LOCUS       RSH1CE                  8510 bp    RNA     linear   VRL 29-NOV-2000
DEFINITION  Human respiratory syncytial virus nonstructural protein (1C),
            nonstructural protein (1B), major nucleocapsid (N), phosphoprotein
            (P), protein (M), 1A (1A), G (G), protein (F) and
            envelope-associated protein (22K) gene, complete cds.
ACCESSION   M11486 K01459 K02719 K03348 K03349 M11217 M11244 M11487 M11505
            M11514 M11631 M12966
VERSION     M11486.1
KEYWORDS    envelope-associated protein; fusion glycoprotein; major
            nucleocapsid protein; major surface glycoprotein; matrix protein;
            nonstructural protein; phosphoprotein.
SOURCE      Human orthopneumovirus (HRSV)
  ORGANISM  Human orthopneumovirus
            Viruses; ssRNA viruses; ssRNA negative-strand viruses;
            Mononegavirales; Pneumoviridae; Orthopneumovirus.
REFERENCE   1  (bases 1085 to 2220; 5254 to 5544)
  AUTHORS   Elango,N. and Venkatesan,S.
  TITLE     Amino acid sequence of human respiratory syncytial virus
            nucleocapsid protein
  JOURNAL   Nucleic Acids Res. 11 (17), 5941-5951 (1983)
   PUBMED   6310521
REFERENCE   2  (bases 3211 to 4157)
  AUTHORS   Satake,M. and Venkatesan,S.
  TITLE     Nucleotide sequence of the gene encoding respiratory syncytial
            virus matrix protein
  JOURNAL   J. Virol. 50 (1), 92-99 (1984)
   PUBMED   6699948
REFERENCE   3  (bases 2288 to 3191)
  AUTHORS   Satake,M., Elango,N. and Venkatesan,S.
  TITLE     Sequence analysis of the respiratory syncytial virus phosphoprotein
            gene
  JOURNAL   J. Virol. 52 (3), 991-994 (1984)
   PUBMED   6548527
REFERENCE   4  (bases 5602 to 7500)
  AUTHORS   Collins,P.L., Huang,Y.T. and Wertz,G.W.
  TITLE     Nucleotide sequence of the gene encoding the fusion (F)
            glycoprotein of human respiratory syncytial virus
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 81 (24), 7683-7687 (1984)
   PUBMED   6096849
REFERENCE   5  (bases 7551 to 8510)
  AUTHORS   Collins,P.L. and Wertz,G.W.
  TITLE     The envelope-associated 22K protein of human respiratory syncytial
            virus: nucleotide sequence of the mRNA and a related polytranscript
  JOURNAL   J. Virol. 54 (1), 65-71 (1985)
   PUBMED   3838351
REFERENCE   6  (bases 8 to 1050; 7554 to 8506)
  AUTHORS   Elango,N., Satake,M. and Venkatesan,S.
  TITLE     mRNA sequence of three respiratory syncytial virus genes encoding
            two nonstructural proteins and a 22K structural protein
  JOURNAL   J. Virol. 55 (1), 101-110 (1985)
   PUBMED   4009789
REFERENCE   7  (bases 5602 to 7423)
  AUTHORS   Elango,N., Satake,M., Coligan,J.E., Norrby,E., Camargo,E. and
            Venkatesan,S.
  TITLE     Respiratory syncytial virus fusion glycoprotein: nucleotide
            sequence of mRNA, identification of cleavage activation site and
            amino acid sequence of N-terminus of F1 subunit
  JOURNAL   Nucleic Acids Res. 13 (5), 1559-1574 (1985)
   PUBMED   2987829
REFERENCE   8  (bases 4630 to 5543)
  AUTHORS   Satake,M., Coligan,J.E., Elango,N., Norrby,E. and Venkatesan,S.
  TITLE     Respiratory syncytial virus envelope glycoprotein (G) has a novel
            structure
  JOURNAL   Nucleic Acids Res. 13 (21), 7795-7812 (1985)
   PUBMED   4069997
REFERENCE   9  (bases 4627 to 5544)
  AUTHORS   Wertz,G.W., Collins,P.L., Huang,Y., Gruber,C., Levine,S. and
            Ball,L.A.
