LOCUS       LT599047             2256786 bp    DNA     circular BCT 14-DEC-2016
DEFINITION  Brucella sp. 10RB9215 isolate BR10RB9215WGS1 genome assembly,
            chromosome: 1.
ACCESSION   LT599047
VERSION     LT599047.1
DBLINK      BioProject:PRJEB14686
            BioSample:SAMEA4063032
KEYWORDS    .
SOURCE      Brucella sp. 10RB9215
  ORGANISM  Brucella sp. 10RB9215
            Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales;
            Brucellaceae; Brucella.
REFERENCE   1
  AUTHORS   Blom J.
  JOURNAL   Submitted (05-JUL-2016) to the INSDC. JLU, JLU,
            Justus-Liebig-University Giessen, Bioinformatics and Systems
            Biology, Heinrich-Buff-Ring 58, 35392 Giessen, 35390, Germany
FEATURES             Location/Qualifiers
     source          1..2256786
                     /organism="Brucella sp. 10RB9215"
                     /chromosome="1"
                     /host="African bull frog, Pyxicephalus edulis"
                     /isolate="BR10RB9215WGS1"
                     /mol_type="genomic DNA"
                     /collection_date="2009"
                     /db_xref="taxon:1149953"
     CDS             23..229
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10001"
                     /product="hypothetical protein"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L8U1"
                     /protein_id="SBW13197.1"
                     /translation="MPQDRIENAFNAAHLHGTGFLKRRFISVTERMVYEAIADYLQLP
                     YTEEILLRVFLFPVKISVLPISGR"
     CDS             400..1734
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10002"
                     /product="xyloglucan glycosyltransferase 1"
                     /db_xref="GOA:A0A1M4L8T7"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L8T7"
                     /protein_id="SBW13198.1"
                     /translation="MTPQLFSAARVLDTPQAFVIAMAVYAFLGCIVNWPMKTCWRHVA
                     MSLFFLRLCSYPPFCRRFWPAAIHGNCAFHRVICRSIPYWCRYREKDVVAQLIAALNR
                     LNWPRSKLDIKLVCEKDDYETIAAIRCNTMPSNFELVLVPSGGPRTKPKALNYALQFA
                     RGEIVAVFDAEDRPHPDQLLEAWQAFRQGGSKLACVQAPLIIGNFRRNLLTRMFAFEY
                     AVLFRGLLPWLARRGLVIPLGGTSNHFRRSCLEQVGGWDAYNVTEDADLGMRLARFGY
                     RIDVISRGTIEDAPEEHGVWHRQRTRWIKGDADMAGAWPPADEHLARAWLVAFRREPD
                     LYARHHRFGAAAPADAAHAGRALPAHGVRAADTQGLWLLALDVINILMAYMSFHMLGA
                     KTMEPTELGGYAYFLAIPIYWVLISLSAWRAVWQLVRQPHLWEKTRTSQTCF"
     CDS             complement(1837..2004)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10003"
                     /product="hypothetical protein"
                     /db_xref="InterPro:IPR022488"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L8W5"
                     /protein_id="SBW13199.1"
                     /translation="MDIAGISRWDDYSTALHTMLERTDTGYAPWTIIRANDKRRARLA
                     ANPAHTPYPAL"
     CDS             complement(2147..2689)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10004"
                     /product="hypothetical protein"
                     /db_xref="InterPro:IPR022488"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L921"
                     /protein_id="SBW13200.1"
                     /translation="MGDSSKTANKKKAKKNGTKSAEKPIKIEIANKKRKFDINDPKLP
                     GWIDDCALQSGGYPYSSKMKSDEYEATLERLQIELVKLQYWLQNTGERVISVFEGRDA
                     AGKGGTIFTIRQFMNPRTARNVALPKPTETERGQWYFQRYVSHFPTAGEFVTFDRSWY
                     NRAGVERVMGFCTPSSLKHS"
     CDS             2822..4264
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10005"
                     /product="sensor histidine kinase"
                     /db_xref="GOA:A0A1M4L8U8"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="InterPro:IPR013656"
                     /db_xref="InterPro:IPR035965"
                     /db_xref="InterPro:IPR036097"
                     /db_xref="InterPro:IPR036890"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L8U8"
                     /protein_id="SBW13201.1"
                     /translation="MSEDSGRAGPEARTETSLFEPLLRIKGVLFVSMVLAICVMALDL
                     PFWFRAILLALVVLGAVWAAAGIGNGEDEKVPLREVASREMAAVSGERLADLLTDPMI
                     VFDHTATVRFANAAALEAFQSLQNGTALYLRFRAPEMLALIQGVIADGEPRNIEYFER
                     VPIDRWYKAMVKALRDAEGKPELFVLIFRDQSETRRIDRMRSDFIANASHELRTPLAS
                     LRGFIETLQGPARNDAAARDRFLDIMQKQAERMSRLIDDLLSLSRLEMRAHLAVNESV
                     DVAATLAHVADTLTPLAAGLGVTIERHLPEHPVHVMGARDELIQVFQNLVENACKYGQ
                     EGKRVIIRLSEEDTASATEVVASIQDFGPGIAAEHLPRLTERFYRIDVETSRAHKGTG
                     LGLAIVKHILARHRGRLVVRSQLGKALPSWCACRNRTRAPPRPQQYEILQVSRTFIKR
                     KVPATFLLPGRSWQVIPVKRLWRSQTGGAS"
     CDS             complement(4416..4811)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10006"
                     /product="hypothetical protein"
                     /db_xref="InterPro:IPR011681"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L8X3"
                     /protein_id="SBW13202.1"
                     /translation="MNWTDERVELLKKLWSEGLSASQIAAQLGGVSRNAVIGKVHRLK
                     LSGRGKTTTAAPRSKKVNTPAAAPRPAVQNNNSGTHTTTMRTTTVTKTVGATALQMEY
                     ATEVVAETVIKPASDVVVPIFAPSDPVAA"
     CDS             5414..6625
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10007"
                     /product="hypothetical protein"
                     /db_xref="GOA:A0A1M4LEZ7"
                     /db_xref="InterPro:IPR004636"
                     /db_xref="InterPro:IPR005814"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4LEZ7"
                     /protein_id="SBW13203.1"
                     /translation="MTDATTVHPLYDTYNRAALRFERGEGIWLITEDGERYIDFAAGI
                     AVNSLGHSHPHLVETLKTQAEKLWHLSNIYEIPAQEKLGRRLVESTFADKVFFTNSGA
                     EALECAIKTARRYQYVSGHPERFRIITFEGAFHGRTLATIAAGGQAKYLEGFGPKVEG
                     FDQVPFGDEAALRAAITPETAGILLEPIQGEGGLRAFPEEFLRLVRQICDENGLLLLL
                     DEVQTGVGRTGKFFAHEWAGIRPDIMAIAKGIGGGFPIGACLATAEAAKGMTAGMHGT
                     TYGGNPLGMAVGNAVLDVILADGFMENVQATALVMKQGLASLVDRYPNVVSEIRGRGL
                     LMGMKCVVPNTSLIQALRDEHILSVGAGDNVVRFLPPLITTPEEAREALKHIETAVER
                     LSIANPISKTV"
     CDS             6630..7568
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10008"
                     /product="aspartate carbamoyltransferase, catalytic
                     subunit"
                     /db_xref="GOA:A0A1M4LF00"
                     /db_xref="InterPro:IPR002292"
                     /db_xref="InterPro:IPR006130"
                     /db_xref="InterPro:IPR006131"
                     /db_xref="InterPro:IPR006132"
                     /db_xref="InterPro:IPR024904"
                     /db_xref="InterPro:IPR036901"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4LF00"
                     /protein_id="SBW13204.1"
                     /translation="MANDNGIKHFIDLSTVPATELRAILEDAKARKARLKAGEVERPY
                     AGKVLAMIFEKPSTRTRVSFDVGMRQLGGETIMLTGSEMQLGRSETIADTAKVLSRYV
                     DAIMIRTTAHERMLELAEYATVPVINALTDDTHPCQIMADVLTYEEHRGPIKGKTFAW
                     MGDGNNVLHSLVEAAARFDFNVNIATPKGSEPKSQYIDWARANGAGIMSTTDPEKAAS
                     GADCIVTDTWVSMGQEDHARGHNVFIPYQVNAHLMAKADPKALFMHCLPAHRGEEVTD
                     EVIDGPQSVVFDEAENRLHAQKAILAWCLQDRGLGA"
     CDS             7570..8592
                     /codon_start=1
                     /transl_table=11
                     /gene="hslO1"
                     /locus_tag="BR10RB9215_C10009"
                     /product="Hsp33-like chaperonin"
                     /db_xref="GOA:A0A1M4L8S8"
                     /db_xref="InterPro:IPR000397"
                     /db_xref="InterPro:IPR016153"
                     /db_xref="InterPro:IPR016154"
                     /db_xref="InterPro:IPR023212"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L8S8"
                     /protein_id="SBW13205.1"
                     /translation="MSDKTSNEHTEAENIQTGLGGFNFAGDDAVVPFQVEGLDVRGRA
                     VQLGPSINAILKRHEYPEEVARLLAEATVLTVLLGTSLKFDGKFIFQTQSDGPVDMLV
                     VDFRTPRSVRAYARYDEARLKEAIAANKTRPEELLGNGTLAFTVDQGIYTQRYQGIVA
                     LDGSTLEEIAVTYFRQSEQIPTDLKLSVAKLIERGADGKPVEQWRAGGLIIQFLPESE
                     LRARVPDLPGGDGDDSQLIHHPEDDAWDEARSLVGTIESSELTDPQVGSERLLYRLFH
                     ERGVRVFDSIAVIDECSCSREKIAGVLSGFTAEEIEDSVEDGKISVTCEFCSKLYQFD
                     PAEFTK"
     CDS             complement(8633..9025)
                     /codon_start=1
                     /transl_table=11
                     /gene="apaG"
                     /locus_tag="BR10RB9215_C10010"
                     /product="ApaG"
                     /db_xref="InterPro:IPR007474"
                     /db_xref="InterPro:IPR023065"
                     /db_xref="InterPro:IPR036767"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L8W1"
                     /protein_id="SBW13206.1"
                     /translation="MYSAVTRGIEVTVEPFYLEVQSEPEENRYVWGYRVTIVNNSSET
                     VQLCSRYWQITDANGHVQEVRGSGVVGEQPVLDPGDSYQYSSGCPLTTSSGVMVGRYQ
                     MKGEDGAQFEIEIPAFSLDVPEQRRTLN"
     CDS             complement(9394..10590)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10011"
                     /product="O-acetylhomoserine
                     aminocarboxypropyltransferase"
                     /db_xref="GOA:A0A1M4L8V7"
                     /db_xref="InterPro:IPR000277"
                     /db_xref="InterPro:IPR006234"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L8V7"
                     /protein_id="SBW13207.1"
                     /translation="MTTENARKFRPATELVHAGSLRSGFAEMSEALFLTQGFLYPTAE
                     AAEARFKGEDPGFIYSRYANPTTDMFEKRMCALEGAEDARATASGMAAVAAAILCQVQ
                     AGDHVISARAVFGSCRYIVETVLPRYGVEVSIIDGSDVANWKAAVRPNTKVMFLESPS
                     NPTLEIIDIAAVAQIANEAGAKLIVDNVFATPLFQKPLELGAHIVVYSATKHIDGQGR
                     CLGGVVLSDREWIETTLQDYFRHTGPGLSPFNAWIMLKGLETLSVRVRQQTQSAAAIA
                     DFLAGKPGVKRVIYPGRADHPQADIIAKQMTGGSTLIALELEGGKEAAFKFENALQIF
                     SITNNLGDTKSLITHPATTTHKNLSNEAKAELGISDGLLRVSVGLEDTDDLLEDVEAA
                     LKVARG"
     CDS             11017..12108
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10012"
                     /product="2'-deoxycytidine 5'-triphosphate deaminase"
                     /db_xref="GOA:A0A1M4L8U7"
                     /db_xref="InterPro:IPR010550"
                     /db_xref="InterPro:IPR033704"
                     /db_xref="InterPro:IPR036157"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L8U7"
                     /protein_id="SBW13208.1"
                     /translation="MTQREAGILADADIAALFESGLLASPRLLDADQIQPASLDLRLG
                     AKAYRVRASFMPGPGTPVIDKLERLKLHEIDLTAGAVLETGCVYIVPLLESLALSPEL
                     SASANPKSSTGRLDIFTRVIADGAQEFDKVPAGYKGPLYLEVSPRTFPIVVRTGSRLS
                     QIRFRKGRAQLDESELAVLHKAETLVASEMPNISGGGIALSVDLSGGEDRLIGYRGKH
                     HTGVVDVDKRAAHDVLDFWEPLYDRGAHELVLDPDEFYILVSREAVHVPPLYAAEMTP
                     FDPLVGEFRVHYAGFFDPGFGHSAAGGTGSRAVLEVRSHEVPFILEHGQIVGRLVYEH
                     MLGQPKALYGIDLGSNYQAQQLKLSKHFR"
     CDS             12205..13215
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10013"
                     /product="AraC family transcriptional regulator"
                     /db_xref="GOA:A0A1M4L8X1"
                     /db_xref="InterPro:IPR002818"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR018060"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L8X1"
                     /protein_id="SBW13209.1"
                     /translation="MVNETGRSLGGKAEATADAPPRRLSVGIVVLPGFTLSALSLFLD
                     PFRLAADDRDKSRQIRCAWKICTLSGDPVTSSSGMVIEPTVPLGEIDECDYVAVVGGL
                     LAQYRHSQQALIDLIKRADKRGKAVVGLCTAAFLLAEAGVLEDRNCCVSWFHRDDFLE
                     LFDGYTADTTSLFHLSGRHYTCAGGLGAAALALSIIQNEISEELARKSASILLIPYEL
                     VRSEQPALSFNGVRSPMIRKAIRIFEETLEDPVPMIDVARRLGISVRQMERGFRLSLG
                     RTAFEVREELRVKKAKELLAETSLSLLEVAVASGFTDTRSMNRSFSRQKQKAPRDYRR
                     QR"
     CDS             13302..13568
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10014"
                     /product="hypothetical protein"
                     /db_xref="GOA:A0A1M4L933"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L933"
                     /protein_id="SBW13210.1"
                     /translation="MSDGVNRFLGDTPGRILVKLVLISLVVGVVMSAFHWTPYDILYG
                     IRDFFLHLWNMGFSAVARFADYLVLGAAVVIPAFILLRILSYRK"
     CDS             13650..14087
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10015"
                     /product="hypothetical protein"
                     /db_xref="InterPro:IPR014044"
                     /db_xref="InterPro:IPR035940"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L8W0"
                     /protein_id="SBW13211.1"
                     /translation="MLAGGAMALSALPVDWAQAAGNNDPTAIFNAIRKANGLPLMATD
                     SRLEQAALYQARRMASYGKIGHSVGWGNGFVSRLKQAGIRGPAAENVAVGQPDTQAVF
                     DAWMKSPGHRKNMLDPTFAHYGLAWATPENNPRRIYWAMMLGL"
     CDS             14274..15629
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10016"
                     /product="Na+ driven multidrug efflux PUMP"
                     /db_xref="GOA:A0A1M4L8Y0"
                     /db_xref="InterPro:IPR002528"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L8Y0"
                     /protein_id="SBW13212.1"
                     /translation="MQGGGQSIGNVTKPFDVTHRMVMLIAVPMTLAAITTPLLGLVDM
                     GVVGQMGQAELIGGLAIGALVFDFLLSLFNFLRSGTTGLVAQAMGAGDAVEEQAIFWR
                     AIIIAVAAGGLMILCLPLILGAASTFMHPTPATRAAMATYISIRMLSAPVALINYSIL
                     GLVLGRGQGILGLGLQVLLNGINIALCIVLGLELGWGVTGVAWATVTGETVAALVGLF
                     IVMRHFRKDATLRPDRKRIFQREGIMRMFAVNRDIMIRSLLLLTAFAFFTRAGSDLGP
                     VTLAANAVLLNFFLVAGFFLDGMAAAAEQIIGRSIGARYSPAFRRGAKLTFIWGLVMA
                     GLVAFFLLVFGDTIISLLSRAEDVHVEAMKYLPWAALTGLTGLLAFHMDGVYIGATWS
                     RDMRNMMFLSLVFFLAVLYAAKPVMGNHGLWLAINLFLSVRGITLLAILPRRYRMEFA
                     R"
     CDS             complement(15631..16419)
                     /codon_start=1
                     /transl_table=11
                     /gene="pyrD"
                     /locus_tag="BR10RB9215_C10017"
                     /product="dihydroorotate dehydrogenase 2"
                     /db_xref="GOA:A0A1M4L910"
                     /db_xref="InterPro:IPR001295"
                     /db_xref="InterPro:IPR005719"
                     /db_xref="InterPro:IPR005720"
                     /db_xref="InterPro:IPR012135"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L910"
                     /protein_id="SBW13213.1"
                     /translation="MDDKAVINRLGFNNEGHEAAFKRLSRRAGKSGIVGVNIGANKDA
                     EDRIADYVAGIRRFYQLARYFTVNISSPNTPGLRNLQAREALHELLSRVLEARDEEGK
                     MCTLKRPVFLKIAPDLTDEELDDIAAEADAQKLDGIIVSNTTLSRSGLKNVENSNETG
                     GLSGAPLFERSTVVLARMRERVGPDMPLIGVGGIDSAETALAKIKAGADLVQLYTGLI
                     YRGPGLPGEILRGLSTAIKHECVSSIAELRDRDTKEWAARKLTS"
     CDS             complement(16721..17074)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10018"
                     /product="hypothetical protein"
                     /db_xref="InterPro:IPR009297"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L938"
                     /protein_id="SBW13214.1"
                     /translation="MSNKIIYKIAPRELWAQAEKAGSFAGAPVDIADGYIHFSTAAQV
                     RTTAAKHFAGQNDLLLVHVDAQALGQALKYEVSRGGALFPHLYAPLPLTAVVKVEPLP
                     LGPDDLHIFPELEDK"
     CDS             17329..17784
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10019"
                     /product="hypothetical protein"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L8T9"
                     /protein_id="SBW13215.1"
                     /translation="MLGRMAGSAHRLAIASLLGTALFSTGALAQENGRYRLEGTETGY
                     VRLDTQTGAISVCTQQKGQLVCKMAAEDRDAYENDIADLQARVKKLEAQVAAMGKVEG
                     SKASALPSEQEFEQSMSYMERFMRRFMDLAKSFEGGEEKPAPPAIPGRT"
     CDS             complement(17875..18825)
                     /codon_start=1
                     /transl_table=11
                     /gene="pip"
                     /locus_tag="BR10RB9215_C10020"
                     /product="proline iminopeptidase"
                     /EC_number="3.4.11.5"
                     /db_xref="GOA:A0A1M4L8X2"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR002410"
                     /db_xref="InterPro:IPR005944"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L8X2"
                     /protein_id="SBW13216.1"
                     /translation="MTRNTLYPEIEPFKEEMLQVSSLHRIHVEQCGNPDGKPVIMIHG
                     GPGGGITPTMRRLHDPKRYRIILFDQRGCGRSTPHAELRENTTWDLVADMEHIRAHLG
                     IDKWQVFGGSWGSTLGLAYAETHPERVSELVLRGIFMVRRFEVDWMYSNGASIIFPDH
                     FEAYQEHIPEAERGDMIAAYYKRLTDRDPRVQLEAARRWARWEGSVISLLPDPARVDA
                     FGEDQYAIAFARIECHYFQNRGFLESDDQLLRNVERIRHIPGVIVHGRYDICTPFINA
                     WQLKKMWPEADLKIVEDSGHAVTEPGIMHELIEATKRFCE"
     CDS             19055..19696
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10021"
                     /product="LuxR family transcriptional regulator"
                     /db_xref="GOA:A0A1M4L8W8"
                     /db_xref="InterPro:IPR000792"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR011006"
                     /db_xref="InterPro:IPR016032"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L8W8"
                     /protein_id="SBW13217.1"
                     /translation="MHFIIADDHPLFRGALRQVLSGQSENVEIIEAGDFDTVRKLVGE
                     KDDTDLLLLDLTMPGGTGLSGLVALKALQPALPIIIVSATDDPATIHHALELGASGFI
                     SKSASMETIGEAVGAVLAGDIWTPDDIDLDHPKDPEIESLIARLRTLTPQQTRVLTML
                     AEGLLNKQIAFELGVSEATVKAHVSAVLQKLGVDSRTQAVILLSRIGSDVLGV"
     CDS             complement(19736..23248)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10022"
                     /product="sensor histidine kinase"
                     /db_xref="GOA:A0A1M4L8V5"
                     /db_xref="InterPro:IPR001734"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="InterPro:IPR011006"
                     /db_xref="InterPro:IPR035965"
                     /db_xref="InterPro:IPR036097"
                     /db_xref="InterPro:IPR036890"
                     /db_xref="InterPro:IPR038377"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L8V5"
                     /protein_id="SBW13218.1"
                     /translation="MQGWGIIGFAFLYLLLLFAVASIGDRRTARWSSTPRPYIYALSL
                     AVYCTSWTFFGSVGLSAQRGLEFLGIYIGPILVFTLGNRLLRHIVRLAKSEHITSIAD
                     FLAARYGKSFGVASLATCIAAVGSIPYIALQLKAVSGSVGLVMDYYGAAVDPAVFVFG
                     DISLPVAAVLATFAILFGTRHTDATEHQNGLILAVALESVIKLCAFLTVGLACAFFLF
                     GAPSQLIRQISQSPEALEAFHYETSIGTWLVQTALSAAAVIMLPRQFHVTVVESRSEK
                     ELRTASWLFPLYLILINIFVFPIALIGVMTLGNSVNGDLYVLALPLSAGAHWLALIAF
                     LGGLSAATAMVIVACVALSIMISNHLVLPLIISSFAKRHFAEQRDLTKIILNTRRITI
                     IVILALAFSYYRLTSNNIHLASIGFVSFAAVAQFAPALIGGLFWRNANGRGAMLGLSA
                     GFIVWCYTLLLPTVAPENAAILRDGFLGFTALRPEALFGTNALPLTNGVAWSIAANTL
                     FYILGSLSRASTPLERIQASIFLPRTFIGAPTLKRFRTTVTVAELKATMARYLGAERV
