LOCUS       BACBRNA                  832 bp    DNA     linear   BCT 01-FEB-1996
DEFINITION  B.amyloliquefaciens barnase gene, complete cds.
ACCESSION   M14442
VERSION     M14442.1
KEYWORDS    barnase; ribonuclease.
SOURCE      Bacillus amyloliquefaciens
  ORGANISM  Bacillus amyloliquefaciens
            Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus;
            Bacillus amyloliquefaciens group.
REFERENCE   1  (bases 1 to 832)
  AUTHORS   Paddon,C.J. and Hartley,R.W.
  TITLE     Cloning, sequencing and transcription of an inactivated copy of
            Bacillus amyloliquefaciens extracellular ribonuclease (barnase)
  JOURNAL   Gene 40 (2-3), 231-239 (1985)
   PUBMED   3007290
REFERENCE   2  (bases 181 to 420)
  AUTHORS   Paddon,C.J., Vasantha,N. and Hartley,R.W.
  TITLE     Translation and processing of Bacillus amyloliquefaciens
            extracellular RNase
  JOURNAL   J. Bacteriol. 171 (2), 1185-1187 (1989)
   PUBMED   2914867
REFERENCE   3  (bases 1 to 779)
  AUTHORS   Hartley,R.W.
  TITLE     Direct Submission
  JOURNAL   Submitted (14-JUL-1988) Robert W. Hartley, LCDB/NIDDK, National
            Institutes of Health, Bethesda, MD 20892, USA
REFERENCE   4  (bases 1 to 832)
  AUTHORS   Hartley,R.W.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-JAN-1996) Robert W. Hartley, LCDB/NIDDK, National
            Institutes of Health, Bethesda, MD 20892, USA
COMMENT     On Feb 1, 1996 this sequence version replaced gi:142614.
            [2]  translation start sites.
            Pro I barnase is cleaved to form pro II barnase (positions 391-735)
            after which it is cleaved again to form the mature peptide.
FEATURES             Location/Qualifiers
     source          1..832
                     /organism="Bacillus amyloliquefaciens"
                     /mol_type="genomic DNA"
                     /strain="H2R1"
                     /db_xref="taxon:1390"
                     /map="195 bp upstream of RsaI site"
                     /clone="pMT6"
     CDS             286..735
                     /codon_start=1
                     /transl_table=11
                     /product="barnase (RNase) precursor"
                     /protein_id="AAA86441.1"
                     /translation="MKKRLSWISVCLLVLVSAAGMLFSTAAKTETSSHKAHTEAQVIN
                     TFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKL
                     PGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR"
     sig_peptide     286..363
     mat_peptide     403..732
                     /product="barnase"
     regulatory      737..772
                     /regulatory_class="terminator"
                     /note="transcription terminator"
BASE COUNT          259 a          181 c          175 g          217 t
ORIGIN      
        1 ctggaaaacg tcacattgct tccgcatatc gggtcagcaa cggctaaaat ccgcttgaat
       61 atgttcacac aagccgctca aaacatgatt gacgccgtat acggaagaac gccgaaaaac
      121 cttactaagg aatttcaata agaagaaaaa tcccggttgg ttcagccggg gtttattttt
      181 cgctagataa aaagtactat ttttaaattc tttctattcc tttctttcgt tgctgataca
      241 atgaaaagga atcagcttca catgatgaaa atgggaggta ttgctttgaa aaaacgatta
      301 tcgtggattt ccgtttgttt actggtgctt gtctccgcgg cggggatgct gttttcaaca
      361 gctgccaaaa cggaaacatc ttctcacaag gcacacacag aagcacaggt tatcaacacg
      421 tttgacgggg ttgcggatta tcttcagaca tatcataagc tacctgataa ttacattaca
      481 aaatcagaag cacaagccct cggctgggtg gcatcaaaag ggaaccttgc agacgtcgct
      541 ccggggaaaa gcatcggcgg agacatcttc tcaaacaggg aaggcaaact cccgggcaaa
      601 agcggacgaa catggcgtga agcggatatt aactatacat caggcttcag aaattcagac
      661 cggattcttt actcaagcga ctggctgatt tacaaaacaa cggaccatta tcagaccttt
      721 acaaaaatca gataacgaaa aaaacggctt ccctgcggag gccgtttttt tcagctttac
      781 ataaagtgtg taataaattt ttcttcaaac tctgatcggt caatttcact tt
//