  TITLE     Nucleotide sequence of the G protein gene of human respiratory
            syncytial virus reveals an unusual type of viral membrane protein
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 82 (12), 4075-4079 (1985)
   PUBMED   3858865
REFERENCE   10  (bases 4173 to 4571)
  AUTHORS   Collins,P.L. and Wertz,G.W.
  TITLE     The 1A protein gene of human respiratory syncytial virus:
            nucleotide sequence of the mRNA and a related polycistronic
            transcript
  JOURNAL   Virology 141 (2), 283-291 (1985)
   PUBMED   3879976
REFERENCE   11  (bases 1 to 528; 552 to 1050)
  AUTHORS   Collins,P.L. and Wertz,G.W.
  TITLE     Nucleotide sequences of the 1B and 1C nonstructural protein mRNAs
            of human respiratory syncytial virus
  JOURNAL   Virology 143 (2), 442-451 (1985)
   PUBMED   2998021
REFERENCE   12  (bases 1081 to 2277)
  AUTHORS   Collins,P.L., Anderson,K., Langer,S.J. and Wertz,G.W.
  TITLE     Correct sequence for the major nucleocapsid protein mRNA of
            respiratory syncytial virus
  JOURNAL   Virology 146 (1), 69-77 (1985)
   PUBMED   3839952
REFERENCE   13  (bases 1051 to 1080; 2278 to 2287; 3192 to 3210; 4158 to 4172;
            4572 to 4626; 5545 to 5601; 7501 to 7578)
  AUTHORS   Collins,P.L., Dickens,L.E., Buckler-White,A., Olmsted,R.A.,
            Spriggs,M.K., Camargo,E. and Coelingh,K.V.
  TITLE     Nucleotide sequences for the gene junctions of human respiratory
            syncytial virus reveal distinctive features of intergenic structure
            and gene order
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 83 (13), 4594-4598 (1986)
   PUBMED   3460060
COMMENT     Reprint for [2] and clean copy sequence for [12],[5] kindly
            provided by P.Collins, 21-FEB-1986.
            Respiratory syncytial virus is a negative-strand RNA pleomorphic
            enveloped virus of the genus Pneumovirus.  The matrix protein has
            no homology with the matrix proteins of other negative-stranded RNA
            viruses, implying that RS virus has undergone extensive
            evolutionary divergence.  Two unidentified reading frames which
            potentially encode proteins were located: one overlaps the matrix
            protein and the other the F protein.  The biological significance
            of these two reading frames is not clear.  The positive strand is
            shown.
FEATURES             Location/Qualifiers
     source          1..8510
                     /organism="Human orthopneumovirus"
                     /mol_type="genomic RNA"
                     /strain="A2"
                     /db_xref="taxon:11250"
                     /lab_host="HEp-2 cell"
     gene            1..528
                     /gene="1C"
     mRNA            1..528
                     /gene="1C"
     CDS             55..474
                     /gene="1C"
                     /codon_start=1
                     /product="nonstructural protein"
                     /protein_id="AAB59850.1"
                     /translation="MGSNSLSMIKVRLQNLFDNDEVALLKITCYTDKLIHLTNALAKA
                     VIHTIKLNGIVFVHVITSSDICPNNNIVVKSNFTTMPVLQNGGYIWEMMELTHCSQPN
                     GLLDDNCEIKFSKKLSDSTMTNYMNQLSELLGFDLNP"
     variation       171