                     ERAFLRFEGREQRRLDPGMTVDTPLIRYAEQLLGTAVGSSSARLVLSLLLQRNDASPR
                     DARQLLDDASAALQQNRDLLQIALDQMDQGITVLDKDLRLTCWNRQFRKLFDLPDEVM
                     QVGIPISEIVEHLSQRGDIAMNARNGAIRSLGTVRRPWRMTMKSTGKILEINSNPMPD
                     GGLVTTFTDITAAVEADLMRQKASEMLEQRVIDRTAELMHVNDELARAQAAAEEANLG
                     KTRFLAAAGHDILQPLNAARLYSTALAEKLGRSETSEFARNIDSSLEAVEAILGMVLD
                     ISRLDTGSLKPETSVFRLDKLLSQIATDFTPLAVKKGLKLRVVPSSIVVKTDRNMLRR
                     LIQNLVSNSIKYSRKGGILLGVRRRGNFVDLQVLDTGIGIAPQKLKLVFREFTRLNEG
                     MREAEGLGLGLSIVDRIARVLSLPLSLASTPGKGTVFSLRIPVSGEAPPAEEVKNRRG
                     PQRASELDGLGVLCIDNDVNILCGMETLLSGWGCNVTTLRSGAELKSFCATGTAAPAV
                     IIADYHLIHENGLDMIGFARESFKTEIPAILLTADRSKEVRQRAEDENVTVLHKPLRP
                     AALRSMLSLFHHARQDGASAQGST"
     CDS             23771..24187
                     /codon_start=1
                     /transl_table=11
                     /gene="mscL"
                     /locus_tag="BR10RB9215_C10023"
                     /product="large-conductance mechanosensitive channel"
                     /db_xref="GOA:A0A1M4L8Y5"
                     /db_xref="InterPro:IPR001185"
                     /db_xref="InterPro:IPR019823"
                     /db_xref="InterPro:IPR036019"
                     /db_xref="InterPro:IPR037673"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L8Y5"
                     /protein_id="SBW13219.1"
                     /translation="MLKEFQEFALKGNMVDLAIGVIIGGAFGGLVNSIVNDIIMPIIG
                     LITGGIDFSNMFIQLAGDPKTTLAAAREAGATIAYGNFITLLINFLIIAWVLFLVVKL
                     MNRLKKREEAKPAPAAPSEEVLLTEIRDILAKQQKA"
     CDS             complement(24262..25539)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10024"
                     /product="8-amino-7-oxononanoate synthase"
                     /db_xref="GOA:A0A1M4L942"
                     /db_xref="InterPro:IPR001917"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR010961"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L942"
                     /protein_id="SBW13220.1"
                     /translation="MDYRRFFEEAIDQLHAEKRYRVFADLERIVGRFPQAIWRNNGTA
                     REITVWCSNDYLGMGHHPDVIKAMCETAGSAGSGAGGTRNISGNNHPLVELESELADL
                     HGKEAGLVFTSGFVSNEASISTIARLLPNCLILSDELNHASMIEGVRRSGAEKKIFRH
                     NDVEHLEQLLKAADRSRAKLIVFESVYSMDGDIAPIEKIADLADKYNAMTYIDEVHAV
                     GMYGAHGGGITERDGLAHRIDIIEGTLAKAFGALGGYITGSRAIIDAVRSYAPGFIFT
                     TSLPPAVAAAATAAIRHLKSSQAERDGQQRQAQRAKDVLSAAGLPVMPSQTHIVPILV
                     GDPELCKKASDRLLEVHGIYIQPINYPTVPRGTERLRITPSPLHDDKLIDGLKDALLE
                     VWNELGIPFAEPSAPQAANSDRIIPLMVSKAGG"
     CDS             complement(25685..26386)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10025"
                     /product="polysaccharide deacetylase family protein"
                     /db_xref="GOA:A0A1M4L8X6"
                     /db_xref="InterPro:IPR002509"
                     /db_xref="InterPro:IPR011330"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L8X6"
                     /protein_id="SBW13221.1"
                     /translation="MPVPILLYHQIAPLPAKNIPFRGLLVHPDRFRSQMRWLKRLGYQ
                     GLSLRDAMPYIKGEKTGKVAVITFDDGYLNVLENAGPVLAEYGFTATNYFVANQVGGS
                     NVWDQPIGVPKTPCMSVAQLREWAALGHEVGAHTLDHVALSKVPEDEARRQIAQSKTV
                     LEDMLGTQVTNFCYPYGDNTPIHREMVREAGYETATTTVRARARPTDDPFGIPRIYVR
                     RRDLWPKFVVRLRVR"
     CDS             complement(26395..27114)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10026"
                     /product="glycosyl transferase, family 25"
                     /db_xref="GOA:A0A1M4L8Z1"
                     /db_xref="InterPro:IPR002654"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L8Z1"
                     /protein_id="SBW13222.1"
                     /translation="MNVKAFIIHLKRATDRAPQVEKLIKELPVRAEVIEAVDSRALGN
                     DEIARIYKRRLHTPRYPFALSRNEIACFLSHRKAWQAIIDRKLDAGFIVEDDIALTEN
                     FMGAYRAAVNHLEPGGFIRFTFRDDREHGREVFRDEAVRIIIPNPIGLGMVAQLVSYD
                     AARKLLDITQTFDRPVDTTVQMRWVTGLQPLSVIPGGVKEISSQLGGTTIQHKKNFSD
                     KLAREILRPIYRMRVRAYSSK"
     CDS             complement(27244..27918)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10027"
                     /product="hypothetical protein"
                     /db_xref="GOA:A0A1M4L920"
                     /db_xref="InterPro:IPR001675"
                     /db_xref="InterPro:IPR038578"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L920"
                     /protein_id="SBW13223.1"
                     /translation="MFAEHLQPFGKTSGVKAGKMKKTLVIVGNGPLTRDLSSEIDSAD
                     YVLRFNEPRESIGMSGSKTDLLMLATSSKQMQQWLKYPTFLNSAIFRNAQELLFAFHP
                     AIIRQFHHRPNFLSRWLKGRRADWTTKAIEVLGAQGKEIRIMPPQFYLGVCEELGITA
                     DKMAELFPSTGFFGIWYMLRNFPQSQWNILICGFSWQGWKHHDWSAERQWIEEKIKSG
                     VITPLI"
     CDS             complement(28010..28195)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10028"
                     /product="hypothetical protein"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L950"
                     /protein_id="SBW13224.1"
                     /translation="MEGQVIFYKNDRIIYRHHIDVQEDDYSKGVNDALIAFQRNYAGF
                     DLASDDIHIRFKKPGDV"
     CDS             complement(28290..29180)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10029"
                     /product="transcriptional regulator, LysR family"
                     /db_xref="GOA:A0A1M4L8U5"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="InterPro:IPR036390"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L8U5"
                     /protein_id="SBW13225.1"
                     /translation="MNLRSFQAFAEVVRQGGFSAAARTINATQSTVSKAVKQLEEELQ
                     LVLLDRAVSPPRLTAAGEIVYRRARAMLTEKDDMLAELGELRGLKRGLLRLGLPPIGS
                     SVLFAPVFAAYTSLYPDIDIQLVEHGSKRLEELLLAGDVELAASLLPVEESFAWQDVR
                     CEPVVALLPASHPVSDDDGVTLREIANLPFILFESGFALNHIILSACQRHGFSPNVAV
                     RSSQIDFIVELVAAGMGIGFLPQMIAEQRHHPGVRIHRVKDADVNWHMAFVWRKGAFL
                     SHAARAWLALCEGASTPAKA"
     CDS             29302..29721
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10030"
                     /product="LrgA family protein"
                     /db_xref="GOA:A0A1M4L8Y4"
                     /db_xref="InterPro:IPR005538"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L8Y4"
                     /protein_id="SBW13226.1"
                     /translation="MNTPRKAHDLKIRLRYALHNSRLMQIATLVGFWLAGEAVVRLAG
                     LPLPGGIVGMALVLALLLSGRISLFSMKRGAEWFLAEMLLFFIPAVLAILEHRELIGM
                     LGLKIMAVILLGTLTVMSVTALTVDLCYRWSLRYAAR"
     CDS             29708..30415
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10031"
                     /product="LrgB family protein"
                     /db_xref="GOA:A0A1M4L8X5"
                     /db_xref="InterPro:IPR007300"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L8X5"
                     /protein_id="SBW13227.1"
                     /translation="MLPGDPLGNPFMATLFWSAATILLYLAAKRVYRRFPLWWLTPLA
                     VTPLLLMALVIGLDENYRVYFSATHWLVALLGPATVAFAIPIYQQRATIRRYWPVLLA
                     GVLVGSSAAMASAWGLAHLLGLNEAISLSLMPRSMSTPFAMTVSGDIGGRPDLTAIFV
                     VLTGIFGAALGEIMLHWLPVRSALARGALFGMGAHGAGVARAHQIGSEEGSIAGLVMV
                     LVGLVNVLAAPLIAHFL"
     CDS             30965..32212
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10032"
                     /product="lipoprotein, putative"
                     /db_xref="InterPro:IPR010297"
                     /db_xref="InterPro:IPR014586"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L8W7"
                     /protein_id="SBW13228.1"
                     /translation="MDLRRIVLRFAPALLVCFSLLAGCASRPEGVLVPIGETVPQASE
                     VNLLVATTRAPSGNPGTLFSGERGKKISLTDIIVSIPPDRNRKVGEVQWPKRLPPNPL
                     KDFATVAVEPLHGDAAARHWINTHLPRTKRVMIFIHGFNNTFEDSVYRFAQIVHDSGA
                     DVAPIIFTWPSRASVFDYNYDKESTNYSRDALEHVLRVVANDPQVRDVTVMAHSMGAW
                     LAMEALRQMAIRDRRVNAKITDVILASPDIDVDVFGKQFQAMGSHHPRFTLFTSRDDK
                     ALALSRRISGNIDRLGQIDPSVEPYRSKLEKAGIVVIDLTQLKAGDRLNHSKFASSPE
                     VVQLIGRRLVAGQTITDSEIGIGDRLGAVALGTAQGVGSAASLVVTAPIAVFDPRTRR
                     TYDEQIDRFGRAVGNTVGAVIMP"
     CDS             32299..33180
                     /codon_start=1
                     /transl_table=11
                     /gene="panC"
                     /locus_tag="BR10RB9215_C10033"
                     /product="pantoate-beta-alanine ligase"
                     /EC_number="6.3.2.1"
                     /db_xref="GOA:A0A1M4L8Z4"
                     /db_xref="InterPro:IPR003721"
                     /db_xref="InterPro:IPR004821"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L8Z4"
                     /protein_id="SBW13229.1"
                     /translation="MQIIHTIEELRQALAPARQQGKKIGFVPTMGYLHKGHLELVRRA
                     RVENDVTVVSIFVNPLQFGANEDLGRYPRDLERDADLLHDAQVDYLFAPAVSDMYPRP
                     MQTVVDVPPLGNQMEGEARPGHFAGVATVVSKLFNIVGPDAAYFGEKDFQQLVIIRRM
                     VDDMAIPVRIVGVETVREDDGLACSSRNVYLTPEQRRAAIIVPQALDEADRLYRSGTD
                     DPDALEAAIRTFIGRQPLAVPEVIAIRDPQTLERLPALQGRPILVALFVRVGATRLLD
                     NRVIGHAAPQITQERAA"
     CDS             33182..34009
                     /codon_start=1
                     /transl_table=11
                     /gene="panB"
                     /locus_tag="BR10RB9215_C10034"
                     /product="3-methyl-2-oxobutanoate
                     hydroxymethyltransferase"
                     /EC_number="2.1.2.11"
                     /db_xref="GOA:A0A1M4L952"
                     /db_xref="InterPro:IPR003700"
                     /db_xref="InterPro:IPR015813"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L952"
                     /protein_id="SBW13230.1"
                     /translation="MSAPVTRKRLTPKAIQAMKGECPIVSLTAYTTPVARLLDPHCDL
                     LLVGDSLGMVLYGMESTLAVTLDMMIMHGQAVMRGTSHACVIVDMPFGSYQESKEQAF
                     RNAARVMQETGCDGVKLEGGEEMAETVAFLVRRGIPVFGHVGLMPQQVNTVGGFRSLG
                     RGDDEAGKIRRDAQAIAQAGAFAVVIEGTVEPLAREITALIDIPTVGIGASSACDGQV
                     LVSDDMLGLFQDFTPRFVKRFAHLAPQVSQAAEAYAEEVRARRFPGPEHVFGAKPGA"
     CDS             34022..34153
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10035"
                     /product="putative membrane protein"
                     /db_xref="GOA:A0A1M4L8Y8"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L8Y8"
                     /protein_id="SBW13231.1"
                     /translation="MADDIAHTDLIAVLVAVLIAVIEDEPRIMTVRGCSHFGWLDHA"
     CDS             complement(34218..34994)
                     /codon_start=1
                     /transl_table=11
                     /gene="fpr"
                     /locus_tag="BR10RB9215_C10036"
                     /product="ferredoxin-NADP reductase"
                     /EC_number="1.18.1.2"
                     /db_xref="GOA:A0A1M4L903"
                     /db_xref="InterPro:IPR001221"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR001709"
                     /db_xref="InterPro:IPR008333"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="InterPro:IPR033892"
                     /db_xref="InterPro:IPR039261"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L903"
                     /protein_id="SBW13232.1"
                     /translation="MSSNFNQETVTDIHHWTDTLFSFRTTRDPGFRFQSGQFIMMGLE
                     VNGKPLTRAYSIASSLYEDGLEFFSIKVPNGPLTSKLQHLKKGDQIIVSKKPVGTLLY
                     DNLKPGKHLWLLSTGTGLAPFLSIIRDLEVYERFEKVILVHGVRQVAELAYTDFISNE
                     LPQDEFLGEMVKNQLIYYPTVTREPYKNRGRLTDLIRSGQLFKDVGLPEFNHEDDRMM
                     LCGSPEMLAETKQILEERGFTEGSQSEAGEFVIEKAFVEK"
     CDS             35779..36876
                     /codon_start=1
                     /transl_table=11
                     /gene="nspC"
                     /locus_tag="BR10RB9215_C10037"
                     /product="carboxynorspermidine decarboxylase"
                     /db_xref="GOA:A0A1M4L930"
                     /db_xref="InterPro:IPR005730"
                     /db_xref="InterPro:IPR009006"
                     /db_xref="InterPro:IPR022643"
                     /db_xref="InterPro:IPR029066"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L930"
                     /protein_id="SBW13233.1"
                     /translation="MIQTPYYLIDKTKLKRNMEKIAYVREKSGAKALLALKCFATWSV
                     FDLMSEYMDGTTSSSLNEVRLGHEKFGGETHAYSVAYADHEIDEVISHADKIIFNSIG
                     QLERFADKASGIKRGLRLNPGVSSSSFDLADPARPFSRLGEWDVAKVEKVMDRITGFM
                     IHNNCENSDFSLFDRMLSDIEEKFGSLLHRVEWVSLGGGIHFTGEDYPVDAFCARLKS
                     FSEKFGVQVYLEPGEASITRTTTLEVTVLDTLFNGKNLAIVDSSIEAHMLDLLIYREK
                     AKMAPNNGGHSYMVCGKSCLAGDIFGEFTFDKPLAIGDRLSFEDAAGYTMVKKNWFNG
                     VKMPAIAVRELDGTVKLVREFDYADFEGSLS"
     CDS             37058..38299
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10038"
                     /product="hypothetical protein"
                     /db_xref="GOA:A0A1M4L956"
                     /db_xref="InterPro:IPR005097"
                     /db_xref="InterPro:IPR032095"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L956"
                     /protein_id="SBW13234.1"
                     /translation="MKKNVLIIGAGGVAQVVAHKCAQNSDVLGDIHIASRTVEKCRRI
                     IDSVREKKSLKTEVKLEAHALDAMDVEATKALIRKTGVQIVINVGSAFLNMSVLRACI
                     DTGVAYMDTAIHEDPKKICETPPWYGNYEWKHLKECEEKGITAILGIGFDPGVVNAYA
                     RLAADDYLDEVKSIDIVDINAGSHGRWFSTNFDPEINFREFTGTVYSWQSGQWQSNKM
                     FEVGQTFDLPVVGPSKAYMTGHDEVHSLSKNYPNADVRFWMGFGDHYINVFTVLKNLG
                     LLSEQPVKTAEGLEVVPLKVVKAVLPDPASLAPDYTGKTCIGDFVKGTKDGKDKEVFI
                     YNVADHKDAYNEVGSQGISYTAGVPPVAAAILIASGEWDVKKMVNVEELNPKPFLHIL
                     NQIGLPSRIKDENGDRALDFA"
     CDS             complement(38576..39604)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10039"
                     /product="proline racemase, putative"
                     /db_xref="InterPro:IPR008794"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L8V8"
                     /protein_id="SBW13235.1"
                     /translation="MRSTKVIHIVGCHAEGEVGDVIVGGVAPPPGETVWEQSRFIAND
                     ETLRNFVLNEPRGGVFRHVNLLVPPKDPRAQMGFIIMEPADTPPMSGSNSICISTVLL
                     DSGIIAMQEPVTHMVLEAPGGIIEVEAECRNGKAERISVRNVPSFADRLDAPLEVAEL
                     GTIMVDTAYGGDSFVIVDAAQIGMKIEPSQARELAEIGVKITKAANEQLGFRHPEKDW
                     RHISFCQITEPVTREGDVLTGVNTVAIRPAKLDRSPTGTGCSARMAVLHAKGQMKAGE
                     RFIGKSVLGTEFHCRLDKVLELDGKPAISPIISGRAWVTGTSQLMLDPSDPFPHGYRL
                     SDTWPRGE"
     CDS             40057..41472
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10040"
                     /product="multidrug resistance protein NorM, putative"
                     /db_xref="GOA:A0A1M4L8Z5"
                     /db_xref="InterPro:IPR002528"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L8Z5"
                     /protein_id="SBW13236.1"
                     /translation="MDGTFDAGFREPTISKANRWGREMVVALKLGWPLIFTNLSQAAL
                     TATDVIFIGRLGADTLASALLATSFYHTLMIFSMGLVSAVMPMIAIALGKNRHSVRDV
                     RRTVRQGFWSAIMIVIPLWVVLWHCEEIFLFLGQRPDIAARSTDFMHTLQWALLPYLF
                     YIVLRSFFAAMEKPMWTLLVAALAIGFNALAGWTLIFGHFGFAPMGLHGAGMATTASS
                     TMMFLGLAFITLRHPRFRRYHLFGRFWRPDWPRLIELWRIGLPMALTFVFETSIFYAA
                     VVMMGRIGPTAMAAHAVAIQIASLSFMVPLGFGQVATVRVGRAYGRGDPKAIAYAGWS
                     AYALGVGFMALMGILMVLMPRVFIGIFLNLNDPQNLPVMELAVTFLALAALFQIVDGA
                     QAVAAGMLRGLRDTRIPMLLALFGYWGVGLPLGAVLAFHFGMGGVGIWLGLAAGLGMV
                     AVLMTIRWRRHLAHVSAVAAA"
     CDS             complement(41518..42039)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10041"
                     /product="hypothetical protein"
                     /db_xref="InterPro:IPR010642"
                     /db_xref="InterPro:IPR038696"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L8Y7"
                     /protein_id="SBW13237.1"
                     /translation="MKHYRAIGLAFTFTALSSLSAFAASLPGGASTLQETYQDWTVSC
                     QSQKDTTACVMRQEQSSAQTGQRVLTAELRNVAGGKVDGVLLMPFGLDLAKGASLKID
                     DTAGPNLTFSTCLPQGCLAPVSFDAKQVAALKSGTNINVTTTALSPSQPVAFKISLKG
                     FGAALDRIQALTK"
     CDS             42287..43666
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10042"
                     /product="sensor protein degS"
                     /EC_number="2.7.3.-"
                     /db_xref="GOA:A0A1M4L8X8"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="InterPro:IPR011712"
                     /db_xref="InterPro:IPR017171"
                     /db_xref="InterPro:IPR033480"
                     /db_xref="InterPro:IPR036890"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L8X8"
                     /protein_id="SBW13238.1"
                     /translation="MTLRYQIVALAIIPLIVAILTITAFITWQSANLVQSSIATFEKN
                     MLKAKETELLNLTNLALSAIQKVYEEAGPNDEDAMEKVRAILTSLDYGRDGYFFVYDY
                     NGNNVVHPRQLFRPGHNWLNLTDPDGDRVIANLIAKAKEGGGLHRYKWEKPSSREMAD
                     KLSFAVGLDKWKWMLGTGVYLDDVYAQTAAANADFRANIRTTFLIVSLIAVPAVMLVF
                     ATCMLLNLRERRMADTKLKELAQRIIDTQEEERARLARELHDGISQNLVGVRYAIDLA
                     SRQVRTGSGGAPQAIEKASDALNGAIKEVRRLSHDLRPRILDDLGLTVALKALCEHFC
                     ERTGIETRFKADSLQETIKPEPSTALYRVVQEALTNVERHSGATRVDIRLKGANGKVT
                     MTIADNGNGFAVRGLKDPLSGLGLRNMQERMAHFGGVLLVETSADGTQLTARLPKSAT
                     ERRLEPEVA"
     CDS             43663..44304
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10043"
                     /product="LuxR family transcriptional regulator"
                     /db_xref="GOA:A0A1M4L908"
                     /db_xref="InterPro:IPR000792"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR011006"
                     /db_xref="InterPro:IPR016032"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L908"
                     /protein_id="SBW13239.1"
                     /translation="MTNECKIRVLLVDNHPLVLDGLRAVLETYDDIDIAGAASNARVA
                     LEMALAVNPDVVLMDINMPLLNGIDAIELFKRQLPNVRILMLSMHDSREYISTSIMRG
                     ASGYILKDVSTNEIVTAIHAVASGGTYFSSGVSEALLESGEKRSEGLSARENDVLVLV
                     AEGGSNREIAARLGISEATVETHRKNIKKKLGIASTAGLTRYAIENRLCLSSL"
     CDS             44592..45140
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10044"
                     /product="hypothetical protein"
                     /db_xref="GOA:A0A1M4L962"
                     /db_xref="InterPro:IPR007387"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L962"
                     /protein_id="SBW13240.1"
                     /translation="MSVLLALSRAIDAANNFIGKSVSWLVLVAVLISAINAVTRKLFN
                     VSSNAWLEAQWYLFSAVFLIAAGYTLLHSEHVKVDLLYSRYSRRTQLLVEIFGTIFFL
                     LPFCIITIYLSWPIVEAKIASGETSNNTGGLVLWPVWLLIPIGFSLLALQGISELIKR
                     IAILQGRIPDTVAIEDAEAQAL"
     CDS             45152..46720
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10045"
                     /product="TRAP dicarboxylate transporter, DctM subunit,
