) variant VP1 capsid
            protein gene, partial cds.
ACCESSION   M15980
VERSION     M15980.1
KEYWORDS    vp1; vp1 capsid protein.
SOURCE      Foot-and-mouth disease virus
  ORGANISM  Foot-and-mouth disease virus
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Picornaviridae; Aphthovirus.
REFERENCE   1  (bases 1 to 375)
  AUTHORS   Beck,E. and Strohmaier,K.
  TITLE     Subtyping of European foot-and-mouth disease virus strains by
            nucleotide sequence determination
  JOURNAL   J. Virol. 61 (5), 1621-1629 (1987)
   PUBMED   3033288
COMMENT     Original source text: Foot and mouth disease virus (serotype
            O/Murchin(DDR)/1984), cDNA to viral RNA.
FEATURES             Location/Qualifiers
     source          1..375
                     /organism="Foot-and-mouth disease virus"
                     /mol_type="genomic RNA"
                     /db_xref="taxon:12110"
     CDS             <1..>375
                     /note="VP1 capsid protein"
                     /codon_start=1
                     /protein_id="AAA42642.1"
                     /translation="EIRRQDVSFIMDKVPQNINILLQIPSHTLVALLRASTYSLIAVK
                     GDVPNGAPEKALDTAKALTRLALPTAPRVLATVGECRYSRNAPNLRLQVLAQVARTPS
                     IKTRTLLMAETPRLAIEPVQTNL"
BASE COUNT           94 a          109 c           94 g           78 t
ORIGIN      
        1 gaaatcaggc gccaagacgt ctcgttcatc atggacaagg tgccgcaaaa cattaacatt
       61 ttgctccaga ttccatcaca cactttggtg gcactcctac gcgcgtccac ttactctttg
      121 atagcagtaa aaggagacgt tccaaatgga gcgcccgaaa aggcgttgga cactgctaag
      181 gcactcaccc ggcttgcact gcccaccgcg ccccgcgtgt tggcaaccgt gggtgagtgc
      241 aggtacagca gaaatgctcc caacttgaga cttcaggtgt tggctcaagt ggcgcggacg
      301 ccttccatca aaacccggac cttgcttatg gccgaaacac caaggttggc aatcgaaccg
      361 gtgcagacta atctt
//