LOCUS BLYAMYABA 595 bp mRNA linear PLN 27-APR-1993 DEFINITION Barley alpha-amylase type B isozyme mRNA, clone 103. ACCESSION M10056 VERSION M10056.1 KEYWORDS alpha-amylase; amylase. SOURCE Hordeum vulgare ORGANISM Hordeum vulgare Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum. REFERENCE 1 (bases 1 to 595) AUTHORS Huang,J.K., Swegle,M., Dandekar,A.M. and Muthukrishnan,S. TITLE Expression and regulation of alpha-amylase gene family in barley aleurones JOURNAL J. Mol. Appl. Genet. 2 (6), 579-588 (1984) PUBMED 6335720 COMMENT Original source text: Barley (Hordeum vulgare cv. Himalaya) gibberellic acid treated aleurone cell, cDNA to mRNA, clone 103. Draft entry and sequence in computer-readable form kindly provided by S. Muthukrishnan, 03-SEP-1985 [1]. There are at least four types of alpha-amylase. The accumulation of alpha-amylase mRNAs in aleurones as a function of time after addition of the hormone gibberellic acid (GA) shows differential control of the expression of the alpha-amylase genes. Type A isozyme mRNA is present in small amounts in unstimulated cells, and increases in concentration upon stimulation with GA, whereas type B isozyme mRNA is undetectable in unstimulated cells and increases a hundred-fold after stimulation with gibberellic acid. FEATURES Location/Qualifiers source 1..595 /organism="Hordeum vulgare" /mol_type="mRNA" /db_xref="taxon:4513" CDS <1..462 /note="alpha-amylase type B, EC 3.2.1.1" /codon_start=1 /protein_id="AAA32930.1" /translation="ILNVAVEGALWRLRGTDGKAPSMIGWWPAKAVTFVDNHDTGSTQ HMWPFPSDRVMQGYAYILTHPRTPCIFYDHFFDWGPKEEIDRLVSVRTRHGIHNESKL QIIEADADLYLAEIDGKVIVKLGPRYDVGNLIPGGFEGAAHGNDYAVWEKI" BASE COUNT 149 a 156 c 170 g 120 t ORIGIN 256 bp upstream of PvuI site; chromosome 6. 1 atcctcaacg tggccgtgga gggcgcgctg tggcggctgc gcggcacaga cggtaaggcg 61 ccaagcatga tcgggtggtg gccagccaag gcggtgacct ttgtggacaa ccacgacacc 121 ggctccacgc agcacatgtg gcccttccct tctgacaggg tcatgcaggg atatgcctac 181 atcctcacgc acccaaggac gccatgcatc ttctacgacc atttcttcga ctggggcccg 241 aaggaggaga tcgatcgcct ggtgtcagtc aggacccggc acgggataca caacgagagc 301 aagctgcaaa tcatagaggc cgacgccgac ctttatctcg ccgagatcga cggcaaggtc 361 atcgtcaagc tcgggccaag atacgatgtg gggaacctca ttccgggagg cttcgaaggt 421 gccgcgcacg gcaatgacta tgccgtatgg gagaaaatat gagcaaaatt gcgagagcag 481 ctctacaagt tcctatatga tacatattag tccgagctca cgctgttcac atagtacaat 541 taatattgct ctaatgtaaa agtgaggatg agggacatgc attgtatttt tgata //