                     putative"
                     /db_xref="GOA:A0A1M4L8Z3"
                     /db_xref="InterPro:IPR004681"
                     /db_xref="InterPro:IPR010656"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L8Z3"
                     /protein_id="SBW13241.1"
                     /translation="MVAFFAENLAPLMFLSLVVVLLLGYPVAFALAFVGFAFGFIGIE
                     LGLLPVNLFGAIPDRIFGQMSNETLLAIPFFTFMGLILERSGMAEDLLDTIGQLFGPV
                     RGGLAYAVIIVGALLAATTGVVAASVISMGLISLPIMLRYGYDRKVASGTIAAAGTLA
                     QIIPPSLVLIVLADQLGRSVGDMYKGALVPGLLLVGVYVGFIIVMSILRPNSVPALPL
                     QARTLKGWKLVQRVVLSLVPPLVLIFLVLGTIFIGVATPTEGGAMGAVGALLLAIING
                     RLNLKMLTSALYATTKLSSFVIFILLGARVFSLTFYGVNGHVWVEHLMTSVPGGEVGF
                     LIVANILVFFLAFFLDYFELAFIIIPLLAPVADSLGIDLIWFGVMLAMNMQTSFMHPP
                     FGFSLFYLRSVAPSRPYKDKVTGATIQPVTSGQIYMGSIPFLLIQVVAVGVIIAFPGL
                     VTHYKGNHPQVDPASIQINVPMPDAGGGNPFGNAPAPFGAPSPAVEPLPAPSFGSPAP
                     SFGQGADQKEKPAQ"
     CDS             46782..47900
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10046"
                     /product="TRAP dicarboxylate transporter-DctP subunit"
                     /db_xref="GOA:A0A1M4L913"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="InterPro:IPR018389"
                     /db_xref="InterPro:IPR019546"
                     /db_xref="InterPro:IPR026289"
                     /db_xref="InterPro:IPR038404"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L913"
                     /protein_id="SBW13242.1"
                     /translation="MKETLSRRSFLTKGAAIGAAAATSGAALATPAIAAELPTLRWRL
                     TSGFPNNLDTIYGGAVYMADAVSKMTDGKFQIQVFQAGEIVPGPQAIDAVQANTVEMA
                     HTCGYYFTGKNPTFAIGTALPFGMNTRLQNAWLYHGGGNELYNEFLSDYGIVGIVGGN
                     TAAQMGGWYRKEIKSAEDLKGLKMRIAGVAGEVMSRLGVVPQQLPGGDIYPSLERGTI
                     DAAEWVGPYDDEKLGFYQIAPYYYYPAFWEGGASVHFFINKKQYESLPEAYKVALNTA
                     AEAATQNMIALYDVKNTAAIRSLVSKGVKLQPLPRDVLDAAYKVSFDLYAEYNEKNPA
                     WAKIYPAWKKFRDEGFEWFRVAEYTYDSYVYAAQAAGK"
     CDS             complement(47983..48801)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10047"
                     /product="hypothetical protein"
                     /db_xref="InterPro:IPR008579"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR013096"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR017627"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L939"
                     /protein_id="SBW13243.1"
                     /translation="MSRNYYAPTGGLPPQTQLLTDRAMFTEAYAVIPKGTFSDIVTSF
                     LPFWEKTRLWVIARPLSGFAETFSQYIMEVQPGGGSDRAELDEGAEGVLFVVEGEVSV
                     TVAGKTHRLEEGGYAYLPPKSGWRLRNEGAATARFHWIRKAYEYVDGLDVPEPLFLNE
                     KDIAPSPMPDTGGAWATTRFVDPNDLRHDMHVTVVTFEPGGVIPFAETHVMEHGLYVL
                     EGKAVYRLNQDWVEVEAGDFMWLRAFCPQACYAGGPGKFRYLLYKDVNRHMKLA"
     CDS             complement(48814..50241)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10048"
                     /product="chitin deacetylase"
                     /EC_number="3.5.1.41"
                     /db_xref="GOA:A0A1M4L974"
                     /db_xref="InterPro:IPR002509"
                     /db_xref="InterPro:IPR011330"
                     /db_xref="InterPro:IPR017580"
                     /db_xref="InterPro:IPR017625"
                     /db_xref="InterPro:IPR018020"
                     /db_xref="InterPro:IPR036778"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L974"
                     /protein_id="SBW13244.1"
                     /translation="MKYPRNLVGYGRNTPDPRWPGGANIAVQFVVNYEEGGECCILDG
                     DPASECLLSEIVGAQPWRGQRNLNMESIYEYGARSGFWRLWRAFTRRNMPVTVYGVTL
                     AMARNPEAVAAMKEAGWEIASHGLRWWEYKDVPEEIEREHIREAVRLHTEVTGARPLG
                     IYQGKPSDNTLKLVMEEGGFLYSADSYADELPYWVKGPKGPHLIVPYTLDANDMRFAT
                     PQGFNSGDQFFTYLKDSFDVLYREGEEGAPKMMSIGLHCRVAGRPGRMAALERFLDYV
                     QSHDKVWVAKRVDIARHWHEHHRPVVADVVPSKADRQAFVARYGSIFEHSPWIAERAY
                     DARLTAEEDSASGLAAAMTKVFRAAAPDERLAVLKAHPDLAGKLAQARRLTAESTAEQ
                     ASAGLDALTDTEKQAFTELNDAYTAKFGFPFIIAVKGRNKQEILDAFRRRVSNDRDTE
                     FETACAQVERIALLRLKDILPEILY"
     CDS             50508..50783
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10049"
                     /product="hypothetical protein"
                     /db_xref="InterPro:IPR036817"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L8W4"
                     /protein_id="SBW13245.1"
                     /translation="MGQEQNGYGRSRMHIPGQASGKPAANPYMELHPIGKRQAENLEE
                     APIREAGHRSVAFRNSVHLRFGICGGKAHYRLLRLVSPFSCSTCWGS"
     CDS             50789..52267
                     /codon_start=1
                     /transl_table=11
                     /gene="xdhA"
                     /locus_tag="BR10RB9215_C10050"
                     /product="xanthine dehydrogenase, small subunit"
                     /EC_number="1.17.1.4"
                     /db_xref="GOA:A0A1M4L905"
                     /db_xref="InterPro:IPR001041"
                     /db_xref="InterPro:IPR002346"
                     /db_xref="InterPro:IPR002888"
                     /db_xref="InterPro:IPR005107"
                     /db_xref="InterPro:IPR006058"
                     /db_xref="InterPro:IPR012175"
                     /db_xref="InterPro:IPR012675"
                     /db_xref="InterPro:IPR014307"
                     /db_xref="InterPro:IPR016166"
                     /db_xref="InterPro:IPR016167"
                     /db_xref="InterPro:IPR036010"
                     /db_xref="InterPro:IPR036318"
                     /db_xref="InterPro:IPR036683"
                     /db_xref="InterPro:IPR036884"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L905"
                     /protein_id="SBW13246.1"
                     /translation="MGQSARHEIRFLLNGETIVLDRVSPTETLLDYLRLSARLRGTKE
                     GCGEGDCGACTVLVGRAVDGGLVYESVNACIRFVGSLDGCHVVTIEYLRGADGDLHPV
                     QKAMVEFHGSQCGFCTPGFVMSLYALWMRDPRPADAAIEKALQGNLCRCTGYEAIMRA
                     ARAISDYGNVAQDPLAAERAHVLERLTALRDGARVEVGAGKDRLIVPADLDDFATILA
                     AEPKATIVAGSTDVGLWVTKMMRDISPVVFIGHLEELHSIREENGVVTIGAGVTYTQA
                     FGFLAGRIPALGQLINRIGGEQVRNMGTIGGNIANGSPIGDTPPPLIALGATLTLRKG
                     AERRTIALEDFFIAYGKQDRGAGEFVEAVHVPLPGEGSRFAAYKVSKRREEDITASLG
                     AFHLMLDAAGNVAHIRIAYGGMAATPKRAFAVETALMGKPWTEATVEAALEAYAQDYT
                     PLTDMRATAEYRLLVARNMLRRFYLETTDSGETLGALRGEAA"
     CDS             52280..54634
                     /codon_start=1
                     /transl_table=11
                     /gene="xdhB"
                     /locus_tag="BR10RB9215_C10051"
                     /product="xanthine dehydrogenase, molybdopterin binding
                     subunit"
                     /EC_number="1.17.1.4"
                     /db_xref="GOA:A0A1M4L8Z8"
                     /db_xref="InterPro:IPR000674"
                     /db_xref="InterPro:IPR008274"
                     /db_xref="InterPro:IPR014309"
                     /db_xref="InterPro:IPR036856"
                     /db_xref="InterPro:IPR037165"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L8Z8"
                     /protein_id="SBW13247.1"
                     /translation="MNRHSATDIKTARIRGGVATEQKHDSAHKHVTGTAVYIDDIPEP
                     EGTLHIGVGYASVAHGRIKSIDLEAVRAAPGVVDILTCKDVPGKNDVSPSGMHDDPIF
                     AVDKVEFHGQPIFAVIAKTRDQARRAARLAKIEYEEAPGIYSIDMLDGLKGRLVTTPL
                     TLERGNARAAIDAAPHRIRNRMYLGGQDHFYLEGQVSLAVPGEDEDVTVYCSTQGPSE
                     TQHLVAHALGVSSHSVTVEVRRMGGGFGGKETQANQWAAIAAIAAKKHKRAMKIRLDR
                     DEDMTSTGKRHGFVIDYEVGFDDDGTILGVDYLYALNAGFSADLSGPVGDRALFHCDN
                     AYFYPAVHAQSAPLYTNTVSNTAFRGFGGPQGMAGAERVIDEVAFALGKDPLEIRKRN
                     FYDEMGKDGTRNVTPYHQKVEDCIIQRIVAQLEESADYAKRREAIREFNAKSRYVKRG
                     IALTPVKFGISFTKTESNQAGALVHVYADGSVHMNHGGTEMGQGLHMKVAQVVAEEFQ
                     IDIDRVKITATTTAKVPNTAPTAASSGADLNGMAAQDAARQIKKRLIRFAAQQYQVPE
                     DQIMFLPNRVRVGNQEISFNDLVNQAYIGRVQLSAAGHYKTPKIHWDRAKGRGHAFYY
                     YAYGAACSEVSVDTLTGEYVVERTDILHDTGRSLNRAIDIGQIEGGFVQGMGWLTTEE
                     LVWDEKGRLRTHAPSTYKIPLASDRPKIFNVALTDWSEAYEPTIHRSKAVGEPPLPLG
                     LSVLHALADAVASVADYKVCPRLDAPATPERVLMTVERLRKQNG"
     CDS             54627..55511
                     /codon_start=1
                     /transl_table=11
                     /gene="xdhC"
                     /locus_tag="BR10RB9215_C10052"
                     /product="xanthine dehydrogenase accessory protein Xdhc"
                     /db_xref="InterPro:IPR003777"
                     /db_xref="InterPro:IPR014308"
                     /db_xref="InterPro:IPR027051"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L8Y3"
                     /protein_id="SBW13248.1"
                     /translation="MARTMPGARDDIRTFLHQRPARNGLDCVLVEVTDVKGSAPRDAG
                     AWMLVARDTIFRTIGGGQLEYMAIEHARKILSGGRDTPLDVPLGPEIGQCCGGRVSLS
                     FRLMTYGLADELVGKVDAEIAMRPHVYIFGAGHVGDALAHALSLTPVRVVMVDTREAE
                     LMKFQEKWEPVFRPGFHGNYICDVPGVETCLSAMPEQVVRSAPPHSAFIILTHDHALD
                     FLIAAEALQRQDAAYVGMIGSKTKKATFKNWLKREAGREDLFENLVCPIGGAVVKDKR
                     PEVIAALAAAEILTAVLV"
     CDS             complement(55860..56774)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10053"
                     /product="transcriptional regulator, LysR family"
                     /db_xref="GOA:A0A1M4L915"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="InterPro:IPR036390"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L915"
                     /protein_id="SBW13249.1"
                     /translation="MSYLDNLRVFVRVVELGNLSAAGRDQRASPAVASNRIKELEKHL
                     GVRLFNRTTRKLTPTEHGRVFYDGALKILEAVDEAEAAVAELAKNPKGSIRITAPLGF
                     GRRLIASGIPEFHDRYPDIEVRLRLSDHEVDIMSEGVDVAFKLGVLENSNLRMRGIMN
                     CERVVCAAPQYLERHGTPQSPEALLSDRHHCLLLRFPGSKEYYWLLQTPEGLRKFEVT
                     GPYDSDDGDVLTQWALGGRGIINKPLFEVKEYIRDGRLTPILQHTPPAPIQLAAIYPH
                     KRLQDPKVRLIIDFMTERCQRLIREALA"
     CDS             56955..58208
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10054"
                     /product="putative membrane spanning protein"
                     /db_xref="GOA:A0A1M4L967"
                     /db_xref="InterPro:IPR009056"
                     /db_xref="InterPro:IPR010389"
                     /db_xref="InterPro:IPR036909"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L967"
                     /protein_id="SBW13250.1"
                     /translation="MYDFAVAWDWLGFAVRWLHVTTAIAWIGSSFYFIALDLGLRQRP
                     GLPEGAYGEEWQVHGGGFYQIQKYLVAPAQMPEHLTWFKWESYATWLSGFTLLCVVYY
                     AGADLYLVDPNVLDVSVPVAIAISIASLAFGWIAYNTICNMMLGRSDTLLMVILYCIL
                     VVMAWGYTHLFTGRAAFLHLGAFTATIMSANVFMIIIPNQKIVVADLIAGRKPDPKYG
                     KIAKQRSTHNNYLTLPVLFLMLSNHYPLAFGTEFNWIIASLVFLMGVTIRHWFNTRHA
                     RKGNPTWTWLVTVILFIIIIWLSTVPKILTGEPENPKVSALQQSFLNDPHFDKVRDTV
                     LGRCSMCHATEPGWEGIIAPPKGVVLDTDRNIAAHAREIYLQAGRSHAMPPANVTGVT
                     DEERQLLASWYQSVTTGPKEGTKTE"
     CDS             58205..59509
                     /codon_start=1
                     /transl_table=11
                     /gene="guaD"
                     /locus_tag="BR10RB9215_C10055"
                     /product="guanine deaminase"
                     /EC_number="3.5.4.3"
                     /db_xref="GOA:A0A1M4L902"
                     /db_xref="InterPro:IPR006680"
                     /db_xref="InterPro:IPR011059"
                     /db_xref="InterPro:IPR014311"
                     /db_xref="InterPro:IPR032466"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L902"
                     /protein_id="SBW13251.1"
                     /translation="MTKLLIRGRVLTFRDEPQSLDDSHAYRYIEDGAVLVENGRILRL
                     GDYAEVSGEAGADVKLADHRPHLIVPGFIDTHIHYPQTQVVASYAANLLEWLNTYTFV
                     AEQKFADEQHAEFIAERFLDELIRHGTTTAAAYCSVHPQSVDAYFRASQHRNMRMLGG
                     KVMMDRNAPPALCDTAQSGYDDTKALIARWQGQGRLDYVITPRFAITSTPEQLEASQT
                     LVREHPECFVQTHLSENHDEIAFTRSLYPDAPDYLGIYEHYGLLGNKTLLGHSIHLEE
                     REVRLMAETGSIAVFCPTSNLFLGSGLFDRDRLKAAGVRMAVATDIGGGTSFSMLRTM
                     DEGYKVLQLRGQRLNPFQSFYMMTLGNARALSMEDRIGTLEEGTEADIVVLDSSATSP
                     MRLRMAAGATLEQELFLLQTLGDDRAIVETYVAGKPMKADLL"
     CDS             59589..60875
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10056"
                     /product="hydroxypyruvate reductase, putative"
                     /EC_number="1.1.1.81"
                     /db_xref="GOA:A0A1M4L925"
                     /db_xref="InterPro:IPR007835"
                     /db_xref="InterPro:IPR025286"
                     /db_xref="InterPro:IPR037035"
                     /db_xref="InterPro:IPR038614"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L925"
                     /protein_id="SBW13252.1"
                     /translation="MSAIADPKKFLTSLFDAAVAAADPELVIRANLPEKPKGRTIVIG
                     AGKGSAQMAAAFERAWAEKHDAPLEGVVVTRYGYGAPCERIRIIEAAHPVPDEAGLQA
                     SKRLFNAVSGLSEDDLVVALISGGGSALLPSPPEGMTLEDEIAVNKALLASGAPISAM
                     NAVRKHLSTIKGGRLAAAAHPAKVFSLVVSDIPGDNPAFVASGPTVPDETSRDEALKI
                     IERYRLDLPQAALAHIKSENAHAPQLGDIIFARNEVRVIASAAVSLEAAAREASRLGV
                     EAVILSDSVEGEAREVAHVHAAIAREVAERDRPFKKPVVILSGGETTVTIGSQGGKGG
                     RNSEFLLSFALDIDGYANIHALAADTDGIDGSEDNAGAFADGGTVSRLQKLGEDGMAR
                     LNANDAWTAFNALGDLFVPGPTGTNVNDLRAILITV"
     CDS             complement(60856..61014)
                     /codon_start=1
                     /transl_table=11
                     /gene="ccoS"
                     /locus_tag="BR10RB9215_C10057"
                     /product="cytochrome oxidase maturation protein,
                     cbb3-type"
                     /db_xref="InterPro:IPR004714"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L949"
                     /protein_id="SBW13253.1"
                     /translation="MSGLIFLIPIALFLGLLGLAAFLWSLKSGQYDDLDGAANRILLD
                     DESKPLSK"
     CDS             complement(61011..63269)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10058"
                     /product="heavy metal translocating P-type ATPase"
                     /db_xref="GOA:A0A1M4L979"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR006121"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023298"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="InterPro:IPR027256"
                     /db_xref="InterPro:IPR036163"
                     /db_xref="InterPro:IPR036412"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L979"
                     /protein_id="SBW13254.1"
                     /translation="MSCCVENAQIATVIQSVSPEEMQIASRALGDGLRQLDLSVPGVH
                     CGLCIKTIEDALGKISGVAYVRVNLTARRVTLRWKDGETPPNVVDTLRRLGYEAHIFD
                     MAQDKDPTFTRLLIALGVAAFASSNVMLLSVAVWSGADAATRDMFHWISGLIAFPTLV
                     YSGRIFYVSAWNALRAGRVNMDVPIALAISLAFAMSVYETIHHGQHAYFDASVTLLFF
                     LLIGRTLDYMMRARARSAVRGLAQLGSRGAVVIGENDERNYLPVNEIRPGMRIILAAG
                     ERVPVDAKVEEGRSELDCSIASGESDAVPVGPGSDIRAGTLNLSTPLVIRATAEARDS
                     FLSEMVRLMDIAEDGRAHYRRLADRASELYVPMVHATAFLAFAGWMFYTGGDWYRSIY
                     IAISTLIITCPCALALAVPIVQVVAARRLFENGIMIKDGSAMERMAEIDTAVFDKTGT
                     LTLGQPWLINAQEIEPHYLEIAAELSLYSRHPLSRALALFSGATPMTPFTRIEEVPGA
                     GIEAELDGTTYRLGKQEWACGKAETAQPSGPETCLSIDGRLVQVFRFEDRPREDAANA
                     IAALKRNGLKLGIISGDKQAAVKKLADYLGVNDYHSGVLPADKSKLVQELSSEGRKVL
                     MVGDGLNDAPALVAAHVSMAPATAADIGRNAADFVFLRESLSAVPLAFAVSKEAGKLV
                     SQNFGLSIGYNIIAVPIAVFGYVTPLVAALSMSLSSIVVVTNALRLRAGKQKQQARQS
                     GAPATTMKEAHK"
     CDS             complement(63266..63763)
                     /codon_start=1
                     /transl_table=11
                     /gene="ccoH"
                     /locus_tag="BR10RB9215_C10059"
                     /product="cytochrome cbb3 oxidase maturation protein CcoH"
                     /db_xref="GOA:A0A1M4L8X4"
                     /db_xref="InterPro:IPR008620"
                     /db_xref="InterPro:IPR018037"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L8X4"
                     /protein_id="SBW13255.1"
                     /translation="MSTNSKTSGTFTGWHMLGIMFMFFGVIIAVNLLMAYNAVHSWSG
                     LVVQNSYVASQEFNDKAKTGKEQAALNWQSKPAYENGVFTWQLADHNGKAVAMTGGTV
                     DFKRPVGDAHDTKVTLTVREPGILTAPLELGEGAWIMEVNADAGLEDPYRHIIRVLVK
                     DGKIL"
     CDS             complement(63763..65313)
                     /codon_start=1
                     /transl_table=11
                     /gene="ccoG"
                     /locus_tag="BR10RB9215_C10060"
                     /product="cytochrome c oxidase accessory protein CcoG"
                     /db_xref="GOA:A0A1M4L917"
                     /db_xref="InterPro:IPR013783"
                     /db_xref="InterPro:IPR014116"
                     /db_xref="InterPro:IPR017896"
                     /db_xref="InterPro:IPR017900"
                     /db_xref="InterPro:IPR032879"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L917"
                     /protein_id="SBW13256.1"
                     /translation="MSDDVERIDVQAVNSPKTRQSLYASRVKIFPKRVQGTFRRFKWI
                     VMFITLGIYYLTPWLRWDRGAYAPDQAVLIDLANRRFYFFFIEIWPQEFYYVAGLLIM
                     AGLGLFLVTSVAGRAWCGYTCPQTVWVDLFLVVERAVEGDRNARMKLDKAPWTFDKVW
                     KRLAKHSIWIVIGVLTGGAWIFYFADAPTLLKDFVTGHAAPVAYFTVAILTATTYIFG
                     GLMREQVCTYMCPWPRIQAAMLDENSLTVTYNDWRGEPRSRHSKKAIAAGETVGDCVD
                     CNACVAACPMGIDIRDGQQLECITCALCIDACDSVMDKIGKPRGLISYATLADYDANM
                     ALATNNGIASTDPARVYEAPNKFSDKVQNLSWKKVLRPRSMFYFAIWALIGVVLIVSL
                     STRQRIGINVLHDRTPQYVLLSDGSIRNGYTVKLLNMIPTPRTFQLSIQGLPEATLTV
                     QDETPDASGNYAIAVEPDKLKNLRVFVTMPHDAVTEPRKDYEIEVRAEDGSEGARYKA
                     TFMAPERK"
     CDS             complement(65465..66328)
                     /codon_start=1
                     /transl_table=11
                     /gene="ccoP"
                     /locus_tag="BR10RB9215_C10061"
                     /product="cytochrome c oxidase, cbb3-type, subunit III"
                     /EC_number="1.9.3.1"
                     /db_xref="GOA:A0A1M4L907"
                     /db_xref="InterPro:IPR004678"
                     /db_xref="InterPro:IPR008168"
                     /db_xref="InterPro:IPR009056"
                     /db_xref="InterPro:IPR032858"
                     /db_xref="InterPro:IPR036909"
                     /db_xref="InterPro:IPR038414"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L907"
                     /protein_id="SBW13257.1"
                     /translation="MTDKQIDEVSGVSTTGHEWDGIKELDNPMPRWWLWTFYATIFWA
                     IAYVIAYPAWPLISGSTAGLTGWSSRGQFWQENAKIAASRQGIIDQIKAKDVHEILAD
                     EELRQYAIAGGAAAFRVNCVQCHGSGAQGAPGYPNLNDDDWLWGGSIDDIVTTIRHGV
                     RSPDDPETRLSEMTAFADVLEPQQIRDVAAYVVSLSGTPHDPSMVPEGQKVFAENCAV