                     /gene="1C"
                     /note="c in [11]; t in [6]"
                     /replace="t"
     gene            552..1050
                     /gene="1B"
     mRNA            552..1050
                     /gene="1B"
     CDS             584..958
                     /gene="1B"
                     /codon_start=1
                     /product="nonstructural protein"
                     /protein_id="AAB59851.1"
                     /translation="MDTTHNDNTPQRLMITDMRPLSLETIITSLTRDIITHKFIYLIN
                     HECIVRKLDEKQATFTFLVNYEMKLLHKVGSTKYKKYTEYNTKYGTFPMPIFINHDGF
                     LECIGIKPTKHTPIIYKYDLNP"
     variation       747
                     /gene="1B"
                     /note="a in [11]; g in [6]"
                     /replace="g"
     variation       769
                     /gene="1B"
                     /note="g in [11]; a in [6]"
                     /replace="a"
     gene            1081..2277
                     /gene="N"
     mRNA            1081..2277
                     /gene="N"
     CDS             1096..2271
                     /gene="N"
                     /codon_start=1
                     /product="major nucleocapsid"
                     /protein_id="AAB59852.1"
                     /translation="MALSKVKLNDTLNKDQLLSSSKYTIQRSTGDSIDTPNYDVQKHI
                     NKLCGMLLITEDANHKFTGLIGMLYAMSRLGREDTIKILRDAGYHVKANGVDVTTHRQ
                     DINGKEMKFEVLTLASLTTEIQINIEIESRKSYKKMLKEMGEVAPEYRHDSPDCGMII
                     LCIAALVITKLAAGDRSGLTAVIRRANNVLKNEMKRYKGLLPKDIANSFYEVFEKHPH
                     FIDVFVHFGIAQSSTRGGSRVEGIFAGLFMNAYGAGQVMLRWGVLAKSVKNIMLGHAS
                     VQAEMEQVVEVYEYAQKLGGEAGFYHILNNPKASLLSLTQFPHFSSVVLGNAAGLGIM
                     GEYRGTPRNQDLYDAAKAYAEQLKENGVINYSVLDLTAEELEAIKHQLNPKDNDVEL"
     gene            2289..3196
                     /gene="P"
     mRNA            2289..3196
                     /gene="P"
     CDS             2302..3027
                     /gene="P"
                     /codon_start=1
                     /product="phosphoprotein"
                     /protein_id="AAB59853.1"
                     /translation="MEKFAPEFHGEDANNRATKFLESIKGKFTSPKDPKKKDSIISVN
                     SIDIEVTKESPITSNSTIINPTNETDDTAGNKPNYQRKPLVSFKEDPTPSDNPFSKLY
                     KETIETFDNNEEESSYSYEEINDQTNDNITARLDRIDEKLSEILGMLHTLVVASAGPT
                     SARDGIRDAMIGLREEMIEKIRTEALMTNDRLEAMARLRNEESEKMAKDTSDEVSLNP
                     TSEKLNNLLEGNDSDNDLSLEDF"
     gene            3210..4156
                     /gene="M"
     mRNA            3210..4156
                     /gene="M"
     CDS             3214..3984
                     /gene="M"
                     /codon_start=1
                     /product="matrix protein"
                     /protein_id="AAB59854.1"
                     /translation="METYVNKLHEGSTYTAAVQYNVLEKDDDPASLTIWVPMFQSSMP
                     ADLLIKELANVNILVKQISTPKGPSLRVMINSRSAVLAQMPSKFTICANVSLDERSKL
                     AYDVTTPCEIKACSLTCLKSKNMLTTVKDLTMKTLNPTHDIIALCEFENIVTSKKVII
                     PTYLRSISVRNKDLNTLENITTTEFKNAITNAKIIPYSGLLLVITVTDNKGAFKYIKP
                     QSQFIVDLGAYLEKESIYYVTTNWKHTATRFAIKPMED"
     CDS             3923..4150
                     /gene="M"
