LOCUS       HUMHLACFO               1413 bp    mRNA    linear   HUM 08-NOV-1994
DEFINITION  Human MHC class I HLA-C allele HLA-4, partial cds.
ACCESSION   M11886
VERSION     M11886.1
KEYWORDS    cell surface glycoprotein; class I gene; integral membrane
            glycoprotein; major histocompatibility complex.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1413)
  AUTHORS   Davidson,W.F., Kress,M., Khoury,G. and Jay,G.
  TITLE     Comparison of HLA class I gene sequences. Derivation of
            locus-specific oligonucleotide probes specific for HLA-A, HLA-B,
            and HLA-C genes
  JOURNAL   J. Biol. Chem. 260 (25), 13414-13423 (1985)
   PUBMED   3863816
COMMENT     Original source text: Homo sapiens liver cDNA to mRNA.
FEATURES             Location/Qualifiers
     source          1..1413
                     /db_xref="H-InvDB:HIT000194133"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /map="6p21.3"
                     /tissue_type="liver"
     gene            1..1413
                     /gene="HLA-C"
     mRNA            <1..1413
                     /gene="HLA-C"
                     /product="HLA-4 transplantation antigen, mRNA"
     CDS             <1..1029
                     /gene="HLA-C"
                     /note="HLA-4 transplantation antigen"
                     /codon_start=1
                     /product="transplantation antigen"
                     /protein_id="AAA52665.1"
                     /db_xref="GI:386777"
                     /db_xref="GDB:G00-119-311"
                     /translation="CSHSMRYFDTAVSRPGAGEPRFISVGYVDDTQFVRFDSDAASPR
                     GEPRAPWVEQEGPEYWDRETQKYKRQAQADRVSLRNLRGYYNQSEDGSHTLQRMSGCD
                     LGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARAAEQLRAYL
                     EGLCVEWLRRYLENGKETLQRAEPPKTHVTHHPLSDHEATLRCWALGFYPAEITLTWQ
                     RDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHMQHEGLQEPLTLSWEP
                     SSQPTIPIMGIVAGLAVLVVLAVLGAVVTAMMCRRKSSGGKGGSCSQAACSNSAQGSD
                     ESLITCKA"
BASE COUNT          296 a          415 c          429 g          273 t
ORIGIN      Chromosome 6p21.3.
        1 tgctcccact ccatgaggta tttcgacacc gccgtgtccc ggcccggcgc cggagagccc
       61 cgcttcatct cagtgggcta cgtggacgac acgcagttcg tgcggttcga cagcgacgcc
      121 gcgagtccga gaggggagcc gcgggcgccg tgggtggagc aggaggggcc ggagtattgg
      181 gaccgggaga cacagaagta caagcgccag gcacaggctg accgagtgag cctgcggaac
      241 ctgcgcggct actacaacca gagcgaggac gggtctcaca ccctccagag gatgtctggc
      301 tgcgacctgg ggcccgacgg gcgcctcctc cgcgggtatg accagtccgc ctacgacggc
      361 aaggattaca tcgccctgaa cgaggacctg cgctcctgga ccgcggcgga caccgcggct
      421 cagatcaccc agcgcaagtg ggaggcggcc cgtgcggcgg agcagctgag agcctacctg
      481 gagggactgt gcgtggagtg gctccgcaga tacctggaga acgggaagga gacgctgcag
      541 cgcgcagaac ccccaaagac acacgtgacc caccaccccc tctctgacca tgaggccacc
      601 ctgaggtgct gggccctggg cttctaccct gcggagatca cactgacctg gcagcgggat
      661 ggggaggacc agacccagga caccgagctt gtggagacca ggccagcagg agatggaacc
      721 ttccagaagt gggcagctgt ggtggtgcct tctggacaag agcagagata cacgtgccat
      781 atgcagcacg aggggctgca agagcccctc accctgagct gggagccatc ttcccagccc
      841 accatcccca tcatgggcat cgttgctggc ctggctgtcc tggttgtcct agctgtcctt
      901 ggagctgtgg tcaccgctat gatgtgtagg aggaagagct caggtggaaa aggagggagc
      961 tgctctcagg ctgcgtgcag caacagtgcc cagggctctg atgagtctct catcacttgt
     1021 aaagcctgag acagctgcct gtgtgggact gagatgcagg atttcttcac acctctcctt
     1081 tgtgacttca agagcctctg gcatctcttt ctgcaaaggc acctgaatgt gtctgcgttc
     1141 ctgttagcat aatgtgagga ggtggagaga cagcccaccc ccgtgtccac cgtgacccct
     1201 gtccccacac tgacctgtgt tccctccccg atcatctttc ctgttccaga gaggtggggc
     1261 tggatgtctc catctctgtc tcaaattcat ggtgcactga gctgcaactt cttacttccc
     1321 taatgaagtt aagaacctga atataaattt gtgttctcaa atatttgcta tgaagcgttg
     1381 atggattaat taaataagtc aattcctaaa aac
//