                     CHGADAKGLREFGAPNLTDAIWLYGSGEDAIIRQVSHPKHGVMPAWEARLGDATVKQL
                     AIFVHSLGGGE"
     CDS             complement(66321..66479)
                     /codon_start=1
                     /transl_table=11
                     /gene="ccoQ"
                     /locus_tag="BR10RB9215_C10062"
                     /product="cytochrome c oxidase, cbb3-type, CcoQ subunit"
                     /db_xref="GOA:A0A1M4L8Z0"
                     /db_xref="InterPro:IPR008621"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L8Z0"
                     /protein_id="SBW13258.1"
                     /translation="MDYNSLRTFADSWGLFGMALFFVFVVLYAFRPGSKKKADEAKEI
                     PFKDDKND"
     CDS             complement(66494..67225)
                     /codon_start=1
                     /transl_table=11
                     /gene="ccoO"
                     /locus_tag="BR10RB9215_C10063"
                     /product="cbb3-type cytochrome c oxidase subunit II"
                     /EC_number="1.9.3.1"
                     /db_xref="GOA:A0A1M4L926"
                     /db_xref="InterPro:IPR000883"
                     /db_xref="InterPro:IPR003468"
                     /db_xref="InterPro:IPR009056"
                     /db_xref="InterPro:IPR036909"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L926"
                     /protein_id="SBW13259.1"
                     /translation="MSILKNHSKLEKNATLLLIASLAVVTVGGLVEIAPLFYLENTIE
                     KVEGMRPYSPLELAGRDIYVREGCYLCHSQMIRPFRDEVERYGHYSLAAESMYDHSFQ
                     WGSKRTGPDLARVGGRYSNEWHVQHLVRPRDVVPESVMPSYAFLKERPLKTDDIAAHL
                     KTNVAVGVPYTKEMIDNALDDLKAQATPDADTSGMEERYPKARVGDFDGNPQMISEMD
                     ALIAYLQMLGTLVDFSTYDQSPKAR"
     CDS             complement(67240..68865)
                     /codon_start=1
                     /transl_table=11
                     /gene="ccoN"
                     /locus_tag="BR10RB9215_C10064"
                     /product="cbb3-type cytochrome c oxidase subunit I"
                     /EC_number="1.9.3.1"
                     /db_xref="GOA:A0A1M4L977"
                     /db_xref="InterPro:IPR000883"
                     /db_xref="InterPro:IPR004677"
                     /db_xref="InterPro:IPR023615"
                     /db_xref="InterPro:IPR023616"
                     /db_xref="InterPro:IPR036927"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L977"
                     /protein_id="SBW13260.1"
                     /translation="MNYAAGTVLSGLGALFAVLLAGFSHDELFRTHMWILFATLAIFT
                     ILLMRNADYGLTPKKVDQSTYMDGPIRYGVIATVFWGVVGFLVGVLIAAQLAFPDLNL
                     QPYFNFGRLRPVHTSAVIFAFGGNALICSSFYVVQRTCRARLFGGDLAWFVFWGYQLF
                     IVMAATGYLLGITQSREYAEPEWYVDIWLTIVWVAYLVVFMGTLLRRKEPHIYVANWF
                     YLSFIITIAMLHIINNLAIPVSFLGVKSYSAFAGVQDAVTQWWYGHNAVAFFLTVPFL
                     AMMYYFVPKQANRPVYSYRLSIVHFWSIIFLYIWAGPHHLHYTAVPDWAQTLGMVFSI
                     MLWMPSWGGMINGLMTLSGAWDKVRTDPIIRLMVAAIAFYGMATFEGPMLSIKAVNSL
                     SHYTDWTIGHVHAGALGWNGMISFAAVYYLAPKLWNRQRLYSIRMVNWHFWLATLGIV
                     LYASSMWVAGIQQGLMWREYDNQGFLVYSFAETVLAMFPYYVIRTIGGVFYLTGGLLM
                     AWNVYQTIRGRLRNEAPMGGTRPVAGATMQPAE"
     CDS             complement(69083..69541)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10065"
                     /product="ferric uptake regulator family protein"
                     /db_xref="GOA:A0A1M4L914"
                     /db_xref="InterPro:IPR002481"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="InterPro:IPR036390"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L914"
                     /protein_id="SBW13261.1"
                     /translation="MLFDPHKAPTSQPKPAKVKSILQQAGLRPTRQRMALGRLLFLDQ
                     NRHVTPDLLYEEALQAGVTLSVATVYNTLNQFAEAGLVRRISIHGERTYFDTDTGDHT
                     HFYIAEEGRIIDIPSENVSIGPLPAPPDGYRISKVDITIQIERDPGSKRI"
     CDS             70216..70890
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10066"
                     /product="ErfK/YbiS/YcfS/YnhG family protein"
                     /db_xref="GOA:A0A1M4L935"
                     /db_xref="InterPro:IPR005490"
                     /db_xref="InterPro:IPR038063"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L935"
                     /protein_id="SBW13262.1"
                     /translation="MPQPAAFQAYPAAPEFQPQVQTVQPQPEVQAPVSEYEAIYGEVR
                     DGGNVIPALDVSKIAKRNLRRQVDYVTDHPVGTIIVDPHARYLYLVQPGGKAMRYAVG
                     VGRAGLVFSGEAKVAYKAQWPRWTPTANMIKRNPDHYARYAKGLEGGIRNPLGARALY
                     LYRDGKDTLYRIHGTNEPWSVGKASSSGCIRLFNQDILDLYKHAPSGVRVVVLNKAQS
                     GKGESS"
     CDS             70887..71501
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10067"
                     /product="twin-arginine translocation signal domain
                     protein"
                     /db_xref="GOA:A0A1M4L958"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="InterPro:IPR036249"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L958"
                     /protein_id="SBW13263.1"
                     /translation="MMNRRQILAATAAGAATFALSGGSGLAQRVPSVAEVLYDKEIPV
                     LGNPNGDVTIVEYFDYQCPYCRKSHADLMRVVRKDGNVRLVMKDWIIFGETSAYAARL
                     VLAAEKSGNYEKAMEALMTTPGRLTRDQVDGALKKAGLDAAKLQAAYKADAKRIDGIL
                     QRNMKQGEAFNFGGTPSFVIGTRLYGGVMKEKELLEAIKNARKT"
     CDS             complement(71550..72995)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10068"
                     /product="succinate-semialdehyde dehydrogenase"
                     /db_xref="GOA:A0A1M4L990"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="InterPro:IPR029510"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L990"
                     /protein_id="SBW13264.1"
                     /translation="MPAIGFIIDGKENGGASGKIFERKDPVTGKVATVAAAASLADVD
                     AIAEAAAKAFESWSETGPNARRALLNKAADLMDSRTAEFTRLMLEETGATAPWAGFNV
                     HLGANILREAAALTTQITGEIIPSDKPGIMSMAVRQPVGVVLGMAPWNAPVILGVRAV
                     AAALACGNTVILRSSETCPGVHHLIIKTLNDAGFPAGVANVISNAPDDAPEIVAALIA
                     HPAIRRINFTGSTQVGRIIARQAAEHLKPVLLELGGKAPFIVLEDADLDQAVDAAAFG
                     AFMNQGQICMSTERFIVHEKVADAFAEKLAAKARSLPAGDPRGNVVLGSLVDLKSAQR
                     MDALIADAVAKGGRVLAGGKRDGAVVEATIIDGVTPQMDIYTQESFGPVKPIIRVKSA
                     EEAIRVANDTEYGLSSAIFSQDVKRALALSRKLETGICHINGPTVADEAQVPFGGVKS
                     SGYGRFGGKAAINEFTELRWITIEGPQHYPF"
     CDS             73194..74279
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10069"
                     /product="methylated-DNA-[protein]-cysteine
                     S-methyltransferase"
                     /db_xref="GOA:A0A1M4L8Y1"
                     /db_xref="InterPro:IPR001497"
                     /db_xref="InterPro:IPR004026"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR014048"
                     /db_xref="InterPro:IPR016221"
                     /db_xref="InterPro:IPR018060"
                     /db_xref="InterPro:IPR035451"
                     /db_xref="InterPro:IPR036217"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="InterPro:IPR036631"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L8Y1"
                     /protein_id="SBW13265.1"
                     /translation="MNLMIPKTHDLDESRWQKVLDRDKASDGEFVYAVRTTGVYCRPS
                     CPSRRGKRENVQFFNGCEDAERAGFRPCMRCKPDLSDTLATQNNARHAEMVASACRFI
                     ETAETQPSLEEIANAVKASPAHFHRVFKAFTGLTPKAYADAHRAGRMRAALDMPQIRV
                     TDAIYDAGYNSSSRFYEASDRILGMTPKVYRAGGKDADIRFAIGQSTLGAVLVAASGK
                     GVCAIFMGDDPQGLIHDLEKRFPKANLIGADRNFENLVAEVVGFVEAPGIGLDLPLDL
                     RGTAFQQRVWRALCEIPAGETVSYTEIAERIGAPRAVRAVAQACAANKIAVAVPCHRV
                     VRNDGGISGYRWGVERKRDLLERERKA"
     CDS             74461..74811
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10070"
                     /product="arsenate reductase"
                     /db_xref="InterPro:IPR006504"
                     /db_xref="InterPro:IPR006660"
                     /db_xref="InterPro:IPR036249"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L924"
                     /protein_id="SBW13266.1"
                     /translation="MSVTIYGIKNCDTMKKARIWLEDHGIDYAFHDYKKDGLDAETLD
                     RFLKTVPWEQLLNRAGTTFRKLPEDVRSNVDAASARELMLAQPSMVKRPVLERDGKLM
                     VGFKPAQYEAYFKL"
     CDS             75148..76191
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10071"
                     /product="hypothetical protein"
                     /db_xref="GOA:A0A1M4L916"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L916"
                     /protein_id="SBW13267.1"
                     /translation="MQQGIANILQHWLASWRDSLMACVAGSLAWLICEELLGQPKPIF
                     AMVTGVACLAPNLPNHGKQAIRVVLGVTAGVIVAELSLFLPQTVSVLHTGMVAFIAMV
                     LATTFGTAPAIPIQAGVSAILVLAMGPQEAGLSRLTDVLVGAGVGLLFSQILLTPDPV
                     RVIDRAVRGLLEPIASGLKKSAAVLKDDNPEEANTTITQFIEAHRALVALSDGLALVR
                     SDARWSLRGRLVASEITDMASRYERRGIRLYAAALLFGEALGNALRKKETEPPAWLME
                     SLQIVIANCSMEPGREPHRIPPIPKDLPFGWRECVLRLEGVQDTLLHFLNSDQPDSVL
                     VPKCEAKPQADAV"
     CDS             76341..77525
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10072"
                     /product="transporter MFS superfamily"
                     /db_xref="GOA:A0A1M4L901"
                     /db_xref="InterPro:IPR010645"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="InterPro:IPR036259"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L901"
                     /protein_id="SBW13268.1"
                     /translation="MNQPFRTPPQHRVALRYAFGGFLAMAAAMGVGRFIYTPILPGMM
                     VDIGFSTADAGFIASANYIGYLVGAVVAGYGWSAGIERMVVIAGLAASAVFCFAMALF
                     EGVWILSILRFAAGFASAVTMILCTAIVLSHITRAQRAGLGAMHFGGVGSGITLSALL
                     VALIRFSGLGWRADWIGAGLLTLVIMAVVAAFVKEGPVGGNNGMREPPLPNSFAFHAL
                     AFAYGIFGFGYVITATFLIAIVRANGGGPVMEAAVWVVTGLAAAPSIWLWAPAGRKFG
                     LFSAFALTAILEAVGVAASVVMAPPLGALVGGALLGVTFMALTAFGLQAARILAPASP
                     KRALARMTVCFSIGQIIGPLVAGFMAQHSGSFTSASLAAALSLIVAAAIGFSAGRAAR
                     LH"
     CDS             77747..78994
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10073"
                     /product="transporter"
                     /db_xref="GOA:A0A1M4L936"
                     /db_xref="InterPro:IPR009248"
                     /db_xref="InterPro:IPR036640"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L936"
                     /protein_id="SBW13269.1"
                     /translation="MFASFFPRPKLFFISALLWTLLAVLGWYMGGENLGSVFGLAPAA
                     GDAAPLIGAHVFWSRPFLWFYIYFAVITFAFYGFWVRFSPHPWQRWSILGSALILFAT
                     YFNVQVSVAINTWYGPFYDMVQKGLTTPGAVSAAEFYWGLADFAGIAFLAITIGVLNL
                     FFVSHYIFRWRTAMNDYYMSHWPKLRHIEGAAQRVQEDTMRFSTTLEQLGVSLVKSVM
                     TLIAFLPVLFTFSQKVSTLPIIGYVPHALVWAAVIWALFGTGFLALVGIKLPGLEFNN
                     QRVEAAYRKELVYGEDHADRAEPITMRELFKNVRHNYFRLYFHYVYFNVARIFYLQVD
                     NIFPLIILIPSIVAGKLTLGLMSQITNVFDQVRGSFQYLVNSWTTIIELLSIYKRLRA
                     FEAAIHGEPLQAVDRINLEPGAG"
     CDS             complement(79033..80031)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10074"
                     /product="hypothetical protein"
                     /db_xref="GOA:A0A1M4L991"
                     /db_xref="InterPro:IPR002509"
                     /db_xref="InterPro:IPR011330"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L991"
                     /protein_id="SBW13270.1"
                     /translation="MRFPLPRLVAFCAFAVTSLAGQALAGEPPKTQYVLISFDGAHDN
                     TLWTRSRELARKNNAHFTYFLSCVFLMTKQDRTGYKPPHKKAGASNVGFALSRDEVAT
                     RLDNIWQAHLEGNEIASHGCGHFDGTKWSTADWKKEIGEFRRIVADAYRNNGIGGEPE
                     GWRALALTGINGFRAPYLAAGKPVQDVLKATGFRYQASSVTRGPELPQLTDRLASFGL
                     PLVPEGPSQRPVVAMDYNLYVRHSKAVEAPQKAAEFEARAYKAFRAAFDKQYAGGRIP
                     LQLGFHFVLMNDGAYWRALERLVSEVCTKPDVKCTTYGAYLDQLQNTGSNTAHNRS"
     CDS             80279..80950
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10075"
                     /product="hypothetical protein"
                     /db_xref="GOA:A0A1M4L923"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR018704"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L923"
                     /protein_id="SBW13271.1"
                     /translation="MADDSFIREVNEELRSERAKQVWRNFGPALIGAAVAVVLGTVGW
                     VGYQHWTDSKASASGDKFLAALDLAAAGKTDEALAAFTDLEKTGYGSYPVLARLRAAS
                     VLADKGDAAAAVKAFDEISADNSVPEPLRNIARLRAGYLLVDNGSYDDVAKRVEPLSA
                     DGNPMRTSAREALGLAAWKAERFDDAAKLFKLVAEDSLAPANARQRANIMLDLMHSAG
                     VAAQG"
     CDS             80972..82423
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10076"
                     /product="tRNA modification GTPase TrmE"
                     /db_xref="GOA:A0A1M4L948"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR015946"
                     /db_xref="InterPro:IPR016484"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR031166"
                     /db_xref="InterPro:IPR032859"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L948"
                     /protein_id="SBW13272.1"
                     /translation="MGFTLAIVGRPNVGKSTLFNRLVGRKLALVDDLPGVTRDRRIHD
                     AKLYDLKFQVIDTAGLEEAANDSLEARMRAQTEAAISEADAVLFVIDAKAGITPADST
                     FAEAVRRSGKPVVLVANKAEARGSEAGMYDAFQLGLGEPCPISAEHGQGMPDLRDAIV
                     ELLGEERVFAEERQEEAADEVFTPAAVGALVGDDIEDPDAEEIPAYDATKPLRIAIVG
                     RPNAGKSTLINTMLGEDRLLTGPEAGITRDSISADWEWHGRKIKLFDTAGMRRKARVQ
                     EKLEKLSVADGLRAIRFAEVVIIVLDATIPFEKQDLQIADLIIREGRAPVIAFNKWDL
                     IEDRQMVLADLYEKTARLLPQVRGLRAVPISGERGQGIDKLMENVVKTHEIWNRRIST
                     GRLNRWLEGVIAHQPPPAVSGRRLKVKYMTQVKTRPPGFVVSCSRPDAMPQSYVRYLI
                     NGLRETFDMPGVPIRLSLRTSDNPFAGRAKKKK"
     CDS             82582..83898
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10077"
                     /product="heat shock protein, Hsp70 family"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L965"
                     /protein_id="SBW13273.1"
                     /translation="MTPSDQGVEQSGVTLGIDFGTTNTVLSVAAPDGTTAVLSVPKDG
                     VEITGYRSILCFWQDRETGERTAESGPWAMDAFVNAPHSTRMLQSFKTFAASKSFKDT
                     PVFGRRFKFEDILQTFLETVAAKLGDRLPPKGNRVVIGRPVIFAGNAPDEALAMLRYE
                     KAFRAFGFTDIHYVYEPVAAAYFYAQQLTADSNVLVADFGGGTSDFSIVRFEVGKEGL
                     RFTPLSQTGLGIAGDTFDYRIIDNAVSPLLGKGTEYESFGKRLTVPNHYYANFARWNT
                     LFLMNSPATIRELDELARQAVDPKPLESFIHLIENDYGYEIYRAVSELKVRLSSQHIA
                     ELHFKADDFEIRSDITRNDFENWIDSDVCQIERSVQQAVEKAGLAPSAIDRVFLTGGT
                     SFVPVIRTVFESRFPDAMVTSSNQFDSIANGLALIGQSGDIDRWSV"
     CDS             84392..85681
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10078"
                     /product="cell wall hydrolase"
                     /db_xref="GOA:A0A1M4L9A1"
                     /db_xref="InterPro:IPR011105"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9A1"
                     /protein_id="SBW13274.1"
                     /translation="MRLVSLRALFGRSCAAAEPVWHYPVTGYCPEDGRYYGVRAKPRQ
                     IPHKQHWLVPFVLAASAYLFNSNAIAFQDMASLVPAADLGTHRWTAFIARAPVGSVHQ
                     AEMPFVDATTVTGSIATNGIEVPGIGHVALSGGRKTAKLGVDDPNPDENRINRADKTN
                     RLVSVKPKAPAKAFTAGSMFEKISLISRPPEKIDTRMAFTRKLEGKEVGITMAFHRVK
                     PPKPKAELPTQLAKLINNEQPDVLALGYAPSTPDYGKTSPFESILRPDQSEGRFVPPI
                     GDQDHDWAATPLPPSAFSPREQKCLAEAVYYEARGESVKGQVAVAQVVLNRVRNPAYP
                     GSICGVVYQNRDWLNACQFSFACDGQKHRVTEPAQWRMAQQVAKTVSAGQIWLPEVGS
                     ATHYHATYVRPFWAPTMKKLTKIGLHIFYRTYGGGWS"
     CDS             85952..86350
                     /codon_start=1
                     /transl_table=11
                     /gene="atpI"
                     /locus_tag="BR10RB9215_C10079"
                     /product="ATP synthase protein I"
                     /db_xref="GOA:A0A1M4L8Z6"
                     /db_xref="InterPro:IPR016989"
                     /db_xref="InterPro:IPR032820"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L8Z6"
                     /protein_id="SBW13275.1"
                     /translation="MARGAEPEKPSGTIKDAKREPGSGELDQRLNRLEAELAKKGVLK
                     QPASEEERSETSSSVAQAMKLSSEFIAGILVGALIGWFLDRYAGTSPWGLIVFLLLGF
                     GAGTLNVLRSAGYVAEQGNNKSSAEKDDRK"
     CDS             86458..87207
                     /codon_start=1
                     /transl_table=11
                     /gene="atpB"
                     /locus_tag="BR10RB9215_C10080"
                     /product="F0F1 ATP synthase subunit A"
                     /EC_number="3.6.3.14"
                     /db_xref="GOA:A0A1M4L934"
                     /db_xref="InterPro:IPR000568"
                     /db_xref="InterPro:IPR023011"
                     /db_xref="InterPro:IPR035908"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L934"
                     /protein_id="SBW13276.1"
                     /translation="MANDPIHQFQVSRWIPIDVGGVDLSFTNVSAFMVATVVLASGFL
                     YLTSSGRGLIPTRLQSVSEMAYEFVATSLRDSAGSKGMKFFPFVFSLFMFVLVANFLG
                     LFPYFYTVTSQIIVTFALSLLVIGTVIFYGFFKHGFGFLKLFVPSGVPGIIVPLVVLI
                     EIISFLSRPISLSVRLFANMLAGHITLKVFAGFVVSLSSLGALGIGGAVLPLLMTVAI
                     TALEFLVAFLQAYVFTVLTCMYINDAVHPGH"
     CDS             87275..87502
                     /codon_start=1
                     /transl_table=11
                     /gene="atpE"
                     /locus_tag="BR10RB9215_C10081"
                     /product="F0F1 ATP synthase subunit C"
                     /EC_number="3.6.3.14"
                     /db_xref="GOA:A0A1M4L929"
                     /db_xref="InterPro:IPR000454"
                     /db_xref="InterPro:IPR002379"
                     /db_xref="InterPro:IPR035921"
                     /db_xref="InterPro:IPR038662"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L929"
                     /protein_id="SBW13277.1"
                     /translation="MEAEAAKYIGAGLACFGMAGTALGLGNIFGQYLSGALRNPSAAD
                     SQFGRLVFGFAVTEALGIFSLLIALLLLFAV"
     CDS             87674..88300
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10082"
                     /product="F0F1 ATP synthase subunit B'"
                     /db_xref="GOA:A0A1M4L911"
                     /db_xref="InterPro:IPR002146"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L911"
                     /protein_id="SBW13278.1"
                     /translation="MFVSTAFAQTATESQPASTAGEHGAADAVHTETGVAHDAGHGSG
                     VFPPFDSTHYASQVLWLAITFGLFYLFLSRVVLPRIGGVIETRRDRIAQDLEQAARLK
                     QDADNAIAAYEQELAQARSKAASIAEAAREKGKGEADAERASAEAVLESKLKEAEERI
                     AAIKAKAMSDVGNIAEETTATIVEQLLGLKADKASVSEAVKAIRASNA"
     CDS             88311..88790
                     /codon_start=1
                     /transl_table=11
                     /gene="atpF"
                     /locus_tag="BR10RB9215_C10083"
                     /product="F0F1 ATP synthase subunit B"
                     /EC_number="3.6.3.14"
                     /db_xref="GOA:A0A1M4L945"