                     /note="ORF1; putative"
                     /codon_start=1
                     /product="unknown protein"
                     /protein_id="AAB59855.1"
                     /translation="MLPQIGSTQLHDLQSNPWKINLFPLHQCVNSYKLSTYILHFTIT
                     ITNTLWFNQSNKTYLKSQIIPSHCLSDLVLK"
     gene            4172..4576
                     /gene="1A"
     mRNA            4172..4576
                     /gene="1A"
     CDS             4256..4450
                     /gene="1A"
                     /codon_start=1
                     /protein_id="AAB59856.1"
                     /translation="MENTSITIEFSSKFWPYFTLIHMITTIISLLIIISIMIAILNKL
                     CEYNVFHNKTFELPRARVNT"
     gene            4626..5543
                     /gene="G"
     mRNA            4626..5543
                     /gene="G"
     CDS             4641..5537
                     /gene="G"
                     /codon_start=1
                     /protein_id="AAB59857.1"
                     /translation="MSKNKDQRTAKTLERTWDTLNHLLFISSCLYKLNLKSVAQITLS
                     ILAMIISTSLIIAAIIFIASANHKVTPTTAIIQDATSQIKNTTPTYLTQNPQLGISPS
                     NPSEITSQITTILASTTPGVKSTLQSTTVKTKNTTTTQTQPSKPTTKQRQNKPPSKPN
                     NDFHFEVFNFVPCSICSNNPTCWAICKRIPNKKPGKKTTTKPTKKPTLKTTKKDPKPQ
                     TTKSKEVPTTKPTEEPTINTTKTNIITTLLTSNTTGNPELTSQMETFHSTSSEGNPSP
                     SQVSTTSEYPSQPSSPPNTPRQ"
     gene            5601..7499
                     /gene="F"
     mRNA            5601..7499
                     /gene="F"
     CDS             5614..7338
                     /gene="F"
                     /note="precursor"
                     /codon_start=1
                     /product="fusion glycoprotein"
                     /protein_id="AAB59858.1"
                     /translation="MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGY
                     LSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPP
                     TNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHL
                     EGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIE
                     TVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSN
                     NVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICL
                     TRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYD
                     CKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTV
                     SVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRK
                     SDELLHNVNAGKSTTNIMITTIIIVIIVILLSLIAVGLLLYCKARSTPVTLSKDQLSG
                     INNIAFSN"
     sig_peptide     5614..5679
                     /gene="F"
     mat_peptide     5680..6021
                     /gene="F"
                     /product="fusion glycoprotein"
                     /note="F1 subunit"
     mat_peptide     6022..7335
                     /gene="F"
                     /product="fusion glycoprotein"
                     /note="F2 subunit"
     CDS             5639..5758
                     /gene="F"
                     /note="ORF2; putative"
                     /codon_start=1
                     /product="unknown protein"
                     /protein_id="AAB59859.1"
