LOCUS       LT727259                6160 bp    DNA     circular SYN 06-FEB-2017
DEFINITION  Mammalian vector pdECFP, complete sequence.
ACCESSION   LT727259
VERSION     LT727259.1
KEYWORDS    .
SOURCE      Mammalian vector pdECFP
  ORGANISM  Mammalian vector pdECFP
            other sequences; artificial sequences; vectors.
REFERENCE   1  (bases 1 to 6160)
  AUTHORS   De Schamphelaire W.
  JOURNAL   Submitted (02-FEB-2017) to the INSDC. BCCM/LMBP, Universiteit Gent,
            Technologiepark 927, 9052, BELGIUM.
REFERENCE   2
  AUTHORS   De Schamphelaire W., Olbrechts A., Meert J., Verhelst K.,
            Roggeman Fonseca M., Vanhoucke M., Beyaert R.
  TITLE     BCCM/LMBP Plasmid collection
  JOURNAL   Unpublished.
FEATURES             Location/Qualifiers
     source          1..6160
                     /organism="Mammalian vector pdECFP"
                     /mol_type="other DNA"
                     /note="BCCM/LMBP Plasmid collection (Ghent
                     University,Belgium) accession number LMBP 4548."
                     /db_xref="taxon:1945175"
     regulatory      1..568
                     /note="hCMV-IE promoter and enhancer"
                     /regulatory_class="promoter"
     CDS             613..>1329
                     /transl_table=11
                     /note="ECFP"
                     /protein_id="SJL87914.1"
                     /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLT
                     LKFICTTGKLPVPWPTLVTTLTWGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFK
                     DDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYISHNVYITADKQKN
                     GIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDH
                     MVLLEFVTAAGITLGMDELYK"
     regulatory      complement(1348..1472)
                     /note="attR1"
                     /regulatory_class="attenuator"
     regulatory      1480..1532
                     /note="lacUV5 promoter"
                     /regulatory_class="promoter"
     CDS             1581..2240
                     /transl_table=11
                     /note="chloramphenicol resistance"
                     /protein_id="SJL87915.1"
                     /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAF
                     LKTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETF
                     SSLWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNV
                     ANMDNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGG
                     A"
     CDS             2582..2887
                     /transl_table=11
                     /note="ccdB"
                     /protein_id="SJL87916.1"
                     /translation="MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSD
                     KVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI"
     regulatory      2928..3052
                     /note="attR2"
                     /regulatory_class="attenuator"
     regulatory      complement(3163..3259)
                     /note="SV40 polyA late"
                     /regulatory_class="terminator"
     regulatory      3163..3259
                     /note="SV40 polyA early"
                     /regulatory_class="terminator"
     rep_origin      complement(3313..3768)
                     /note="f1 ori"
     regulatory      3769..3864
                     /note="amp promoter"