LOCUS       APHOVP1B                 372 bp    RNA     linear   VRL 28-APR-1993
DEFINITION  Foot and mouth disease virus (serotype O) variant VP1 capsid
            protein gene, partial cds.
ACCESSION   M15975
VERSION     M15975.1
KEYWORDS    vp1; vp1 capsid protein.
SOURCE      Foot-and-mouth disease virus
  ORGANISM  Foot-and-mouth disease virus
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Picornaviridae; Aphthovirus.
REFERENCE   1  (bases 1 to 372)
  AUTHORS   Beck,E. and Strohmaier,K.
  TITLE     Subtyping of European foot-and-mouth disease virus strains by
            nucleotide sequence determination
  JOURNAL   J. Virol. 61 (5), 1621-1629 (1987)
   PUBMED   3033288
COMMENT     Original source text: Foot and mouth disease virus (serotype
            O1/Aulendorf(D)/1965), cDNA to viral RNA.
FEATURES             Location/Qualifiers
     source          1..372
                     /organism="Foot-and-mouth disease virus"
                     /mol_type="genomic RNA"
                     /db_xref="taxon:12110"
     CDS             <1..>372
                     /note="VP1 capsid protein"
                     /codon_start=1
                     /protein_id="AAA42637.1"
                     /translation="IRRQDVSFIMDKVPQNINILLQIPSHTLVALLRASTYSLIAVKG
                     DVPNGAPEKALDTAKALTRLALPTAPRVLATVGECRYSRNAPNLRLQVLAQVARTPSI
                     KTRTLLMAETPRLAIEPVQTNL"
BASE COUNT           91 a          110 c           94 g           77 t
ORIGIN      
        1 atcaggcgcc aagacgtctc gttcatcatg gacaaggtgc cgcaaaacat taacattttg
       61 ctccagattc catcacacac tttggtggcg ctcctacgcg cgtccactta ctctttgata
      121 gcagtaaaag gagacgttcc aaatggagcg cccgaaaagg cgttggacac tgctaaggca
      181 ctcacccggc ttgccctgcc caccgcgccc cgcgtgttgg caaccgtggg tgagtgcagg
      241 tacagcagaa atgctcccaa cttgagactt caggtgttgg ctcaagtggc acggacgcct
      301 tccatcaaaa cccggacctt gctgatggcc gaaacaccaa ggttggcaat cgaaccggtg
      361 cagactaatc tt
//