                     /translation="MQLPQSSLQSHFVLLLVKTSLKNFINQHAVQLAKAILVL"
     variation       5903
                     /gene="F"
                     /note="t in 2 clones [4],[7]; c in 1 clone [4]"
                     /replace="c"
     variation       5917
                     /gene="F"
                     /note="c in 2 clones [4]; g in [7]"
                     /replace="g"
     variation       5917
                     /gene="F"
                     /note="c in 2 clones [4]; t in 2 clones [4]"
                     /replace="t"
     variation       5942
                     /gene="F"
                     /note="a in 3 clones [4],[7]; c in 1 clone [4]"
                     /replace="c"
     variation       6173
                     /gene="F"
                     /note="t in 3 clones [4],[7]; c in 1 clone [4]"
                     /replace="c"
     variation       6515
                     /gene="F"
                     /note="t in 3 clones [4],[7]; c in 1 clone [4]"
                     /replace="c"
     variation       6638
                     /gene="F"
                     /note="a in 4 clones [4]; t in [7]"
                     /replace="t"
     variation       6748
                     /gene="F"
                     /note="a in 2 clones [4]; g in 2 clones [4],[7]"
                     /replace="g"
     variation       6952
                     /gene="F"
                     /note="a in 2 clones [4]; g in two clones [4],[7]"
                     /replace="g"
     gene            7550..8506
                     /gene="22K"
     mRNA            7550..8506
                     /gene="22K"
                     /product="22K mRNA"
     CDS             7559..8143
                     /gene="22K"
                     /codon_start=1
                     /product="envelope-associated protein"
                     /protein_id="AAB59860.1"
                     /translation="MSRRNPCKFEIRGHCLNGKRCHFSHNYFEWPPHALLVRQNFMLN
                     RILKSMDKSIDTLSEISGAAELDRTEEYALGVVGVLESYIGSINNITKQSACVAMSKL
                     LTELNSDDIKKLRDNEELNSPKIRVYNTVISYIESNRKNNKQTIHLLKRLPADVLKKT
                     IKNTLDIHKSITINNPKESTVSDTNDHAKNNDTT"
BASE COUNT         3367 a         1697 c         1311 g         2135 t
ORIGIN      
        1 ggggcaaata agaatttgat aagtaccact taaatttaac tcccttggtt agagatgggc
       61 agcaattcat tgagtatgat aaaagttaga ttacaaaatt tgtttgacaa tgatgaagta
      121 gcattgttaa aaataacatg ctatactgat aaattaatac atttaactaa cgctttggct
      181 aaggcagtga tacatacaat caaattgaat ggcattgtgt ttgtgcatgt tattacaagt
      241 agtgatattt gccctaataa taatattgta gtaaaatcca atttcacaac aatgccagta
      301 ctacaaaatg gaggttatat atgggaaatg atggaattaa cacattgctc tcaacctaat
      361 ggtctactag atgacaattg tgaaattaaa ttctccaaaa aactaagtga ttcaacaatg
      421 accaattata tgaatcaatt atctgaatta cttggatttg atcttaatcc ataaattata
      481 attaatatca actagcaaat caatgtcact aacaccatta gttaatataa aacttaacag
      541 aagacaaaaa tggggcaaat aaatcaattc agccaaccca accatggaca caacccacaa
      601 tgataataca ccacaaagac tgatgatcac agacatgaga ccgttgtcac ttgagaccat
      661 aataacatca ctaaccagag acatcataac acacaaattt atatacttga taaatcatga
      721 atgcatagtg agaaaacttg atgaaaaaca ggccacattt acattcctgg tcaactatga