                     /db_xref="InterPro:IPR002146"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L945"
                     /protein_id="SBW13279.1"
                     /translation="MDATFWAFIALVIFVAIVVYMKVPGMIGRTLDERADRIKKELEE
                     ARTLREEAQQLLAEYHRKRKEAEKEAGDIVASAEREAKALLEEAKRATEEYVARRNKL
                     AEQKIATAETDAINAVRASAVDLAVAAAGSILAEKVDAKAAGNLFNDALAQVKSHLN"
     CDS             complement(88912..89574)
                     /codon_start=1
                     /transl_table=11
                     /gene="rnhB"
                     /locus_tag="BR10RB9215_C10084"
                     /product="ribonuclease HII"
                     /EC_number="3.1.26.4"
                     /db_xref="GOA:A0A1M4L998"
                     /db_xref="InterPro:IPR001352"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR022898"
                     /db_xref="InterPro:IPR024567"
                     /db_xref="InterPro:IPR036397"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L998"
                     /protein_id="SBW13280.1"
                     /translation="MKRSTSDSPLLFDLPLAPDFSQEQQLMKRGLKHITGIDEAGRGP
                     LAGPVVAAAVVLDQNDIPEGLDDSKRLTAARREALYEIILTKAIAVSVASLSARSIDA
                     SDIRKAALEAMRRAVIGLTLKPCHALIDGRDVPPGLPCPGSALVKGDQRSASIAAASI
                     VAKVTRDRMMIRAGAAHPPYGLEIHAGYGTQKHRAAIESEGPVPGLHRYTFAPIKGRF
                     DC"
     CDS             complement(89751..90923)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10085"
                     /product="hypothetical protein"
                     /db_xref="GOA:A0A1M4L931"
                     /db_xref="InterPro:IPR006638"
                     /db_xref="InterPro:IPR007197"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L931"
                     /protein_id="SBW13281.1"
                     /translation="MAVIHQAEIIGQADRLAFGAGRAEHANAVIGEAGLRIDHARRRG
                     RGAGINPSGRFEPTMRQEFDDGWATLEELPAFKTDVQIEKPRTIITRNDSPDISFDRS
                     INPYRGCEHGCIYCFARPTHSYMGLSAGLDFETRLFAKPDAPRLLERELAKPGYQPKT
                     IAIGTNTDPYQPVEKKWRIMREILEVLEAANHPVGIVTKSALVVRDIDILSRMAEKGL
                     AKVALSVTTLDAHLARTMEPRASTPSLRLQTIRRLTDAGIPASVMMGPVIPGINDHEI
                     ERILDAAYAQGAREAGYVLLRLPLEVAPLFKDWLLRNYPDRYRHVMSLVRSMRDGKDY
                     DAEWGKRMRGTGPYAWQIGRRFEIAARKLGFNTQRLRLRTDLFEPIQKGGKQLSLF"
     CDS             91059..91565
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10086"
                     /product="hypothetical protein"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L957"
                     /protein_id="SBW13282.1"
                     /translation="MLSVIIETLNSERPLACTLSGLVPAVVEGLLRRVTVIDHGSCDD
                     TALVAEGAGCAFHGLAERDVALNGIRTDWVLFLKPGAMPQEGWGEAVRRHMESGGGPA
                     RFSLPEEGRLGNIRKIFGGGPSLDAGLLVRLDLVQPLFLEGIGSDDLPGRLKPLRLKH
                     RILPPERH"
     CDS             complement(91645..91881)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10087"
                     /product="hypothetical protein"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L975"
                     /protein_id="SBW13283.1"
                     /translation="MKKFALAALAVALSAGAAYAENPYVGQPANMAAQDKAFMQGGST
                     PVRGNTDYTAPASIKAPVYQDGSAHRFGDASPSN"
     CDS             complement(92061..92288)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10088"
                     /product="hypothetical protein"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9A8"
                     /protein_id="SBW13284.1"
                     /translation="MKKFVLAAAALALSAGAALAENPHVGEPANLYANDRTPVATQKL
                     DYTAPASIKAPVYQDGSAHRFGDASPSSYQN"
     CDS             complement(92695..93594)
                     /codon_start=1
                     /transl_table=11
                     /gene="ispE"
                     /locus_tag="BR10RB9215_C10089"
                     /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
                     kinase"
                     /EC_number="2.7.1.148"
                     /db_xref="GOA:A0A1M4L906"
                     /db_xref="InterPro:IPR004424"
                     /db_xref="InterPro:IPR006204"
                     /db_xref="InterPro:IPR013750"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR036554"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L906"
                     /protein_id="SBW13285.1"
                     /translation="MTAFQNAGPSITRLAPAKINLALHVTGRRDDGYHLLDMLVVFAD
                     HGDRIHIEKADSDSFTVSGPFASGIPAGRGNLVLKARDALRQHGGPELSPVAIHLEKN
                     LPIASGIGGGSSDAAATLLALNTLWQLDLDFGMLAAIGLSLGADLPMCLHGAAHGTPL
                     IARGIGEELNDVSGIAALPMLLVNDGTALATPDVFRALTRRENAPLPLPACEGTDALC
                     AYLRETRNDLLPAAISLAPQIEPKLALLRAKGALYAQMSGSGATCFAIFSDESALTRA
                     AKEIADENPGWFAVPAYSFPSRA"
     CDS             complement(93624..93809)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10090"
                     /product="hypothetical protein"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L944"
                     /protein_id="SBW13286.1"
                     /translation="MPQLIFLLLIIAAAWYGYRSFKREAARVLQRVRQAEKEAQNRAH
                     GTLVQDPKTGEYYVRKD"
     CDS             complement(94275..95147)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10091"
                     /product="signal peptide peptidase SppA"
                     /db_xref="GOA:A0A1M4L937"
                     /db_xref="InterPro:IPR002142"
                     /db_xref="InterPro:IPR029045"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L937"
                     /protein_id="SBW13287.1"
                     /translation="MPGLLKRLIPRRFRAVETEIPVVRLHGAIMTGGTSLRPTLSLAS
                     TAGILEKAFADKHAPAVAISINSPGGAPVQSRLIYRRIRDLAVEHQKKVFVFVEDVAA
                     SGGYMIALAGDEIIADPSSIVGSIGVVSASFGFPELLKKIGVERRVYTAGSNKVTLDP
                     FQPEKAEDIERLKALQLEIHATFIDMVKERRAGKLGDNPDLFSGLFWTGTTAASLGLI
                     DGLGDMRSFLRKTYGDKVKLKLIQPQRGLLGRKLPGIGMNSGSVEPAQIAAHLGDGLL
                     CVAEEKAIWARYGL"
     CDS             complement(95302..96483)
                     /codon_start=1
                     /transl_table=11
                     /gene="nhaA"
                     /locus_tag="BR10RB9215_C10092"
                     /product="pH-dependent sodium/proton antiporter"
                     /db_xref="GOA:A0A1M4L922"
                     /db_xref="InterPro:IPR004670"
                     /db_xref="InterPro:IPR023171"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L922"
                     /protein_id="SBW13288.1"
                     /translation="MNHSPQSARPVSIMRRFLDSEAAGGITLMAAAALALIVANSPFA
                     QTYFDALHLYIGPLSLAHWINDALMAIFFLLVGLEIKREMLDGQLASWPNRMLPGIAA
                     AGGVILPAIIFAVLNHDNPAKLRGWAVPSATDIAFALGVLSLLGSRAPSSLKVFLATL
                     AILDDLAAVVIIAIFYTAEISMPYLGAAFITAAVLFVMNRMGVVKLLPYLIGAVILWF
                     FVFNSGVHATVAGVVAALMIPLKPAPGRPDDMTSPLHKLEHALAKPVAFIVVPIFGFA
                     NAGISFKGLEVSVLGDTLTLGILLGLFLGKQFGVFGAAWLAIKTGLAEKPMGASWVQL
                     YGVAILCGIGFTMSIFIGLLSFPSDLMQTETKIGVLSGSALSAICGYLLLRAAARPKR
                     S"
     CDS             complement(96952..97554)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10093"
                     /product="hypothetical protein"
                     /db_xref="GOA:A0A1M4L955"
                     /db_xref="InterPro:IPR002052"
                     /db_xref="InterPro:IPR007848"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L955"
                     /protein_id="SBW13289.1"
                     /translation="MTAPAEDKVEETLDVFHRGAFHLVQPALKGHRSGVDAMILASAV
                     PGGFAGRAADLGSGAGAAGLAVAARCPKARVTLVERSGLMAGFARKTIAHPLNAALAG
                     RIDILEADVALKGKARVLAGLADNSFDFAIMNPPFNEPRDRTTPDPLKAEAHVMPEGM
                     FEQWVRTAAAIVKPGGGIAIIARPGSIRPILDALGGGSAG"
     CDS             complement(97551..97778)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10094"
                     /product="hypothetical protein"
                     /db_xref="GOA:A0A1M4L9A6"
                     /db_xref="InterPro:IPR011322"
                     /db_xref="InterPro:IPR018551"
                     /db_xref="InterPro:IPR036675"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9A6"
                     /protein_id="SBW13290.1"
                     /translation="MIELIRTNDSVLLSFAEALMKEAGIAYFIADTNMSIIEGSLGVL
                     PRRLMVDEDQMEEARQILIDAKIEHELRDNK"
     CDS             98047..99063
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10095"
                     /product="polyprenyl synthetase family protein"
                     /db_xref="GOA:A0A1M4L941"
                     /db_xref="InterPro:IPR000092"
                     /db_xref="InterPro:IPR008949"
                     /db_xref="InterPro:IPR033749"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L941"
                     /protein_id="SBW13291.1"
                     /translation="MGVVLNLDGKMKQEGSVQPLVDLTRADMARVNELILSRAGSDVE
                     MIPEVANHLISSGGKRLRPMMTLASARMFGYEGDGHVRLATSVEFMHTATLLHDDVVD
                     ESDLRRGKSTARTIWGNQASVLVGDFLLGQAFKMMVDVGSLDALDVLATSASIIAEGE
                     VMQLAAAKNMETTEDEYLAVIKAKTAALFSAAAEVGPIIAGAQRSDRAALRDYGLNLG
                     LAFQLVDDALDYGGSAADLGKNTGDDFREGKITLPVILSYRRGTDEERAFWKGAIEGG
                     ASDDASLQKAIGLMMKHGAIADTVQRARHFGEIARDALAPLKASPQKDALIEVVDFCI
                     SRVN"
     CDS             99367..101232
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10096"
                     /product="hypothetical protein"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L973"
                     /protein_id="SBW13292.1"
                     /translation="MRLGSKHRPLYGLLLSLLAGIAIPTSGALAKTTPDPVRAQVRAG
                     SFAGAYLAGRTAESDDNLSAAVDFYRQAMAFDPNNSQIKQDLMLVLLTEGRFKDALPL
                     AHELQNVTAIERFSRLALAIDAINRQQYRKVGPLLMFSLQSDMDRLLINLMNAWVKVG
                     QGNPKEALADVQKMDGPEWYDLFRTYNAALIADLAGRKQEARNYYQQAIDDRRGGSAA
                     PDTYERVVMAFAAFKLRQGDRAGAIKTLKDAEELLNGRMTITEMREKIEAGHKYGRLV
                     KTAQDGAAETLYTLGTAINRSGAEAFAKLYLQMSLPLRPDNDATLYQLGDISAKLHEP
                     QKAVEYYGRVPEQSPYRRDAEMQRALNLAENDQSAEAIKQLKVLLGRDKSDMRTYLAL
                     GGVYAQDKNFADAAKIYDAAVEQIKTPTRKDWPLFYQRGIAYERLQEWDKAEPNFRKA
                     LELYPDQPQVLNYLGYSWVDRNENLDEALNMIRKAVELRPQDGYIVDSLGWAYYQLGR
                     YDQAVVELEKAVKLRPEDPTINDHMGDAYWRVGRLLEATFQWNHAIAGKPEPEELAKI
                     KEKLKKGLPDIPGQSAADATKPAEKKPDEAKPEAPAPSATSAAPSDKAPEKPTTD"
     CDS             101360..102310
                     /codon_start=1
                     /transl_table=11
                     /gene="glyQ"
                     /locus_tag="BR10RB9215_C10097"
                     /product="glycyl-tRNA synthetase subunit alpha"
                     /EC_number="6.1.1.14"
                     /db_xref="GOA:A0A1M4L985"
                     /db_xref="InterPro:IPR002310"
                     /db_xref="InterPro:IPR006194"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L985"
                     /protein_id="SBW13293.1"
                     /translation="MSSTLPAHMHPTRSFQGLILTLHNYWAEHGCAILQPYDMEVGAG
                     TFHPATTLRSLGPKPWKAAYVQPSRRPKDGRYGENPNRLQHYYQYQVLIKPSPPNLQD
                     LYLGSLKAIGLDPTLHDVRFVEDDWESPTLGAWGLGWECWCDGMEVSQFTYFQQVCGI
                     ECSPVAGELTYGLERLAMYVQGVDNVYDLNFNGLEGDEKVTYGDVFLQAEQEYSRYNF
                     EMANTETLHQHFIDAERECEAILKAGSTGENSLHKCVFPAYDQCIKASHVFNLMDARG
                     VISVTERQSYILRVRNLARQCGEAFLLTDAGGFNYKNEAV"
     CDS             102310..102423
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10098"
                     /product="hypothetical protein"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9B7"
                     /protein_id="SBW13294.1"
                     /translation="MPDLLLELFSEEIPALPSARSEARTDKLNNVHAEGVR"
     CDS             102423..104756
                     /codon_start=1
                     /transl_table=11
                     /gene="glyS"
                     /locus_tag="BR10RB9215_C10099"
                     /product="glycyl-tRNA synthetase subunit beta"
                     /EC_number="6.1.1.14"
                     /db_xref="GOA:A0A1M4L918"
                     /db_xref="InterPro:IPR006194"
                     /db_xref="InterPro:IPR008909"
                     /db_xref="InterPro:IPR015944"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L918"
                     /protein_id="SBW13295.1"
                     /translation="MPDLLLELFSEEIPARMQRKAAGDLKKMITDGLVDAGLTYEAAT
                     AYWTPRRLALDIRGLTVRSKDVHEDIKGPSVSAPEQAIQGFLRKAGLSDVSQAHVHSD
                     PKKGDFYVAHLTKPGRAAEDIVAELVPQTIRNFPWPKSMRWGVASARPGALRWVRPLQ
                     SILCTFGPETEETKVIDFDVDGIKSGNVTYGHRFLSDGQAIKVRRFEDYVEKLEKAFV
                     VLDAERRKEIISQDAHNLAFASGLELVEDDGLLEEVSGLVEWPVVLMGEFEEEFLAIP
                     PEVIRLTIRANQKCFVTRKQGDASRLASPAPQHEEIQALSNKFILVSNVAARDGGTEI
                     AYGNGKVVRARLSDALYFWHTDQHDLPDLDKLAASAEKFGLDLKKPLDQRMARLDALN
                     VTFHAKLGTQGQRVERIRELAAQIAPLVGADPKLAQRAAVLAKADLQTEVVGEFPELQ
                     GAMGRKYALLQGEDEAVAAALEEHYKPQGPSDVVPKNPVSVAVALADKLDTLVGFWAI
                     DEKPTGSKDPYALRRAALGVIRLLLSQEWKFPLLPLFRSAFAALQEGQMQRKLREFEA
                     KLATENSGDVDGEQDVDNALANYEKEIHAEAEASCGPVLADLLSFFHDRFKVHLKEEG
                     ARYDAIDAVLTPEADNLLLVARRLEALIVFINEEDGKNLLAGAKRAANILAAEEKKGT
                     KVADRVDPALLREAEEKALFDAVTLASREVGEAIAREDFNGAMLALAKLRGPVDIFFD
                     KVLVNDEDVNVRANRLALLDQIRAATGKVADFSKIAG"
     CDS             104895..105866
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10100"
                     /product="Sua5/YciO/YrdC family protein"
                     /db_xref="GOA:A0A1M4L953"
                     /db_xref="InterPro:IPR005145"
                     /db_xref="InterPro:IPR006070"
                     /db_xref="InterPro:IPR010923"
                     /db_xref="InterPro:IPR017945"
                     /db_xref="InterPro:IPR038385"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L953"
                     /protein_id="SBW13296.1"
                     /translation="MTETLKFDDGAVLRAVEVLRRGGLVAIPTETVYGLAADAANGEG
                     VAGIFAAKGRPQFNPLIAHVDGIAMAGRYVAFDPVSRRLAEAFWPGPLTIVLPLKERQ
                     DTDRPIHPLVTAGLSTLAVRMPHGRVRDVITALDSPVAAPSANTSGRISPTSAAAVAG
                     DLGERIDLILDAGPCGVGVESTIVKVDGDQVHLLRPGGLAAEEIEAFLSQKLRRAEHA
                     AAIQAPGMMESHYAPDASMRLAVSDVKPGEALLAFGPHRVAESNRAAAVLNLSATGDL
                     REAAANLFDFMRRLDATGTATIAVEPIPLDGLGEAINDRLKRAAAPR"
     CDS             105892..107304
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10101"
                     /product="ATPase"
                     /db_xref="GOA:A0A1M4L946"
                     /db_xref="InterPro:IPR004113"
                     /db_xref="InterPro:IPR006094"
                     /db_xref="InterPro:IPR016164"
                     /db_xref="InterPro:IPR016166"
                     /db_xref="InterPro:IPR016167"
                     /db_xref="InterPro:IPR016171"
                     /db_xref="InterPro:IPR036318"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L946"
                     /protein_id="SBW13297.1"
                     /translation="MPDTALIERFAAIVGEKNALTAPEDIAAYLIEQRDLYHGRTPLV
                     LRPGSTEEVAAIMKLATETRTPVVPQGGNTGLVGGQQPDESGAAIILSLGRMNRIRNL
                     DTVGNLVTLEAGVILKNLQDAAEKAGRLFPLSLGAEGSCQIGGNLGSNAGGTAVLAYG
                     NMRELCLGLEVVLPTGEILNDLRYVKKDNTGYDLKDIFVGSEGTLGVITAAVLKIFPQ
                     PKGKGVAYAGLRSPEDVLRLFQLATEHAGPSLTGFELMPRVGVEFTVRHVDGVRDPLE
                     SPHDWYVLIDISSSRSEEDARTTLETILTEAFENDLIQDAAIAESVAQAQSFWKMREE
                     MSWAQKPEGGSIKHDISVPVASIPAFIHEADAATLDMIPGARVVCFGHIGDGNLHYNV
                     SQPVGADKEAFLARWHDLNHRIHTIVASYGGSISAEHGIGQLKREELAFFKQDIALDL
                     MRRIKSALDPAGIMNPGKVL"
     CDS             complement(107342..107659)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10102"
                     /product="hypothetical protein"
                     /db_xref="InterPro:IPR007712"
                     /db_xref="InterPro:IPR035093"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L932"
                     /protein_id="SBW13298.1"
                     /translation="MKVIVSPAARDYIKSEIAYLKLRSPSAAVQLSEDLKRLKRDLGR
                     FSQMGHFTEELPVPGIRRFVMGAYLIDYEIRADAILIFAIRHGRERPPILPPDEDFDF
                     EQS"
     CDS             complement(107656..107883)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10103"
                     /product="hypothetical protein"
                     /db_xref="GOA:A0A1M4L969"
                     /db_xref="InterPro:IPR002145"
                     /db_xref="InterPro:IPR010985"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L969"
                     /protein_id="SBW13299.1"
                     /translation="MRIPRDILAEIEEIASLTERSRSWVIVRAMKAYLAAEGREIRDI
                     AKARCAIENGEGFDLDTVIEEAEAIIKGAAA"
     CDS             108227..108793
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10104"
                     /product="hypothetical protein"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9B9"
                     /protein_id="SBW13300.1"
                     /translation="MMSKGLKPDWAGRELRLDPFHFPQVVTYASHDGSTDVTFTINER
                     GAVIRQVLPSSGLPMSIALPACAFVGVAARAVEDEFGEITVTLELMHEDPLLSVPLLV
                     AHDLGDIAADWRAWSAAFNLPMMLVEEDGVARPLYESTGPVRTGQPQARRQGQEPRRR
                     RPRFLARRKTGTLGVRLVISGKEIIARH"
     CDS             complement(108936..109688)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10105"
                     /product="enoyl-CoA hydratase"
                     /db_xref="GOA:A0A1M4L947"
                     /db_xref="InterPro:IPR001753"
                     /db_xref="InterPro:IPR014748"
                     /db_xref="InterPro:IPR029045"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L947"
                     /protein_id="SBW13301.1"
                     /translation="MSEHILIERKGAVQVIRLNRPEKKNAITRAMYAAMAKALKDGDA
                     DDAVRTHVFLGVPGAFSSGNDMQDFMAAATGDTSFGSEILDFLIPLAETKKPIVSGVD
                     GLAIGVGTTIHFHCDLTFATPRALFRTPFVDLGLVPEAGSSLLAPLLMGRQKAFALLA
                     LGHGFTAEAAQEAGIVYQIVDEEALEAEVMKAAEEIAAKPPQAMQIARALMRLPAENI
                     ADRITREAKHFAERLTSDEAHEAVMAFLSRKK"
     CDS             complement(109691..111469)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10106"
                     /product="acyl-CoA dehydrogenase"
                     /db_xref="GOA:A0A1M4L976"
                     /db_xref="InterPro:IPR006091"
                     /db_xref="InterPro:IPR009075"
                     /db_xref="InterPro:IPR009100"
                     /db_xref="InterPro:IPR013786"
                     /db_xref="InterPro:IPR025878"
                     /db_xref="InterPro:IPR036250"
                     /db_xref="InterPro:IPR037069"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L976"
                     /protein_id="SBW13302.1"
                     /translation="MYRAPVSEISHTLMKVAGLEKALEENRFPEFSADLAAAILEEAG
                     KFAADRIEPLRITGDKNGATVKDGVVTTAPGWKELYRDWIAGGWNSLTGTPEYGGQGL
                     PTMMSVAVSEMWNSGTLAFAIAPTLTMGAVEALEKHASRELKDIYLEKLISGEWMGTM
