LOCUS CPVWPV 1468 bp DNA linear VRL 02-AUG-1993
DEFINITION Cowpox virus white-pock variant (CPV-W2) (crmA) gene, complete cds.
ACCESSION M14217
VERSION M14217.1
KEYWORDS .
SOURCE Cowpox virus
ORGANISM Cowpox virus
Viruses; Varidnaviria; Bamfordvirae; Nucleocytoviricota;
Pokkesviricetes; Chitovirales; Poxviridae; Chordopoxvirinae;
Orthopoxvirus.
REFERENCE 1 (bases 1 to 1468)
AUTHORS Pickup,D.J., Ink,B.S., Hu,W., Ray,C.A. and Joklik,W.K.
TITLE Hemorrhage in lesions caused by cowpox virus is induced by a viral
protein that is related to plasma protein inhibitors of serine
proteases
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 83 (20), 7698-7702 (1986)
PUBMED 3532120
REFERENCE 2 (bases 1 to 1468)
AUTHORS Ink,B.S. and Pickup,D.J.
TITLE Transcription of a poxvirus early gene is regulated both by a short
promoter element and by a transcriptional termination signal
controlling transcriptional interference
JOURNAL J. Virol. 63 (11), 4632-4644 (1989)
PUBMED 2795715
REFERENCE 3 (bases 1 to 1468)
AUTHORS Palumbo,G.J., Pickup,D.J., Fredrickson,T.N., McIntyre,L.J. and
Buller,R.M.
TITLE Inhibition of an inflammatory response is mediated by a 38-kDa
protein of cowpox virus
JOURNAL Virology 172 (1), 262-273 (1989)
PUBMED 2773318
REFERENCE 4 (bases 1 to 1468)
AUTHORS Ray,C.A., Black,R.A., Kronheim,S.R., Greenstreet,T.A., Sleath,P.R.,
Salvesen,G.S. and Pickup,D.J.
TITLE Viral inhibition of inflammation: cowpox virus encodes an inhibitor
of the interleukin-1 beta converting enzyme
JOURNAL Cell 69 (4), 597-604 (1992)
PUBMED 1339309
REFERENCE 5 (bases 1 to 1468)
AUTHORS Palumbo,G.J., Glasgow,W.C. and Buller,R.M.
TITLE Poxvirus-induced alteration of arachidonate metabolism
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 90 (5), 2020-2024 (1993)
PUBMED 8383332
COMMENT Original source text: Cowpox virus (strain W2), DNA.
FEATURES Location/Qualifiers
source 1..1468
/organism="Cowpox virus"
/mol_type="genomic DNA"
/db_xref="taxon:10243"
gene 295..1320
/gene="crmA"
CDS 295..1320
/gene="crmA"
/citation=[1]
/citation=[3]
/citation=[4]
/codon_start=1
/product="early protein"
/protein_id="AAA42922.1"
/translation="MDIFREIASSMKGENVFISPPSISSVLTILYYGANGSTAEQLSK
YVEKEADKNKDDISFKSMNKVYGRYSAVFKDSFLRKIGDNFQTVDFTDCRTVDAINKC
VDIFTEGKINPLLDEPLSPDTCLLAISAVYFKAKWLMPFEKEFTSDYPFYVSPTEMVD
VSMMSMYGEAFNHASVKESFGNFSIIELPYVGDTSMVVILPDNIDGLESIEQNLTDTN
FKKWCDSMDAMFIDVHIPKFKVTGSYNLVDALVKLGLTEVFGSTGDYSNMCNSDVSVD
AMIHKTYIDVNEEYTEAAAATCALVADCASTVTNEFCADHPFIYVIRHVDGKILFVGR
YCSPTTN"
BASE COUNT 493 a 231 c 287 g 457 t
ORIGIN
1 tccatggaag aacgaaagta gtataaaagt aataaaacaa aaaaaagaat ataaaaaatt
61 tatagccact ttctttgagg actgttttcc tgaaggaaat gaacctctgg aattagttag
121 atatatagaa ttagtataca cgctagatta ttctcaaact cctaattatg acagactacg
181 tagactgttt atacaagatt gaaaatatat ttctttttat tgagtggtgg tagttacgga
241 tatctaatat taatattaga ctatctctat cgtcacacaa caaaatcgat tgccatggat
301 atcttcaggg aaatcgcatc ttctatgaaa ggagagaatg tattcatttc tccaccgtca
361 atctcgtcag tattgacaat actgtattat ggagctaatg gatccactgc tgaacagcta
421 tcaaaatatg tagaaaagga ggcggacaag aataaggatg atatctcatt caagtccatg
481 aataaagtat atgggcgata ttctgcagtg tttaaagatt cctttttgag aaaaattgga
541 gataatttcc aaactgttga cttcactgat tgtcgcactg tagatgcgat caacaagtgt
601 gttgatatct tcactgaggg gaaaattaat ccactattgg atgaaccatt gtctccagat
661 acctgtctcc tagcaattag tgccgtatac tttaaagcaa aatggttgat gccatttgaa
721 aaggaattta ccagtgatta tcccttttac gtatctccaa cggaaatggt agatgtaagt
781 atgatgtcta tgtacggcga ggcatttaat cacgcatctg taaaagaatc attcggcaac
841 ttttcaatca tagaactgcc atatgttgga gatactagta tggtggtaat tcttccagac
901 aatattgatg gactagaatc catagaacaa aatctaacag atacaaattt taagaaatgg
961 tgtgactcta tggatgctat gtttatcgat gtgcacattc ccaagtttaa ggtaacaggc
1021 tcgtataatc tggtggatgc gctagtaaag ttgggactga cagaggtgtt cggttcaact
1081 ggagattata gcaatatgtg taattcagat gtgagtgtcg acgctatgat ccacaaaacg
1141 tatatagatg tcaatgaaga gtatacagaa gcagctgcag caacttgtgc gctggtggca
1201 gactgtgcat caacagttac aaatgagttc tgtgcagatc atccgttcat ctatgtgatt
1261 aggcatgtcg atggcaaaat tcttttcgtt ggtagatatt gctctccaac aactaattaa
1321 atcacattct taatattaga atattagaat attatatagt taagattttt actaattggt
1381 taaccatttt tttaaaaaaa tagaaaaaaa acatgttata ttagcgaggg tcgttattct
1441 tccaattgca attggtaaga tgacggcc
//