      781 aatgaaacta ttacacaaag taggaagcac taaatataaa aaatatactg aatacaacac
      841 aaaatatggc actttcccta tgccaatatt catcaatcat gatgggttct tagaatgcat
      901 tggcattaag cctacaaagc atactcccat aatatacaag tatgatctca atccataaat
      961 ttcaacacaa tattcacaca atctaaaaca acaactctat gcataactat actccatagt
     1021 ccagatggag cctgaaaatt atagtaattt aaaattaagg agagatataa gatagaagat
     1081 ggggcaaata caaagatggc tcttagcaaa gtcaagttga atgatacact caacaaagat
     1141 caacttctgt catccagcaa atacaccatc caacggagca caggagatag tattgatact
     1201 cctaattatg atgtgcagaa acacatcaat aagttatgtg gcatgttatt aatcacagaa
     1261 gatgctaatc ataaattcac tgggttaata ggtatgttat atgcgatgtc taggttagga
     1321 agagaagaca ccataaaaat actcagagat gcgggatatc atgtaaaagc aaatggagta
     1381 gatgtaacaa cacatcgtca agacattaat ggaaaagaaa tgaaatttga agtgttaaca
     1441 ttggcaagct taacaactga aattcaaatc aacattgaga tagaatctag aaaatcctac
     1501 aaaaaaatgc taaaagaaat gggagaggta gctccagaat acaggcatga ctctcctgat
     1561 tgtgggatga taatattatg tatagcagca ttagtaataa ctaaattagc agcaggggac
     1621 agatctggtc ttacagccgt gattaggaga gctaataatg tcctaaaaaa tgaaatgaaa
     1681 cgttacaaag gcttactacc caaggacata gccaacagct tctatgaagt gtttgaaaaa
     1741 catccccact ttatagatgt ttttgttcat tttggtatag cacaatcttc taccagaggt
     1801 ggcagtagag ttgaagggat ttttgcagga ttgtttatga atgcctatgg tgcagggcaa
     1861 gtgatgttac ggtggggagt cttagcaaaa tcagttaaaa atattatgtt aggacatgct
     1921 agtgtgcaag cagaaatgga acaagttgtt gaggtttatg aatatgccca aaaattgggt
     1981 ggtgaagcag gattctacca tatattgaac aacccaaaag catcattatt atctttgact
     2041 caatttcctc acttctccag tgtagtatta ggcaatgctg ctggcctagg cataatggga
     2101 gagtacagag gtacaccgag gaatcaagat ctatatgatg cagcaaaggc atatgctgaa
     2161 caactcaaag aaaatggtgt gattaactac agtgtactag acttgacagc agaagaacta
     2221 gaggctatca aacatcagct taatccaaaa gataatgatg tagagctttg agttaataaa
     2281 aaatggggca aataaatcat catggaaaag tttgctcctg aattccatgg agaagatgca
     2341 aacaacaggg ctactaaatt cctagaatca ataaagggca aattcacatc acccaaagat
     2401 cccaagaaaa aagatagtat catatctgtc aactcaatag atatagaagt aaccaaagaa
     2461 agccctataa catcaaattc aactattatc aacccaacaa atgagacaga tgatactgca
     2521 gggaacaagc ccaattatca aagaaaacct ctagtaagtt tcaaagaaga ccctacacca
     2581 agtgataatc ccttttctaa actatacaaa gaaaccatag aaacatttga taacaatgaa
     2641 gaagaatcca gctattcata cgaagaaata aatgatcaga caaacgataa tataacagca
     2701 agattagata ggattgatga aaaattaagt gaaatactag gaatgcttca cacattagta
     2761 gtggcaagtg caggacctac atctgctcgg gatggtataa gagatgccat gattggttta
     2821 agagaagaaa tgatagaaaa aatcagaact gaagcattaa tgaccaatga cagattagaa
     2881 gctatggcaa gactcaggaa tgaggaaagt gaaaagatgg caaaagacac atcagatgaa
     2941 gtgtctctca atccaacatc agagaaattg aacaacctat tggaagggaa tgatagtgac
     3001 aatgatctat cacttgaaga tttctgatta gttaccactc ttcacatcaa cacacaatac
     3061 caacagaaga ccaacaaact aaccaaccca atcatccaac caaacatcca tccgccaatc
     3121 agccaaacag ccaacaaaac aaccagccaa tccaaaacta accacccgga aaaaatctat
     3181 aatatagtta aaaaacggaa agggtgggga aatatggaaa catacgtgaa caagcttcac
     3241 gaaggctcca catacacagc tgctgttcaa tacaatgtct tagaaaaaga cgatgaccct
     3301 gcatcactta caatatgggt gcccatgttc caatcatcta tgccagcaga tttacttata