                     NLTEPQAGSDLGALRTRAERRDDGTYRIFGQKIFITYGEHDLTDNIVHLVLARLPDAP
                     AGTKGISLFLVPKFLVNEDGSLGRRNDLFCSGLEHKMGIHASPTCTMIYGDGFVKGEE
                     QGAVGYLIGEENRGLACMFTMMNNARLLVGIQGVGVAEAAYQQALAYAKERKQGRALG
                     AYPKQGMSPIIEHPDVQRMLLTMKALTQAARSITYACAHAIDMSHVTDGADAQFWSDR
                     AGLLTPLAKSFATDAGVDVSSLGIQIHGGMGFIEETGAAQLLRDARITPVYEGTNGIQ
                     AIDLVMRKLPLQNGDHIKGFLAELQDDADKATASNRAELGETGARLSKAISEAREATD
                     WLQKATAEGRAEEALSGATPYQRLLSLTAGGAYLARAALAGDDAARAALCRFFAENML
                     AEVSSLKDTVITGAASLTAAKSALEA"
     CDS             111786..112931
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10107"
                     /product="response regulator PleD"
                     /db_xref="GOA:A0A1M4L995"
                     /db_xref="InterPro:IPR000160"
                     /db_xref="InterPro:IPR029787"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L995"
                     /protein_id="SBW13303.1"
                     /translation="MTLVPFFLTVNLTVASLFVLTFAFVSMQERGHRAPRWFTLAFLC
                     SMAMPLFGFGLPTTENPRIIILGSFAAIMAALTLLVIGLCETYRQRIEWRLLGFLFIA
                     ALACNALVFELPRTSLLHRFLYQLPLCLIELVTIRVIYRSGMPRLVDKLLMALAVLSV
                     VHFFSKAFLIVWPGMDARPEDQSDKGPAIFSLSMGVFVQVSTGLLLLLRTMLRMLGDA
                     SEQSEIDALSQIYNRRGFDRHVMRRLMRKGPDTPYAIIMSDLDYFKRVNDTYGHDCGD
                     RVIEAFGGLLRTHLPKPAVAARMGGEEFVVFMPGADAVAAHDLAQTLRTTMTALSFSG
                     DAAEWMPTASFGVAEHRVGEGLYDTIRRADGALYEAKKAGRNRVHVT"
     CDS             complement(112944..114227)
                     /codon_start=1
                     /transl_table=11
                     /gene="purD"
                     /locus_tag="BR10RB9215_C10108"
                     /product="phosphoribosylamine-glycine ligase"
                     /EC_number="6.3.4.13"
                     /db_xref="GOA:A0A1M4L9D1"
                     /db_xref="InterPro:IPR000115"
                     /db_xref="InterPro:IPR011054"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR013815"
                     /db_xref="InterPro:IPR016185"
                     /db_xref="InterPro:IPR020559"
                     /db_xref="InterPro:IPR020560"
                     /db_xref="InterPro:IPR020561"
                     /db_xref="InterPro:IPR020562"
                     /db_xref="InterPro:IPR037123"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9D1"
                     /protein_id="SBW13304.1"
                     /translation="MKVLLIGSGGREHALAWKLAASPLLEKLYCAPGNPGIAAVAELA
                     DIGVDDHAALIAFAKEKHIDLVVVGPEAPLVAGLADEMRAEGIRVFGPSRAAAQLEGS
                     KGFTKDLCARFNIPTGAYGRFNNAPKAKAYIRQQGAPIVVKADGLAAGKGVVVAMTLQ
                     EALDAVDSCFEGAFGAAGAEVVVEEFLDGEEASFFCICDGKTALPLGSAQDHKRVGDG
                     DTGPNTGGMGAYAPAPVMTPEMVARTMRELIEPTMHGMAEIGAPFSGILFAGLMITSD
                     GPKLIEYNTRFGDPECQVLMMRLDSDLLALINAAVDGRLDEVSLEWKDEPALTVVMAA
                     EGYPANVKKGSVIRDLEKLESIDGVKLFHAGTALKDGAIVASGGRVLNITATAATVAQ
                     AQARAYEALKLIDWPEGFYRSDIGWRAVEREKADR"
     CDS             114370..115371
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10109"
                     /product="protoheme IX farnesyltransferase"
                     /db_xref="GOA:A0A1M4L927"
                     /db_xref="InterPro:IPR000537"
                     /db_xref="InterPro:IPR006370"
                     /db_xref="InterPro:IPR030470"
                     /db_xref="InterPro:IPR031103"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L927"
                     /protein_id="SBW13305.1"
                     /translation="MQHPQANSDIQSRAARGRVKDAPSGHWVYRILPQWLWPYAQLAR
                     WDRPIGWQLLLWPCWWSTALVAGAGAKAGDGAWSVLPSFWHLFLFLVGAIAMRGAGCT
                     YNDLVDQEIDDKVDRTRSRPLPSGQVTRKQAKLFVVLQALVGLAVVLQFNWFSVGLGI
                     FSLLIVAAYPFMKRITDWPQFVLGLAFSWGALMGWAATEGSLSLPPVLLYIGAILWTI
                     GYDTIYAHQDKEDDALVGVRSTARLFGKHTKTALMVLYGGAIGFFAAAFAVAQVPMPA
                     LAGLLAAGAHLYRQILVLNIDNPDQCLRLFKSNNIVGWLIFLGLVFGTLWVAVKPLV"
     CDS             complement(115411..116022)
                     /codon_start=1
                     /transl_table=11
                     /gene="pdxH"
                     /locus_tag="BR10RB9215_C10110"
                     /product="pyridoxamine 5'-phosphate oxidase"
                     /EC_number="1.4.3.5"
                     /db_xref="GOA:A0A1M4L964"
                     /db_xref="InterPro:IPR000659"
                     /db_xref="InterPro:IPR011576"
                     /db_xref="InterPro:IPR012349"
                     /db_xref="InterPro:IPR019576"
                     /db_xref="InterPro:IPR019740"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L964"
                     /protein_id="SBW13306.1"
                     /translation="MTNSSDDFTQSAEPFKLFAEWLADAAKSEPNDPNAVALATVDPD
                     GLPNVRMVLLKDFDETGFVFYTNYESKKGQEILSAEKAAMCFHWKSLRRQVRVRGPVE
                     KVSDAEADAYYASRPRGSRIGAWASKQSRPLESRFALEKAVAEYTAKYAIGDIPRPPY
                     WSGFRIRPVSIEFWHDRPFRLHDRVLFTRPTPEGDWNKDRLYP"
     CDS             116410..116766
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10111"
                     /product="hypothetical protein"
                     /db_xref="InterPro:IPR032635"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L959"
                     /protein_id="SBW13307.1"
                     /translation="MGGFSIEKAVPDASAITGSVQQAEPAETDTGKLSDQSAIKNVVS
                     ALNFTQWGKKPVPWANPDTGSQGTITTIAESSTNNKLCRQFETSREAFDGVSIYRGET
                     CMERGGQWTVTAFAPI"
     CDS             116909..117856
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10112"
                     /product="chaperone protein DnaJ"
                     /db_xref="GOA:A0A1M4L943"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR002939"
                     /db_xref="InterPro:IPR008971"
                     /db_xref="InterPro:IPR036869"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L943"
                     /protein_id="SBW13308.1"
                     /translation="MRDPYSVLGVAKTAKPEEIKSAFRKLAKKHHPDQNQDDPKAQER
                     FAEVNQAYEIIGDKDKRAQFDRGEIDAEGKPVFQGFASGQGFGGGGAHGDPFAGFHQG
                     GGNSHFEFRGGPGGFQGGGFGGAEDILNDLFGGAFGGGRSGARQRGPSKGADLSASID
                     ISLSQAVGAEKVEAIFPNGKHLKIKLPKFVEDGQTIRLKGQGEPLMGGTPGDALVTIR
                     FKPHPRFRLEGRDVHVDLPVSIDDAVLGGKQEVETLDGRISVKIPAWSSSDRVLRLKE
                     KGLPLKAGGRGDLYVHVRIMLPEGGDKELEDFLQKRKVV"
     CDS             118000..118818
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10113"
                     /product="glucose 1-dehydrogenase"
                     /db_xref="GOA:A0A1M4L984"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR014358"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L984"
                     /protein_id="SBW13309.1"
                     /translation="MTAQSGLLQGKRGLILGVANNRSIAWGIAKAAREAGAELAFTYQ
                     GDALKKRVEPLAEELGAFVAGHCDVADAASIDAVFETLEKKWGKLDFLVHAIGFSDKD
                     ELTGRYIDTSEANFTNTMLISVYSLTAVSRRAEKLMADGGSILTLTYYGAEKVMPNYN
                     VMGVAKAALEASVKYLAVDLGPQNIRVNAISAGPIKTLAASGIGDFRYILKWNEYNAP
                     LRRTVTIDEVGDVGLYFLSDLSRSVTGEVHHADSGYHVIGMKAVDAPDISVVKD"
     CDS             118933..119523
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10114"
                     /product="phosphoglycerate mutase"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9C8"
                     /protein_id="SBW13310.1"
                     /translation="MAREIIYFSRHGETDWNVSQRIQGQLDIDINDNGRSQADRNGDM
                     LKSLIGAGAGFDFVASPLRRTRETMERIRLRMGLDPYEYRTDPQLMEVNFGDWQGFMM
                     EDIAKEREDLLEARARDKWNFVPPGAAAESYMTLSRRIGRWVEAVEWPTVCVTHGGCM
                     RTLFYLYGNMDGHAAANLSIPQDKLLKFANGKLEWV"
     CDS             119786..119995
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10115"
                     /product="cold-shock family protein"
                     /db_xref="GOA:A0A1M4L961"
                     /db_xref="InterPro:IPR002059"
                     /db_xref="InterPro:IPR011129"
                     /db_xref="InterPro:IPR012156"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR019844"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L961"
                     /protein_id="SBW13311.1"
                     /translation="MANGTVKFFNSTKGFGFIQPDDGSSDVFVHISAVERAGLHSLVE
                     GQKVGYEVVADRRSGKSAAANLESL"
     CDS             complement(119932..120240)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10116"
                     /product="hypothetical protein"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L988"
                     /protein_id="SBW13312.1"
                     /translation="MGTLDFRFRRAMSVIAPGTNIITGLCRLFKIVVFHLILPFMAPL
                     PSSKNKKGRALPRPSHCLNNQCQYIRGQRLETNSFNADYSDSRLAAALLPERRSATTS
                     "
     CDS             120463..120675
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10117"
                     /product="hypothetical protein"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9A5"
                     /protein_id="SBW13313.1"
                     /translation="MYQDKESGFNKVTLFKPNLSRMEAKSAVTDKTAKAILDTERAAV
                     EAKTERLRAARLASEENKPQVASKRK"
     CDS             120752..121432
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10118"
                     /product="hypothetical protein"
                     /db_xref="InterPro:IPR007172"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9E1"
                     /protein_id="SBW13314.1"
                     /translation="MSLKKIVRSPVAIKFITSVGTAYLRFVWWSSRNTAGRNETNPLA
                     QAGPCIVAMWHGQMFLAAFARPPEKKFVAAVSKSRDGELVAQMLGKLGIRAIRGSGAG
                     QRKGNRQGGAAALRQMLYALRNGESIVMAAETNKKVFRCGEGVIALAKLSGCPIYPAS
                     ARTSFTRTLNSWDRAELPMPFGRRSVVIGEPIFVPRDASDEELEQYRLQVEQVINQAY
                     ASAKLACS"
     CDS             complement(121577..121828)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10119"
                     /product="hypothetical protein"
                     /db_xref="InterPro:IPR009780"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L940"
                     /protein_id="SBW13315.1"
                     /translation="MHYLIGLILIIAALFSTVAMAEDAEGKITDINKDSETITLDDGE
                     TYKLPGEFDIGAINPGMKVLIIYDVVDHTRFITDIQEAP"
     CDS             122103..123197
                     /codon_start=1
                     /transl_table=11
                     /gene="aroC"
                     /locus_tag="BR10RB9215_C10120"
                     /product="chorismate synthase"
                     /EC_number="4.2.3.5"
                     /db_xref="GOA:A0A1M4L970"
                     /db_xref="InterPro:IPR000453"
                     /db_xref="InterPro:IPR020541"
                     /db_xref="InterPro:IPR035904"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L970"
                     /protein_id="SBW13316.1"
                     /translation="MSHNSFGHLFRVTTWGESHGLALGCVVDGCPPGITFTEAEIQSF
                     LDKRKPGQSKYTTQRREPDQVRVLSGVLLGEDGVTMTTTGTPISMMIENTDQRSKDYG
                     EIARQYRPGHADYAYDVKYGIRDYRGGGRSSARETAARVAAGAIARKVVPGLEVRGAL
                     VSIGVHDIDRSRWNWAEVDNNPFFTPDAGSVEVFADYLDGIRKSGSSVGAIIEIVAEG
                     VPAGIGAPIYGKLDQDIASYLMSINAVKGVEIGNGFEAARLTGEENADEMRMGNDGKP
                     IFLSNHAGGVLGGIATGAPVVARFAVKPTSSILTPRRSIDKDGNEVDVMTRGRHDPCV
                     GIRAVPIGEAMVACAIADHYLRHRGQTGRV"
     CDS             123332..124447
                     /codon_start=1
                     /transl_table=11
                     /gene="ribAB"
                     /locus_tag="BR10RB9215_C10121"
                     /product="3,4-dihydroxy-2-butanone-4-phosphate
                     synthase/GTP cyclohydrolase II"
                     /EC_number="3.5.4.25"
                     /db_xref="GOA:A0A1M4L966"
                     /db_xref="InterPro:IPR000422"
                     /db_xref="InterPro:IPR017945"
                     /db_xref="InterPro:IPR032677"
                     /db_xref="InterPro:IPR036144"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L966"
                     /protein_id="SBW13317.1"
                     /translation="MSYNQKQVVDAIRAFERGEIVVVMDDDGRENEGDLIVAAVHCTP
                     EKMAFIVRHTSGIVCTPMTREEAKRLNLTPMVAENESAHTTAFTVTVDYRHGTTTGIS
                     AEDRTLTVRNLANPNAGASDFVRPGHIFPLVAREGGVLMRSGHTEAAVDLCKLANLPP
                     IGVICELVNDDGTVKRGPDVAAFAEEHKLHRVTVADLIAYRQRKETLVRRIGDAPVET
                     CAGKAHAYSYELPWEPMQHVAVVFGDIRDGEDVPVRLHREDVLNDVFGKGGSNLDAIM
                     QRMGREGRGILVYLREGSVGVRSDHRDARAREALQGEHEAHAEAVAREEEWRQIGLGA
                     QILKDLGVSSIVLLASRERHYVGLEGFGICITRTEII"
     CDS             124661..125629
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10122"
                     /product="histone deacetylase family protein"
                     /db_xref="InterPro:IPR000286"
                     /db_xref="InterPro:IPR023696"
                     /db_xref="InterPro:IPR023801"
                     /db_xref="InterPro:IPR037138"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L954"
                     /protein_id="SBW13318.1"
                     /translation="MLYSGCMTTRLYWHPIYLEHLTPPGHPERPDRIRALMSELEGPD
                     FYRLDRVEAPHAGETAILLAHPEEHLEAVRSKIPEPVEDGEAPQPIMKLDGDTYISPK
                     SMDAALTAIGAAMAAVDDVMSGAADNVFVASRPPGHHAERSRAMGFCVFNNIAIAARH
                     AQRHHGLERIAIVDWDVHHGNGTQDIFKDDPGVMFCSTHQFPLYPGSGDKHETGVGNI
                     VNAPLSPNTGSREFREAFNSRILPALDNFRPDLILISAGFDAHFRDPLAEINLDESDF
                     DWATGKLMERAERFCNHRLVSVLEGGYDLEGLSQSASVHITRLLKG"
     CDS             125634..125888
                     /codon_start=1
                     /transl_table=11
                     /gene="xseB"
                     /locus_tag="BR10RB9215_C10123"
                     /product="exodeoxyribonuclease VII small subunit"
                     /EC_number="3.1.11.6"
                     /db_xref="GOA:A0A1M4L994"
                     /db_xref="InterPro:IPR003761"
                     /db_xref="InterPro:IPR037004"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L994"
                     /protein_id="SBW13319.1"
                     /translation="MVTEPSNADIAVMSFEDALKQLEKIVDDLERGDVPLEESIRIYE
                     RGEALKKHCDTLLKSAEDKVEKIRIGRDGQPVGTEPLDSE"
     CDS             complement(125895..126413)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10124"
                     /product="dedA family protein"
                     /db_xref="GOA:A0A1M4L9D7"
                     /db_xref="InterPro:IPR032816"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9D7"
                     /protein_id="SBW13320.1"
                     /translation="MHFVESYLATYGTLALFFIIYSESFGAPLPGESALIASSLLALH
                     GTLHIQTVLITVFIASVLGDSTGYLIGRFGGRKLILRYGYLVKLTPERLNQFEKIFAE
                     KGIYVVATARFVVLLRQLNGLVAGSMKMNPLHFLAANMVGAAGWTLIWGLGPYLLSGV
                     LAPYVAHLKALF"
     CDS             complement(126655..126915)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10125"
                     /product="transglycosylase"
                     /db_xref="GOA:A0A1M4L968"
                     /db_xref="InterPro:IPR007341"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L968"
                     /protein_id="SBW13321.1"
                     /translation="MSVISWIILGLIAGFIGSKIVNKSGQGMFLDIALGVVGAIIGGV
                     IFTFFGAQGVTGLNIYSLIVSVIGAVIVLWIYHAVTGKRSIG"
     CDS             127078..127629
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10126"
                     /product="hypothetical protein"
                     /db_xref="InterPro:IPR009282"
                     /db_xref="InterPro:IPR027405"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L997"
                     /protein_id="SBW13322.1"
                     /translation="MGSYDDNSGNSPIPGGSLAKPVMIALGALLIGKLLKGNSDDAPA
                     TQAQPVPEQPQAGGGLLGGILGGLGGLLGSAAAGNASAAPAPGPLGGGLGGLLDQLKQ
                     SGLGDKVDSWVGQGENHPIEPGQLGNAIGQTTLEQIAAHAGIDQQELLNQLSQVLPGL
                     VDKLTANGQVPDANTLSKLLQGR"
     CDS             127786..128706
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10127"
                     /product="pirin-related protein"
                     /db_xref="InterPro:IPR003829"
                     /db_xref="InterPro:IPR008778"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR012093"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9B5"
                     /protein_id="SBW13323.1"
                     /translation="MSFFPCADPVLGDKTSVDSIETLVIPRTSDIGGLEVRRALPTAR
                     RRLVGPFIFFDRMGPAILRDGEALDVRPHPHIGLSTVTYLFDGHIRHRDSLGTEMVIR
                     PGDVNLMTAGRGIVHSERSPEEERAGPMPISGVQTWLALPDAKEEIDPAFHHINAPDL
                     PLMDDAAFSGRLIIGSMHGLSSPVIQHAETLYADIRIHPDGRFQIPPTTEERAIYTLE
                     GNVGIGGEVFPPDRLLAFRPGDDIVVQAGPEGAHIMLFGGAPLGSRRYIWWNFVASSK
                     ERIEQAKEEWRMGRFDIVPGDEQDFIPLPE"
     CDS             128849..130780
                     /codon_start=1
                     /transl_table=11
                     /gene="dxs"
                     /locus_tag="BR10RB9215_C10128"
                     /product="1-deoxy-D-xylulose-5-phosphate synthase"
                     /db_xref="GOA:A0A1M4L9F1"
                     /db_xref="InterPro:IPR005474"
                     /db_xref="InterPro:IPR005475"
                     /db_xref="InterPro:IPR005477"
                     /db_xref="InterPro:IPR009014"
                     /db_xref="InterPro:IPR020826"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="InterPro:IPR033248"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9F1"
                     /protein_id="SBW13324.1"
                     /translation="MSRPSTPLLDKAPTPDRLRALPEQDLPQLAEELRTELIDAVSTT
                     GGHLGAGLGVVELTVALHHVFNTPYDRIIWDVGHQAYPHKILTGRRDRIRTLRQAGGL
                     SGFTKRAESEYDPFGAAHSSTSISAGLGMAVASELSGEKRNVIAVIGDGSMSAGMAYE
                     AMNNAGALDARLIVILNDNDMSIAPPTGAMSAYLARLVSGRTYRSVREAAKQVAQKLP
                     KFLQDKARKSEEYARAFFTGGTLFEELGFYYVGPIDGHNLDHLLPVLKNVRDTQKGPV
                     LIHVVTQKGKGYAPAEAAADKYHGVNKFDVITGKQAKPPANAPSYTKIFGTSLIEEAR
                     HDDKIVAVTAAMPTGTGLDLFGEAFPKRVFDVGIAEQHAVTFAAGLASEGYKPFCAIY
                     STFLQRGYDQVVHDVSIQNLPVRFPIDRAGLVGADGPTHAGSFDTGFLAALPGFVVMA
                     ASDEAELRHMVRTAAEYDEGPISFRYPRGDGVGVDLPERGSVLEIGKGRIVREGTKVA
                     LLSFGTRLQECLAAAEELGAAGLSTTVADARFAKPLDHDLIRRLAREHEVLVMVEEGA
                     VGGFGSHVLQFLATDGLLDRGLKVRALTLPDIYQDHGKPDAMYAEAGLDRTGIVRTVF
                     AALHRDELGHEALPTPFRA"
     CDS             130786..131547
                     /codon_start=1
                     /transl_table=11
                     /gene="tlyA"
                     /locus_tag="BR10RB9215_C10129"
                     /product="hemolysin A"
                     /db_xref="GOA:A0A1M4L951"
                     /db_xref="InterPro:IPR002877"
                     /db_xref="InterPro:IPR002942"
                     /db_xref="InterPro:IPR004538"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="InterPro:IPR036986"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L951"
                     /protein_id="SBW13325.1"
                     /translation="MNGQCTDNRPRLDQLLVERGFFATRSRARDAIQRGTVKVDGRPI
