LOCUS       HUMAPA                  1057 bp    mRNA    linear   HUM 27-APR-1993
DEFINITION  Human amyloid protein (AD-AP) mRNA, 3' end.
ACCESSION   M15533
VERSION     M15533.1
KEYWORDS    amyloid protein.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1057)
  AUTHORS   Goldgaber,D., Lerman,M.I., McBride,O.W., Saffiotti,U. and
            Gajdusek,D.C.
  TITLE     Characterization and chromosomal localization of a cDNA encoding
            brain amyloid of Alzheimer's disease
  JOURNAL   Science 235 (4791), 877-880 (1987)
   PUBMED   3810169
COMMENT     Original source text: Human brain, cDNA to mRNA, clone lambda-Am4.
FEATURES             Location/Qualifiers
     source          1..1057
                     /db_xref="H-InvDB:HIT000194405"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     CDS             <1..294
                     /note="amyloid protein"
                     /codon_start=1
                     /protein_id="AAA35540.1"
                     /db_xref="GI:178707"
                     /translation="EFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIV
                     ITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGSENPTYKFFEQMQN"
BASE COUNT          278 a          211 c          223 g          345 t
ORIGIN      1 bp upstream of EcoRI site.
        1 gaattccgac atgactcagg atatgaagtt catcatcaaa aattggtgtt ctttgcagaa
       61 gatgtgggtt caaacaaagg tgcaatcatt ggactcatgg tgggcggtgt tgtcatagcg
      121 acagtgatcg tcatcacctt ggtgatgctg aagaagaaac agtacacatc cattcatcat
      181 ggtgtggtgg aggttgacgc cgctgtcacc ccagaggagc gccacctgtc caagatgcag
      241 cagaacggct cagaaaatcc aacctacaag ttctttgagc agatgcagaa ctagaccccc
      301 gccacagcag cctctgaagt tggacagcaa aaccattgct tcactaccca tcggtgtcca
      361 tttatagaat aatgtgggaa gaaacaaacc cgttttatga tttactcatt atcgcctttt
      421 gacagctgtg ctgtaacaca agtagatgcc tgaacttgaa ttaatccaca catcagtaat
      481 gtattctatc tctctttaca ttttggtctc tatactacat tattaatggg ttttgtgtac
      541 tgtaaagaat ttagctgtat caaactagtg catgaataga ttctctcctg attatttatc
      601 acatagcccc ttagccagtt gtatattatt cttgtggttt gtgacccaat taagtcctac
      661 tttacatatg ctttaagaat cgatggggga tgcttcatgt gaacgtgggg agttcagctg
      721 cttctcttgc ctaagtattc ctttcctgat cactatgcat tttaaagtta aacattttaa
      781 gtatttcaga tgctttagag agattttttt tccatgactg cattttactg tacagattgc
      841 tgcttctgct atatttgtga tataggaatt aagaggatac acacgtttgt ttcttcgtgc
      901 ctgttttatg tgcacacatt aggcattgag acttcaagct tttctttttt tgtccacgta
      961 tctttgggtc tttgataaag aaaagaatcc ctgttcattg taagcacttt tacggggcgg
     1021 gtggggaggg gtgctctgct ggtcttcaat taccaag
//