     3361 aaagaactag ctaatgtcaa catactagtg aaacaaatat ccacacccaa gggaccttca
     3421 ctaagagtca tgataaactc aagaagtgca gtgctagcac aaatgcccag caaatttacc
     3481 atatgcgcta atgtgtcctt ggatgaaaga agcaaactag catatgatgt aaccacaccc
     3541 tgtgaaatca aggcatgtag tctaacatgc ctaaaatcaa aaaatatgtt gactacagtt
     3601 aaagatctca ctatgaagac actcaaccct acacatgata ttattgcttt atgtgaattt
     3661 gaaaacatag taacatcaaa aaaagtcata ataccaacat acctaagatc catcagtgtc
     3721 agaaataaag atctgaacac acttgaaaat ataacaacca ctgaattcaa aaatgctatc
     3781 acaaatgcaa aaatcatccc ttactcagga ttactattag tcatcacagt gactgacaac
     3841 aaaggagcat tcaaatacat aaagccacaa agtcaattca tagtagatct tggagcttac
     3901 ctagaaaaag aaagtatata ttatgttacc acaaattgga agcacacagc tacacgattt
     3961 gcaatcaaac ccatggaaga ttaacctttt tcctctacat cagtgtgtta attcatacaa
     4021 actttctacc tacattcttc acttcaccat cacaatcaca aacactctgt ggttcaacca
     4081 atcaaacaaa acttatctga agtcccagat catcccaagt cattgtttat cagatctagt
     4141 actcaaataa gttaataaaa aatatacaca tggggcaaat aatcattgga ggaaatccaa
     4201 ctaatcacaa tatctgttaa catagacaag tccacacacc atacagaatc aaccaatgga
     4261 aaatacatcc ataacaatag aattctcaag caaattctgg ccttacttta cactaataca
     4321 catgatcaca acaataatct ctttgctaat cataatctcc atcatgattg caatactaaa
     4381 caaactttgt gaatataacg tattccataa caaaaccttt gagttaccaa gagctcgagt
     4441 caacacatag cattcatcaa tccaacagcc caaaacagta accttgcatt taaaaatgaa
     4501 caacccctac ctctttacaa cacctcatta acatcccacc atgcaaacca ctatccatac
     4561 tataaagtag ttaattaaaa atagtcataa caatgaacta ggatatcaag actaacaata
     4621 acattggggc aaatgcaaac atgtccaaaa acaaggacca acgcaccgct aagacattag
     4681 aaaggacctg ggacactctc aatcatttat tattcatatc atcgtgctta tataagttaa
     4741 atcttaaatc tgtagcacaa atcacattat ccattctggc aatgataatc tcaacttcac
     4801 ttataattgc agccatcata ttcatagcct cggcaaacca caaagtcaca ccaacaactg
     4861 caatcataca agatgcaaca agccagatca agaacacaac cccaacatac ctcacccaga
     4921 atcctcagct tggaatcagt ccctctaatc cgtctgaaat tacatcacaa atcaccacca
     4981 tactagcttc aacaacacca ggagtcaagt caaccctgca atccacaaca gtcaagacca
     5041 aaaacacaac aacaactcaa acacaaccca gcaagcccac cacaaaacaa cgccaaaaca
     5101 aaccaccaag caaacccaat aatgattttc actttgaagt gttcaacttt gtaccctgca
     5161 gcatatgcag caacaatcca acctgctggg ctatctgcaa aagaatacca aacaaaaaac
     5221 caggaaagaa aaccactacc aagcccacaa aaaaaccaac cctcaagaca accaaaaaag
     5281 atcccaaacc tcaaaccact aaatcaaagg aagtacccac caccaagccc acagaagagc
     5341 caaccatcaa caccaccaaa acaaacatca taactacact actcacctcc aacaccacag
     5401 gaaatccaga actcacaagt caaatggaaa ccttccactc aacttcctcc gaaggcaatc
     5461 caagcccttc tcaagtctct acaacatccg agtacccatc acaaccttca tctccaccca
     5521 acacaccacg ccagtagtta cttaaaaaca tattatcaca aaaagccatg accaacttaa
     5581 acagaatcaa aataaactct ggggcaaata acaatggagt tgctaatcct caaagcaaat
     5641 gcaattacca caatcctcac tgcagtcaca ttttgttttg cttctggtca aaacatcact
     5701 gaagaatttt atcaatcaac atgcagtgca gttagcaaag gctatcttag tgctctgaga
     5761 actggttggt ataccagtgt tataactata gaattaagta atatcaagga aaataagtgt
     5821 aatggaacag atgctaaggt aaaattgata aaacaagaat tagataaata taaaaatgct
     5881 gtaacagaat tgcagttgct catgcaaagc acaccaccaa caaacaatcg agccagaaga