                     TKPGQMVARDAALAVDDPASAYVSRAALKLVAALDHFDLDVKGRTALDIGASTGGFTQ
                     VLLERGAHHVIAIDVGHDQLHESLRHDPRVTSKEGINARALELAHLDTRAVDCVVSDV
                     SFISLRLALPPALALAEKGAICALLVKPQFEAGREAIGKGGILRDPAYGERMAQELKS
                     WLETQPGWRALGLCPSPIEGGDGNREYLLAGKKDR"
     CDS             131544..132791
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10130"
                     /product="RNA methyltransferase putative, TrmA family"
                     /db_xref="GOA:A0A1M4L980"
                     /db_xref="InterPro:IPR010280"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="InterPro:IPR030390"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L980"
                     /protein_id="SBW13326.1"
                     /translation="MTSSKTGQITIRSIGAGGDGVANLPDGQIYVPFTLPGEVVNVAR
                     DKNRATLMALLEASPERQNPACRHFEDCGGCALQHWQDEPYRLWKRELVIGALKGRGI
                     DVEVAPLVACSPHTRRRAVFAARKTEKGVLLGFNRHQSHEIIDIVECPVTVPEIIARL
                     DDLREVGALLAPGSRPFKLAATLTESGLDLSASGCGKLNDDQRRALTALVIKKDFARL
                     SHEGEIIVEPKKPLIHFGKVPVPVPPGCFLQATAEAEETMAALVLAHLGKARRVADLF
                     CGVGTFALRIAEKSAVHAVENDAAALAALDRGVRHVQGLKPVSIERRDLFRRPLMPKE
                     LLPYNAVVFDPPRAGAEEQALELAKSKVEKVVAISCNPVTLARDLAILQKGGYRIERV
                     TPIDQFLWSAHVEAVAVLTKGRQ"
     CDS             complement(133015..133617)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10131"
                     /product="putative lysine decarboxylase"
                     /db_xref="GOA:A0A1M4L983"
                     /db_xref="InterPro:IPR005269"
                     /db_xref="InterPro:IPR031100"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L983"
                     /protein_id="SBW13327.1"
                     /translation="MSEIRSICVYCGSSTGQNPLYREAGLALGRSIAEHGIRLVYGGG
                     TRGIMGAVAQGVMEAGGEVTGIIPTFLLDKEASLERAKELSELIIVDDMHERKHLMFQ
                     RSDAFVTLPGGIGTVEEIVEMMTWAQLGKHRKPMVFANINNFWQPMLALLDHMRAEGF
                     IHTAHQVQPLIVDKAEDIVPAIIAANGRRKAGDLEIIGKM"
     CDS             133747..134112
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10132"
                     /product="hypothetical protein"
                     /db_xref="InterPro:IPR018660"
                     /db_xref="InterPro:IPR036328"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L963"
                     /protein_id="SBW13328.1"
                     /translation="MKMWTLAKISVAAAALSFAASAASASEITIKLPDNVKVSTNSIL
                     YKCGAKDLSVTYYNADDISLAKLELEDETVVASNVISGSGAKYAGSVYIWWTKGKTAS
                     LYNLIDNPEEDKPISCVEQ"
     CDS             134299..135513
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10133"
                     /product="LysM domain protein"
                     /db_xref="GOA:A0A1M4L9A4"
                     /db_xref="InterPro:IPR018392"
                     /db_xref="InterPro:IPR036779"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9A4"
                     /protein_id="SBW13329.1"
                     /translation="MQKYWSWLLGVGLVVIAGGLAFYWNSLTRTADAPKVDKASIASP
                     VTPGPAKEKPAQAQQTPATAMPATAKAVDVPVFDVLRVEADGSVVIAGQAAPYSAVDV
                     VAGAEVVGQARAGANGDFAVVLDRALSPGDHQLVLRATSSDKHVATSAQTAIVSVPAT
                     ADGQVLALVEEPGQASRLITKPKTAPEGSAAGAPSGGHMQADAAGETGQAKPDADRPI
                     AIEAVEIEGSSVFVAGKAKDGASVIVHANDVLLGTSAISPEGRFLVQGERPLAIGDYI
                     IRADLLDGTNRILATARVPFRREAGENISAVAPAANQQAGSANTRADGAQDTAALQKV
                     DGSVIIRRGDNLWTISKRTYGEGTRYTTIYLANRDQIRNPDLIWPGQVFVMPKEPLRD
                     NEVKRKLLQKTP"
     CDS             135717..137603
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10134"
                     /product="ABC transporter"
                     /db_xref="GOA:A0A1M4L9E6"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR036640"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9E6"
                     /protein_id="SBW13330.1"
                     /translation="MNAPKTVSAESGETLKTLRNLWPYMWPSDRPDLRMRVVWATFYL
                     VLSKIVLILVPYFFKWVTNALNGQLHAPDYIPVVLVGAVMLVLAYNAAKIVQAGLNQL
                     RDALFASVGQYAVRQLAYKTFVHMHELSLRFHLERRTGGLSRVIERGTKGIETIVRFT
                     ILNTLPTILEFALTAVIFAFAYGLSYLVVVAATVWLYTWFTIRASDWRINIRREMNDS
                     DTDANTKAIDSLLNFETVKYFGNEAMEAKRFDGAMARYEKAATQTWTSLGWLNFGQAV
                     IFGAGMAIVMVMSAMEVQKGTQSLGDFVFINALLMQLSIPLNFIGFIYREIRQGLTDI
                     EQMFDLLDVKQEVKDKPGAPALKVDSGAISFKDVHFAYDLQRPILRGISFDVPAGKTV
                     AIVGPSGAGKSTISRLLFRFYDIQSGSITIDGQDVRDVTQESLRKFIGMVPQDTVLFN
                     DTIAYNIRYGRTNASEEDVEKAAELAQIATFIKHLPDGYKSMVGERGLKLSGGEKQRV
                     AIARTILKAPPILILDEATSALDTATEQEIQSALDIVSRGRTTLVIAHRLSTVIGADE
                     IIVLKDGLIAERGTHRHLLDQKGLYASMWDRQREASEAEERLRQMRESDDMGVVLRGT
                     PAAE"
     CDS             137707..138405
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10135"
                     /product="phosphatidylserine decarboxylase"
                     /db_xref="GOA:A0A1M4L982"
                     /db_xref="InterPro:IPR003817"
                     /db_xref="InterPro:IPR033175"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L982"
                     /protein_id="SBW13331.1"
                     /translation="MSLTDTIRNTFVPIHREGYPFIAGFFVVSLILGWLWDPLFWIGM
                     VLTVWCIYFYRDPERVTPMDDDLVISPADGKVSFVGLAVPPAELDLGYEPMTRVSVFM
                     NVFSVHINRSPVRGKIDKVVHRPGKFLNAELDKASTENERNSVLIESPHGKVGVVQIA
                     GLVARRIVCWSNQDDELSVGERFGLIRFGSRVDVYLPSDATVRVAVGQTAIAGETVLA
                     DYGTERGEPVVRIA"
     CDS             138410..139246
                     /codon_start=1
                     /transl_table=11
                     /gene="pssA"
                     /locus_tag="BR10RB9215_C10136"
                     /product="CDP-diacylglycerol-serine
                     O-phosphatidyltransferase"
                     /EC_number="2.7.8.8"
                     /db_xref="GOA:A0A1M4L9A7"
                     /db_xref="InterPro:IPR000462"
                     /db_xref="InterPro:IPR004533"
                     /db_xref="InterPro:IPR012616"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9A7"
                     /protein_id="SBW13332.1"
                     /translation="METPFPPFEPNGRVDASRGPKLSQIPLRIVVPNVITVLAICAGL
                     TGIRLAFENRFELAVAMVLLAAFLDGIDGRIARMIKGSSKFGAQMDSLADIVNFGVAP
                     ALVLYAFMLDHARSFGWIAALLYAIACCLRLARFNVMLEDPNRPAWQNNYFIGVPAPA
                     GAMLVLLPVYLGFLGLMPTRALAFGVAAYTVAIAFLLVSRLPVYNGKSAGSLVRRDIV
                     MPLILCVVIYVAFLMSFTWQTLSLTALAYLAFLPFSLAAWNKREAADRKKAAEEASSG
                     DN"
     CDS             complement(139336..140103)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10137"
                     /product="3-ketoacyl-ACP reductase"
                     /db_xref="GOA:A0A1M4L9C5"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9C5"
                     /protein_id="SBW13333.1"
                     /translation="MFLNAYGDAMNIDLTGRLALVTGASRGIGYFLSLELAKRGAHVI
                     AVARTVGGLEELDDEIRKLGSSATLVPLDITDMEALDRLGGTIHERWGKLDILVANAG
                     ILGTISPIGHVEAKTFEKVMNINVTSVWRLIRSVDPLLRASDAGRAIMLSSGVAHSCR
                     AFWGPYAASKAAVEVMARCWAEETKKMKLKINSVNPGATRTAMRAQAMPGEDPETLPT
                     PQSVAEKIVKLADPKLEVTGKLFDVRQDRFLDYHMPS"
     CDS             complement(140145..141635)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10138"
                     /product="glutamine-fructose-6-phosphate transaminase
                     (isomerizing)"
                     /db_xref="GOA:A0A1M4L9G2"
                     /db_xref="InterPro:IPR000836"
                     /db_xref="InterPro:IPR005854"
                     /db_xref="InterPro:IPR017932"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="InterPro:IPR035584"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9G2"
                     /protein_id="SBW13334.1"
                     /translation="MTSHSSENAPFMLDDDTLHEECGVFGILGHEDAAALTALGLHAL
                     QHRGQEAAGIVSYHNRRFHSERHMGLVGDHFTDAATLNRLPGNRAIGHVRYSTTGETI
                     LRNVQPLFAELEVGGIAIAHNGNFTNGITLRKQLIASGAIFQATSDTEVVLHMIARSR
                     HSSSTDRFVEAIRQVEGGYAMLALTRTKLIAARDPIGIRPLVMGELDGKPIFCSETCA
                     LDIIGAKYIRDVENGEVVVCEIQKDGSITTRSIKPENPQPERLCLFEYVYFARPDSVV
                     GGRSVYVARKNMGMNLAAEAGVDADVIVPVPDGGTPAALGFAQASGIPFEYGIIRNHY
                     VGRTFIEPTQQIRALGVKLKHSANRAMIEGKRVVLVDDSIVRGTTSVKIVQMIRDAGA
                     TEVHMRVASPMIFHPDFYGIDTPHADTLLANQHESLESMCRYIGADSLAFLSIDGLYK
                     AVGGKPRDPKAPTFTDHYFTGEYPTRLLDQEGESNVHTLSLLASNG"
     CDS             complement(141917..142495)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10139"
                     /product="colicin V production protein, putative"
                     /db_xref="GOA:A0A1M4L960"
                     /db_xref="InterPro:IPR003825"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L960"
                     /protein_id="SBW13335.1"
                     /translation="MPITMLDGILLGITLVSAVLAMVRGFSREVLSLVSWAAAAAAAV
                     LLYKPVLPYVKPYISNDTIAMIAAMAAVFLVVLIVVSLITMKIADFIIDSRIGALDRT
                     LGFLFGAARGVLLVVVAMLFFNWLVPTNQPDWVTNAKSKPMLDSFGQQLIELLPADPD
                     KSLIEKLKPKADAPAAGEPEEAPVPDDTPAQE"
     CDS             complement(142621..144024)
                     /codon_start=1
                     /transl_table=11
                     /gene="radA"
                     /locus_tag="BR10RB9215_C10140"
                     /product="DNA repair protein RadA"
                     /db_xref="GOA:A0A1M4L989"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004504"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR020588"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L989"
                     /protein_id="SBW13336.1"
                     /translation="MAKARVQFICQNCGAVHSRWAGKCDSCGEWNTLIEEGTNSGIGS
                     GPGAMLSKRKGRAVALTSLSGEIEDAPRIISGISELDRVTGGGFVRGSALLIGGDPGI
                     GKSTLLTQAAAALSNRGHRIVYVSGEEAVAQIRLRAQRLGVAASAVELAAETNVEDII
                     ATISSDNSGSKRPDLVIIDSIQTLWTDMADSAPGTVTQVRSSAQAMIRYAKQTGAAVV
                     LVGHVTKDGQIAGPRVVEHMVDGVLYFEGEGGHHYRILRTVKNRFGPTDEIGVFEMSD
                     GGLREVSNPSELFLGERNEKSPGAAVFAGMEGTRPVLVEIQALVAPSSLGTPRRAVVG
                     WDGGRLAMILAVLESHCGVRFGQHDVYLNVAGGYRISEPAADIAVAAALVSSMAGIAL
                     PPDCVYFGEISLSGAVRAVSHAVQRLKEAEKLGFRQAEVPNGSGELWKDRNFRLMETA
                     ALADLVARIAASGAGKK"
     CDS             complement(144052..145557)
                     /codon_start=1
                     /transl_table=11
                     /gene="dnaB"
                     /locus_tag="BR10RB9215_C10141"
                     /product="replicative DNA helicase"
                     /EC_number="3.6.1.-"
                     /db_xref="GOA:A0A1M4L986"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR007692"
                     /db_xref="InterPro:IPR007693"
                     /db_xref="InterPro:IPR007694"
                     /db_xref="InterPro:IPR016136"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR036185"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L986"
                     /protein_id="SBW13337.1"
                     /translation="MAEAAVRKLDDARDQKDVRYREAPHNIEAEQALLGAILINNDAF
                     YRVSDFLKPTHFLEPLHRRIYEIATDLIRVGKMANPVTMKTFLPTEGKVGDLSIFQYV
                     TRLATEAVTIINAEDYGRAIYDLATRRALIGIGEDMVNIAYDAPVDMAPQEQIEDAER
                     RLFELAETGRYDGGFLPFKDAVTTAVDMANAAFMRDGHLSGISTGIHALDSKMGGLQP
                     SDLIILAGRPGMGKTSLATNIAFNIANAYEPDQQADGTIKAANGGVVGFFSLEMSAEQ
                     LATRIISEQTEVSSSKIRRGEITETDFEKLVACSQVMQKIPLYIDQTGGISIAQLAAR
                     ARRLKRQRGLDVLVIDYVQLMTGSSKASAQNRVQEITEITTGLKALAKELNVPIIALS
                     QLSRQVESRDDKRPQLSDLRESGSIEQDADVVLFVFREEYYVKNLEPRDEFDPKYEEW
                     KQHFEKVRGTADVIIAKQRHGPTGTVKLAFQSEFTRFADLADGSYLPEQYE"
     CDS             complement(145756..147036)
                     /codon_start=1
                     /transl_table=11
                     /gene="cfa"
                     /locus_tag="BR10RB9215_C10142"
                     /product="cyclopropane-fatty-acyl-phospholipid synthase"
                     /EC_number="2.1.1.79"
                     /db_xref="GOA:A0A1M4L971"
                     /db_xref="InterPro:IPR003333"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L971"
                     /protein_id="SBW13338.1"
                     /translation="MYGMLRTVLTHMIKTGDLTVTDADGSKTRFGDRTGTPVHVHFKT
                     AHAQRAVAFNPELKLAECFMDGEIDFLEGDIYTLLQVVFENTGPTAATEPWMKAAGKL
                     RVLFRRFQQMNTISRSSSNIKSHYDLSGELYDLFLDPDKQYSCAYFDPPNATLAEAQL
                     AKKRHIAAKMLVKEGDKVLDIGCGWGGMGLYLARHLKANVTGVTLSEEQHAIANQRAR
                     DEGLADRAKFELTDYRNINDKFDRLVSVGMFEHVGVGHFAEYFQHVARLMKPDGVFLL
                     HAIGRSDGPGATNPFIRKYIFPGGYIPALSEVLPHIEKAGLYVTDIEILRLHYAETLK
                     AWREAFLANRDKAKALYDERFCRMWEFYLAASESAFRWQNMMVFHIQITHRQEAVPLT
                     RNYIEAEEKRLKRLDSAPKGANSETRSVKKSINA"
     CDS             complement(147411..147980)
                     /codon_start=1
                     /transl_table=11
                     /gene="rplI"
                     /locus_tag="BR10RB9215_C10143"
                     /product="50S ribosomal protein L9"
                     /db_xref="GOA:A0A1M4L9B4"
                     /db_xref="InterPro:IPR000244"
                     /db_xref="InterPro:IPR009027"
                     /db_xref="InterPro:IPR020069"
                     /db_xref="InterPro:IPR020070"
                     /db_xref="InterPro:IPR020594"
                     /db_xref="InterPro:IPR036791"
                     /db_xref="InterPro:IPR036935"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9B4"
                     /protein_id="SBW13339.1"
                     /translation="MEVILLERIGRLGQMGDTVKVKDGYARNFLLPQGKALRANEANK
                     KKFEGQRAQLEAQNLERKNEAQAVADKLNGESFIVVRSAGETGQLYGSVSTRDIAEII
                     TANGFTLHRNQVELNHPIKTIGLHEVSVSLHPEVQVKVMVNIARSTEEAERQAKGEDL
                     TSIEAIYGIEEQPLSEEVFDDEDEAEDQA"
     CDS             complement(148010..148981)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10144"
                     /product="hypothetical protein"
                     /db_xref="GOA:A0A1M4L9F5"
                     /db_xref="InterPro:IPR018710"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9F5"
                     /protein_id="SBW13340.1"
                     /translation="MKFNGTIIGIGIMAGLASALMSAGVIVQPGLMAGLAMVFYFITP
                     LPIFAAALGWGSSAGIVAALAATGAVGIFAAPMAALLMALTSFIPAATGAYLSGLARP
                     AEELGGPKGVLVWYPLSDITFRLALMVALSFVIIGAIVGFGPEMARELANTLIDGVAE
                     ADQQFTASDETRDSVTMLLMVALPAIQPATCLAILIGNLYLALRLTALSGRLRRPRDD
                     WPATMRMPRPALLVFAIALAAAFLPGDIGLIATVVAGALSAGFMMAGLAIMHHRTRGK
                     LWRPVALWLVYVAILLFAFLLFVFMVLGLFDTSRGAPISKIPGADNQ"
     CDS             complement(149132..149380)
                     /codon_start=1
                     /transl_table=11
                     /gene="rpsR"
                     /locus_tag="BR10RB9215_C10145"
                     /product="30S ribosomal protein S18"
                     /db_xref="GOA:A0A1M4L992"
                     /db_xref="InterPro:IPR001648"
                     /db_xref="InterPro:IPR018275"
                     /db_xref="InterPro:IPR036870"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L992"
                     /protein_id="SBW13341.1"
                     /translation="MVDINQIPTRRPFHRRRKTCPFSGANAPKIDYKDVKLLQRYISE
                     RGKIVPSRITAVSQKKQRELAKAIKRARFLGLLPYVVK"
     CDS             complement(149383..149829)
                     /codon_start=1
                     /transl_table=11
                     /gene="rpsF"
                     /locus_tag="BR10RB9215_C10146"
                     /product="30S ribosomal protein S6"
                     /db_xref="GOA:A0A1M4L9C1"
                     /db_xref="InterPro:IPR000529"
                     /db_xref="InterPro:IPR014717"
                     /db_xref="InterPro:IPR020814"
                     /db_xref="InterPro:IPR035980"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9C1"
                     /protein_id="SBW13342.1"
                     /translation="MALYEHVLLARQDISQQQVDALVEQFKGVLEANGGKFGKVENWG
                     LRPLTYRIKKNRKAYYTLVNIDAPAAAVAEMERQMRINEDVLRFLTVRVEEHEEGQSA
                     MLTRRDDRRERDGDDRPRRREGGFDRGDRGDRGPRRPRDNEAGEGA"
     CDS             150235..151179
                     /codon_start=1
                     /transl_table=11
                     /gene="fabD"
                     /locus_tag="BR10RB9215_C10147"
                     /product="ACP S-malonyltransferase"
                     /EC_number="2.3.1.39"
                     /db_xref="GOA:A0A1M4L9D3"
                     /db_xref="InterPro:IPR001227"
                     /db_xref="InterPro:IPR004410"
                     /db_xref="InterPro:IPR014043"
                     /db_xref="InterPro:IPR016035"
                     /db_xref="InterPro:IPR016036"
                     /db_xref="InterPro:IPR020801"
                     /db_xref="InterPro:IPR024925"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9D3"
                     /protein_id="SBW13343.1"
                     /translation="MAVAFTFPGQGSQAVGMGKALAEQFAEARAVFDEVDEALGEKLS
                     ATMFEGPEDVLTLTANAQPALMAVSMAVQRIMEARGFSLKDKVSYVAGHSLGEYSALC
                     AAGTFSLADTARLLRIRGNAMQKAAPVGEGAMAAIIGLEHGDVEAVCMEAKASGPVQI
                     ANDNGGGQLVISGSRAAVELAAKLGSEKGAKRAIMLPVSAPFHSTLMAPAADAMREAL
                     ATVEKHDPVVPLIANVRAAPVTDANEIAALLVEQVTGQVRWRETIEWFSANGVTTLYE
                     VGCGKVLTGLARRISKDVSGAAVGSAEEIEAALAALNA"
     CDS             151249..151986
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10148"
                     /product="3-oxoacyl-ACP reductase"
                     /db_xref="GOA:A0A1M4L9H6"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR011284"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9H6"
                     /protein_id="SBW13344.1"
                     /translation="MFDLTGRKALVTGATGGLGEAIARALHAQGAIVGLHGTREEKLK
                     ELAAELGERIFVFPANLSDREAVKALGQKAEEEMGGVDILVNNAGITRDGLFVRMSDE
                     DWDAVLTVNLTSVFNLTRELTHPMMRRRNGRIINITSIVGVTGNPGQANYCASKAGLI
                     GFSKSLAQEIASRNVTVNCIAPGFIESAMTGKLNEKQKDAIMGNIPMKRMGVGADIAA
                     AVVYLASDEAAYVTGQTLHVNGGMAMI"
     CDS             152260..152496
                     /codon_start=1
                     /transl_table=11
                     /gene="acpP"
                     /locus_tag="BR10RB9215_C10149"
                     /product="acyl carrier protein"
                     /db_xref="GOA:A0A1M4L972"
                     /db_xref="InterPro:IPR003231"
                     /db_xref="InterPro:IPR006162"
                     /db_xref="InterPro:IPR009081"
                     /db_xref="InterPro:IPR020806"
                     /db_xref="InterPro:IPR036736"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L972"
                     /protein_id="SBW13345.1"
                     /translation="MSDTAERVKKIVVEHLGVDADKVTEGASFIDDLGADSLDTVELV
                     MAFEEEFGVEIPDDAAETILTVGDAVKFIDKASA"