     5941 gaactaccaa ggtttatgaa ttatacactc aacaatgcca aaaaaaccaa tgtaacatta
     6001 agcaagaaaa ggaaaagaag atttcttggt tttttgttag gtgttggatc tgcaatcgcc
     6061 agtggcgttg ctgtatctaa ggtcctgcac ctagaagggg aagtgaacaa gatcaaaagt
     6121 gctctactat ccacaaacaa ggctgtagtc agcttatcaa atggagttag tgtcttaacc
     6181 agcaaagtgt tagacctcaa aaactatata gataaacaat tgttacctat tgtgaacaag
     6241 caaagctgca gcatatcaaa tatagaaact gtgatagagt tccaacaaaa gaacaacaga
     6301 ctactagaga ttaccaggga atttagtgtt aatgcaggtg taactacacc tgtaagcact
     6361 tacatgttaa ctaatagtga attattgtca ttaatcaatg atatgcctat aacaaatgat
     6421 cagaaaaagt taatgtccaa caatgttcaa atagttagac agcaaagtta ctctatcatg
     6481 tccataataa aagaggaagt cttagcatat gtagtacaat taccactata tggtgttata
     6541 gatacaccct gttggaaact acacacatcc cctctatgta caaccaacac aaaagaaggg
     6601 tccaacatct gtttaacaag aactgacaga ggatggtact gtgacaatgc aggatcagta
     6661 tctttcttcc cacaagctga aacatgtaaa gttcaatcaa atcgagtatt ttgtgacaca
     6721 atgaacagtt taacattacc aagtgaaata aatctctgca atgttgacat attcaacccc
     6781 aaatatgatt gtaaaattat gacttcaaaa acagatgtaa gcagctccgt tatcacatct
     6841 ctaggagcca ttgtgtcatg ctatggcaaa actaaatgta cagcatccaa taaaaatcgt
     6901 ggaatcataa agacattttc taacgggtgc gattatgtat caaataaagg gatggacact
     6961 gtgtctgtag gtaacacatt atattatgta aataagcaag aaggtaaaag tctctatgta
     7021 aaaggtgaac caataataaa tttctatgac ccattagtat tcccctctga tgaatttgat
     7081 gcatcaatat ctcaagtcaa cgagaagatt aaccagagcc tagcatttat tcgtaaatcc
     7141 gatgaattat tacataatgt aaatgctggt aaatccacca caaatatcat gataactact
     7201 ataattatag tgattatagt aatattgtta tcattaattg ctgttggact gctcttatac
     7261 tgtaaggcca gaagcacacc agtcacacta agcaaagatc aactgagtgg tataaataat
     7321 attgcattta gtaactaaat aaaaatagca cctaatcatg ttcttacaat ggtttactat
     7381 ctgctcatag acaacccatc tgtcattgga ttttcttaaa atctgaactt catcgaaact
     7441 ctcatctata aaccatctca cttacactat ttaagtagat tcctagttta tagttatata
     7501 aaacacaatt gaatgccaga ttaacttacc atctgtaaaa atgaaaactg gggcaaatat
     7561 gtcacgaagg aatccttgca aatttgaaat tcgaggtcat tgcttaaatg gtaagaggtg
     7621 tcattttagt cataattatt ttgaatggcc accccatgca ctgcttgtaa gacaaaactt
     7681 tatgttaaac agaatactta agtctatgga taaaagtata gataccttat cagaaataag
     7741 tggagctgca gagttggaca gaacagaaga gtatgctctt ggtgtagttg gagtgctaga
     7801 gagttatata ggatcaataa acaatataac taaacaatca gcatgtgttg ccatgagcaa
     7861 actcctcact gaactcaata gtgatgatat caaaaagctg agggacaatg aagagctaaa
     7921 ttcacccaag ataagagtgt acaatactgt catatcatat attgaaagca acaggaaaaa
     7981 caataaacaa actatccatc tgttaaaaag attgccagca gacgtattga agaaaaccat
     8041 caaaaacaca ttggatatcc ataagagcat aaccatcaac aacccaaaag aatcaactgt
     8101 tagtgataca aatgaccatg ccaaaaataa tgatactacc tgacaaatat ccttgtagta
     8161 taacttccat actaataaca agtagatgta gagttactat gtataatcaa aagaacacac
     8221 tatatttcaa tcaaaacaac ccaaataacc atatgtactc accgaatcaa acattcaatg
     8281 aaatccattg gacctctcaa gaattgattg acacaattca aaattttcta caacatctag
     8341 gtattattga ggatatatat acaatatata tattagtgtc ataacactca attctaacac
     8401 tcaccacatc gttacattat taattcaaac aattcaagtt gtgggacaaa atggatccca
     8461 ttattaatgg aaattctgct aatgtttatc taaccgatag ttatttaaaa
//