     CDS             152820..154082
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10150"
                     /product="3-oxoacyl-ACP synthase"
                     /db_xref="GOA:A0A1M4L999"
                     /db_xref="InterPro:IPR014030"
                     /db_xref="InterPro:IPR014031"
                     /db_xref="InterPro:IPR016039"
                     /db_xref="InterPro:IPR017568"
                     /db_xref="InterPro:IPR018201"
                     /db_xref="InterPro:IPR020841"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L999"
                     /protein_id="SBW13346.1"
                     /translation="MRRVVITGLGLVSPLASGVEETWKRLLAGESGARRVTEFEVDDL
                     ACQIACRIPVGDGTNGTFNPDLHMDPKEQRKVDPFIVYAVGAADQALDDAGWHPENDE
                     DQVRTGVLIGSGIGGIEGIVEAGYTLRDKGPRRISPFFIPGRLINLASGHVSIKHKLR
                     GPNHSVVTACATGTHAIGDAARLIAFGDADVMVAGGTESPVSRISLAGFAACKALSTK
                     RNDDPTAASRPYDEDRDGFVMGEGAGIVVLEELEHALARGAKIYAEVIGYGMSGDAFH
                     ITAPTESGEGAQRCMVAALKRAGIVPDEIDYINAHGTSTMADTIELGAVERVVGEAAA
                     KISMSSTKSSIGHLLGAAGAAEAIFSTLAIRDNIAPATLNLDNPAAQTRIDLVPHKPR
                     ERKIDVALSNSFGFGGTNASLVLRRYTA"
     CDS             154306..155544
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10151"
                     /product="aminodeoxychorismate lyase, putative"
                     /db_xref="GOA:A0A1M4L9A0"
                     /db_xref="InterPro:IPR003770"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9A0"
                     /protein_id="SBW13347.1"
                     /translation="MNSEEKPGTNPAEQQSVSEPQNEAVPTAPEKAAEPKPFVPKSAS
                     EALRPEPGTPPPRNRSRHARSQIVVFMNFMLSLVVLVLLGASALFYFGKLQFDAQGPL
                     TAETTFLVKRGAGIAEVSNGLESRDIVSDARIFRYGMRTLGHENDLKAGEYAIPAGAS
                     MRDVMNILISGKSIMYPFTVPEGLTVKQVFDRIAADPILIGDMPKEMPPEGSLFTDTL
                     NFTRGTTRSEIIDRMIASQKKLVDDLWAKRRPDLPVRDKNEFVTLASIVEKETGIASE
                     RPHVASVFVNRLNKGMRLQSDPTIIYGLFGGAGKPSDRPIFKSDIEKPTPYNTYIING
                     LPPTPIANPGKAALAAVANPLQTDDLYFVADGTGGHVFSATLKGHNDNVRKWRAAEQQ
                     KNTGQQKDTSGGSGKPDTGQ"
     CDS             155729..156628
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10152"
                     /product="hypothetical protein"
                     /db_xref="InterPro:IPR005229"
                     /db_xref="InterPro:IPR013527"
                     /db_xref="InterPro:IPR013551"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L981"
                     /protein_id="SBW13348.1"
                     /translation="MVLQSMTGFARHAAQHGMADGEARIVWEVRSVNGKGLDLRLRLP
                     QGLESVEHPVRSLLARHFSRGNFQASLTVERSETQAGFAINQPMLAEVLKLGAELQEK
                     HGLAPASVDGILALRGIIDQSQRAEDEEERAALEAAIVAAFEGALKAIAEARRQEGKA
                     LFTILSTHLDTIEQLTADARNDPSRATEAIKARLAGQVALLLDATRELDETRLYQEAA
                     FLATKADIQEELDRLETHVASARKLLGEGGPVGRKLDFLSQEFNREANTLCSKSNAAS
                     ITAIGLGLKAVVDQFREQVQNLE"
     CDS             156682..157299
                     /codon_start=1
                     /transl_table=11
                     /gene="gmk"
                     /locus_tag="BR10RB9215_C10153"
                     /product="guanylate kinase"
                     /EC_number="2.7.4.8"
                     /db_xref="GOA:A0A1M4L9C4"
                     /db_xref="InterPro:IPR008144"
                     /db_xref="InterPro:IPR008145"
                     /db_xref="InterPro:IPR017665"
                     /db_xref="InterPro:IPR020590"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9C4"
                     /protein_id="SBW13349.1"
                     /translation="MVVISSPSGAGKSTIARLLLEDPKMKLSLSISVTTRQRRPSEID
                     GVHYHFITIREFERLRDNDELIEWAEVHGNFYGTLRETAEIALADGQDMLFDIDWQGA
                     DQLQAKMPADVVSIFILPPTMRELQQRLNRRAEDTAEVIETRLQNARFEIQKWVKYDY
                     IVINEDLDRSYAAIKSIINAERLRRDRRPGLFDFVTGLLEEDPGI"
     CDS             complement(157356..158768)
                     /codon_start=1
                     /transl_table=11
                     /gene="tldD"
                     /locus_tag="BR10RB9215_C10154"
                     /product="TldD protein"
                     /db_xref="GOA:A0A1M4L9G5"
                     /db_xref="InterPro:IPR002510"
                     /db_xref="InterPro:IPR025502"
                     /db_xref="InterPro:IPR035068"
                     /db_xref="InterPro:IPR036059"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9G5"
                     /protein_id="SBW13350.1"
                     /translation="MKSLIDSFDTGRDHIERLVAESLKGSDDGELFLEYREAEALVFD
                     NGRLKTGSFNQDQGFGLRSVAGEAIGYAHAGDLSLAALKRASDAVSATLKGYGGTYSP
                     APAGTNRHLYTDENPIGAPGFDAKVQLLQQIDAYLRAKDTKVRQVSVSLACSWQRVEI
                     LRADGHFVRDIRPMARLSVSVVAGSGDRQESGSYTLGGRKGFGEFITTESWQHAADEA
                     LRQALVNLEAIPAPAGTFDIVLANGWPGVMLHEAVGHGLEGDFNRKKTSAFAGLLGQQ
                     VAARGVTVVDDGTIAERRGSLTIDDEGTPTNRTVLIEDGKLVNYMQDRQNARLMGMEA
                     TGNGRRESYAHTPMPRMTNTYMLSGDKTPEEIIASIRKGIYAVSFGGGQVDITSGKFV
                     FGCTEAYMIEDGKVGAPIKGAMLIGNGPDAMKRISMIGNDMKLDTGSGNCGKGGQWVP
                     VGVGQPHLRMDQITVGGTAV"
     CDS             complement(158910..159536)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10155"
                     /product="hypothetical protein"
                     /db_xref="InterPro:IPR010642"
                     /db_xref="InterPro:IPR038696"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9A3"
                     /protein_id="SBW13351.1"
                     /translation="MVFRMFAHRTMIQRLAALAAGAGLSLAAATLPSAAQNNAPGTPG
                     QLPAPQQTPAEPQPTTSATPQQSGALKSQHGAWSILCDTPAGAKTEQCALIQNVVAAK
                     RPELGLSVVVLKTADNKARILRVLAPLGVLLPNGLGLNVDGKDIGRAYFVRCFEDGCY
                     AEVILEDDLLKTLRNGKAATFIVFQTPEEGVGIPVDLKGFGEGFDALP"
     CDS             159970..160824
                     /codon_start=1
                     /transl_table=11
                     /gene="coxB"
                     /locus_tag="BR10RB9215_C10156"
                     /product="cytochrome c oxidase, subunit II"
                     /EC_number="1.9.3.1"
                     /db_xref="GOA:A0A1M4L9C9"
                     /db_xref="InterPro:IPR001505"
                     /db_xref="InterPro:IPR002429"
                     /db_xref="InterPro:IPR008972"
                     /db_xref="InterPro:IPR011759"
                     /db_xref="InterPro:IPR014222"
                     /db_xref="InterPro:IPR034210"
                     /db_xref="InterPro:IPR036257"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9C9"
                     /protein_id="SBW13352.1"
                     /translation="MGGALAVLWTTGAALADQPRPWEWRFQDAATGIAEQIHWFERYT
                     LWFIIPITLLVLGLLVWVVLRFRASVNPEPSKTSHNTAIEVIWTVGPVIILLFLAVPS
                     FQLLTAQYSPEDPTLTVKATGYQWYWGYEYQVDNPVSFDSVILKDDDRAAAGKEDRAR
                     YPRLLTVDNEVVVPVGETVRLLVTASDVIHSWTIPAFGVKMDAVPGRINETWFKADKE
                     GLYYGQCSELCGKDHGFMPIAVRVVSKDQYQNWLSAAATDLPGANKALLQAEGEGSAN
                     DKVAAAGL"
     CDS             160962..162620
                     /codon_start=1
                     /transl_table=11
                     /gene="coxA"
                     /locus_tag="BR10RB9215_C10157"
                     /product="cytochrome c oxidase, subunit I"
                     /EC_number="1.9.3.1"
                     /db_xref="GOA:A0A1M4L9E3"
                     /db_xref="InterPro:IPR000883"
                     /db_xref="InterPro:IPR014241"
                     /db_xref="InterPro:IPR023615"
                     /db_xref="InterPro:IPR023616"
                     /db_xref="InterPro:IPR033944"
                     /db_xref="InterPro:IPR036927"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9E3"
                     /protein_id="SBW13353.1"
                     /translation="MAGTAAHEHGAHDDHKPHGWVRWVYSTNHKDIGTLYLIFAIIAG
                     IIGGALSIAMRAELQEPGIQIFHGLAQMVYGVEGDAALDAGKHMFNVFTSAHALVMIF
                     FMVMPALIGGFANWMVPLMIGAPDMAFPRMNNISFWLLPPALTLLLISLFMPGPAGGW
                     GPGGGWTLYPPFSTSGQPGPAVDFAILAIHISGASSILGAINFITTILNMRAPGMTLH
                     KMPLFAWAVLVTAFLLLLSLPVLAGGITMLLTDRNFGTTFFAPDGGGDPILYQHLFWF
                     FGHPEVYILILPGFGIVSHVVSTFSRKPIFGYLGMAYAMVAIGVVGFVVWAHHMYTVG
                     LSLDTQRYFVFATMVIAVPTGIKIFSWIATMWGGSISFRAPMLWAIGFIFLFTIGGVT
                     GVQLANAGLDRALHDTYYVVAHFHYVLSLGAVFAIFAGWYYWFPKMSGYMYNEFTAKL
                     HFWVTFVGVNLVFFPQHFLGLAGMPRRYIDYPDAYAGWNMISSYGSYISGFAVLIFLY
                     NVFEAFAKKREAGANPWGDGATTLEWQLSSPPPFHQWEQLPRIK"
     CDS             162848..163795
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10158"
                     /product="4-hydroxybenzoate polyprenyltransferase"
                     /db_xref="GOA:A0A1M4L9I5"
                     /db_xref="InterPro:IPR000537"
                     /db_xref="InterPro:IPR006369"
                     /db_xref="InterPro:IPR030470"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9I5"
                     /protein_id="SBW13354.1"
                     /translation="MSLVEKNTASEDAFALSEATARDYLVLLKPRVMSLVVFTGLVGL
                     VLAPGHMNPVLAVISILCIAVGAGASGALNMWYDADIDAVMKRTRKRPIPAGIIAPNQ
                     VLAFGLTLSAFSVMTLGLMVNWLAAALLAFTIFFYAVIYTMWLKRSTPQNIVIGGAAG
                     AFPPMIGWAAATGEITWDSIVLFMIIFLWTPPHFWALSLFTTNDYEAARIPMMPNVKG
                     ELSTRRQALFYAVLMAPVGVLPWVMGFAGMFYGVVSTLLGLAFVYYAWRLWAADSQPQ
                     MLAAARKLFRFSLLYLAGIFAVLLFEALTFKLLAAFGVF"
     CDS             163795..163980
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10159"
                     /product="hypothetical protein"
                     /db_xref="GOA:A0A1M4L978"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L978"
                     /protein_id="SBW13355.1"
                     /translation="MDKTAHKPVHEKLELVVPTEQQKKAQRNRSWGLAIALALFVLLV
                     YIGTLAKMGAGVFMRPI"
     CDS             164000..164605
                     /codon_start=1
                     /transl_table=11
                     /gene="ctaG"
                     /locus_tag="BR10RB9215_C10160"
                     /product="cytochrome C oxidase assembly protein"
                     /db_xref="GOA:A0A1M4L9A9"
                     /db_xref="InterPro:IPR007533"
                     /db_xref="InterPro:IPR023471"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9A9"
                     /protein_id="SBW13356.1"
                     /translation="MTDQGENEKKQRRSNATIAVACLSFFVCMIGAAYASVPLYRIFC
                     QVTGYGGTTQRVEQYSDTILDKTIKVRFDANIANGLPWDFKPMQREVTVRIGETTMIK
                     YEAHNLFGEETYGRASFNVAPGRAGAYFNKVECFCFTDNTLKPGEDLELPVVFFVDPE
                     FVNDPDLKDVKTITLSYTFFPIDKPKPVVNAKALGSTRNGG"
     CDS             164748..165692
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10161"
                     /product="cytochrome o ubiquinol oxidase subunit III"
                     /db_xref="GOA:A0A1M4L9B1"
                     /db_xref="InterPro:IPR000298"
                     /db_xref="InterPro:IPR013833"
                     /db_xref="InterPro:IPR024791"
                     /db_xref="InterPro:IPR033945"
                     /db_xref="InterPro:IPR035973"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9B1"
                     /protein_id="SBW13357.1"
                     /translation="MRFTLQAGSAREEPLRGNTGRDMADVHQKNHDYHIIAPSPWPFL
                     SSVGAFVLAIGGIAWMRYINAGELPFFGLNVVTPWIFFIGLAIVLYCMFGWWSDTIKE
                     GHEGHHTRVVSLHLRYGMIMFIASEVMFFVAWFWAFFDASLFPNEVHQVARAEFTGGI
                     WPPKGIEVLDPLHLPLYNTVILLLSGTTLTWAHHALLHNDRKGMITGLAITVALGVLF
                     SCVQAYEYIHAPFAFKDSIYGATFFMATGFHGFHVLIGTIFLLVCLFRAIGGDFTPKQ
                     HFGFEAAAWYWHFVDVVWLFLFFAIYVWGGWGAPMHGG"
     CDS             165807..166190
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10162"
                     /product="hypothetical protein"
                     /db_xref="GOA:A0A1M4L993"
                     /db_xref="InterPro:IPR009325"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L993"
                     /protein_id="SBW13358.1"
                     /translation="MPEHGHYPQVDPIRSGIAGHCPRCGEGKLFNGFLTVAPRCTACG
                     LDYGFADSGDGPAAFVILIIGFIVVGLALWMEVNIGPPLWVHFILWVPLAIILSLVAM
                     RWIKGILINMQYRHKAEQGRLDSNK"
     CDS             166187..166936
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10163"
                     /product="SurF1 family protein"
                     /db_xref="GOA:A0A1M4L9D5"
                     /db_xref="InterPro:IPR002994"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9D5"
                     /protein_id="SBW13359.1"
                     /translation="MTLEQTSRRFPWGVLIASGIALVILLSLGTWQVERLMWKEALIA
                     STEQRIHEPPLPLAEMEKIYRQEGTVEYRPVTVSGTFMHQGERHFLATYKGEAGFYVY
                     TPLMLEDGRFVLVNRGFVPYEKKDPATRPAGELAAGPVKVTGLARDPLSVKPSFVVPD
                     NDIAKNIFYWKDWAAMAESAGLPDLGRVVPFFVDADSTSNPGGLPIGGVTIIDFPNNH
                     LQYAVTWYGLALALIGVVGTWLWRYRKSGRG"
     CDS             167044..168084
                     /codon_start=1
                     /transl_table=11
                     /gene="ispH"
                     /locus_tag="BR10RB9215_C10164"
                     /product="4-hydroxy-3-methylbut-2-enyl diphosphate
                     reductase"
                     /db_xref="GOA:A0A1M4L9H3"
                     /db_xref="InterPro:IPR003451"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9H3"
                     /protein_id="SBW13360.1"
                     /translation="MTQQRPPLEIRLCGPRGFCAGVDRAIQIVVLALKKYGAPVYVRH
                     EIVHNRYVVEGLQARGAIFVEELDEIPAAHRNQPVVFSAHGVPKSVPADAEAKNLFYL
                     DATCPLVSKVHKQAMRHQRLGRHVILIGHSGHPEVIGTMGQLPDGAVTLIETVEDAHT
                     CHFDDEDNLGFVTQTTLSVDDTAGIIKELQARFPNLAAPAAESICYATTNRQDAVRAA
                     APGCDLFLIVGAPNSSNSKRLVEVAEKAGARMSMLVQRAEDIEWEQIGDISVVGLSAG
                     ASAPEIIVDEIIDAFKARFDVKIELAETTVETENFLVNREIRDVELTVKDMAFVNGEH
                     RVVGISKLMQGK"
     CDS             168090..169070
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10165"
                     /product="hypothetical protein"
                     /db_xref="GOA:A0A1M4L9B3"
                     /db_xref="InterPro:IPR002575"
                     /db_xref="InterPro:IPR005280"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9B3"
                     /protein_id="SBW13361.1"
                     /translation="MAVYTDINEIELGAFLRHYDIGTLTSYKGIAEGVENSNYLLHTS
                     SGSFILTLYEKRTNREDLPFFLGLMQHLAKRGLECPQPVVRNDGAMIGQLAGRPAAIV
                     TFLEGMWMRRPTVAHCEAVGEGLAHMHLAGADFPMRRRNGLTLSDWRPLWNLSRKCAD
                     TVERGLVAETEADLDFLEKNWPADLPQGVIHADLFPDNAFFLGDRLSGFIDFYFACTD
                     ILAYDVAVCLNAWCFEKDFSYNRTKGAALLRGYTSVRPLSGPEADALPVLARGAAVRF
                     MLTRLYDWLTVPAGSFVVKKDPMEYVRRMRFHRQIESAVEYGLEMQGVAA"
     CDS             169067..169531
                     /codon_start=1
                     /transl_table=11
                     /gene="rnhA"
                     /locus_tag="BR10RB9215_C10166"
                     /product="ribonuclease H"
                     /EC_number="3.1.26.4"
                     /db_xref="GOA:A0A1M4L9D8"
                     /db_xref="InterPro:IPR002156"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR022892"
                     /db_xref="InterPro:IPR036397"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9D8"
                     /protein_id="SBW13362.1"
                     /translation="MKRIEAYTDGACSGNPGPGGWGALLRWNGNEKELKGGEAETTNN
                     RMELMAAISALSALKEPCEVDLYTDSVYVRDGISGWIEGWKRNGWKTAAKKPVKNAEL
                     WQALDEARKAHKVTWHWIKGHAGHPENERADELARAGMEPFKYAGHRTLKVK"
     CDS             complement(169738..170223)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10167"
                     /product="ahpC/TSA family protein"
                     /db_xref="GOA:A0A1M4L9F3"
                     /db_xref="InterPro:IPR013740"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="InterPro:IPR036249"
                     /db_xref="InterPro:IPR037944"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9F3"
                     /protein_id="SBW13363.1"
                     /translation="MTIKVGDRLPAATFKVKTADGVTEMTTDDVFKGRKVVLFAVPGA
                     FTPTCSLNHLPGYLENRDAILAKGVDQIAVVAVNDPFVMGAWAQSTGGEGKILFLADG
                     SATFTKAAGLDIDLSGGGLGVRSKRYSAIVEDGVVKALNIEEQPGQAVTSAASALLAQ
                     L"
     CDS             complement(170403..171203)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10168"
                     /product="hypothetical protein"
                     /db_xref="InterPro:IPR028250"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9J5"
                     /protein_id="SBW13364.1"
                     /translation="MKICTSILAPFILAVLAIPAQASTSAWTETPGGRVRVVIEGDDP
                     AITGKQEVRGALQIELRPGWKTYWRNPGVAGVPPQISIEGDAKAQIAFPAPVRFAGDE
                     EGGIGYKKPVSLPVTFHIEPGGKRLKGHAFLGMCENICVPVLAEFDFPLEADRQKSSS
                     ENLAARTLVETAFAQLPAPASPDFGVSAVKHDKDEAIFDVALPDPNAPAELFVASDTV
                     NLSAPVSVEDGKASQRFIAKMQGKTKDAVIDYTIVQNGKAVSGRLELD"
     CDS             171470..171937
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10169"
                     /product="hypothetical protein"
                     /db_xref="InterPro:IPR003774"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L987"
                     /protein_id="SBW13365.1"
                     /translation="MGFIINQLQPVQFPDLLRQIGVIGEEDLIILPDRAQHMVVRNGG
                     PVDRTRGFVLHSDDYMVDSTMPVSDDVCLTATVDILRAIYGGGGPERALMALGYSGWA
                     PGQLEMEVAENGWLTCDAPLDMLFDSDIEGKYSRLMLHMGIDMSRLVSDAGHA"
     CDS             complement(172212..175106)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10170"
                     /product="diguanylate cyclase"
                     /db_xref="GOA:A0A1M4L9C0"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR000160"
                     /db_xref="InterPro:IPR000700"
                     /db_xref="InterPro:IPR001633"
                     /db_xref="InterPro:IPR011622"
                     /db_xref="InterPro:IPR011623"
                     /db_xref="InterPro:IPR013655"
                     /db_xref="InterPro:IPR029787"
                     /db_xref="InterPro:IPR035919"
                     /db_xref="InterPro:IPR035965"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9C0"
                     /protein_id="SBW13366.1"
                     /translation="MRGFSKNCFEAGVRFFALFVFLTLSAVHASAIEPIKISKEDTAL
                     DLSRAVELLRNKGESVQVSTMPGPDGIVRRIEVQSDQNANASGDWAAFSIANPTDEQI
                     DRLIVAPHFRLVGSGVIWPDLGSPRIASITPSEGFALDRQPSADADVFRITLNPGSVI
                     TFVAELSSHNLPQLYLWEPEAYKDMVNSYTLYRGILLGISGLLALFLTILFVVKGTSL
                     FPATAALAWAVLAYICVDFGFWNKLMQITPGNEQIWRAGTEVALAASLVIFLFTYLNL
                     NRWHDHFSYGAVTWILGLLALAGVAVFDPPVASGIARISLALTVFSGVAIIGYLAVKG
                     YDRAVMLIPAWLLTLIWLIGAWMAVSGHLDNDIVQSALGGGLVLIVLLIGFTVMQHAF
                     AGGGLQQGLLSDMERQALAVIGAGDIVWDWDVPRDRVVTTPDIANYLGNTASSLQGPV
                     RNWLPAMHADDRDRFRSTLDAILENRRGRIGQIFRLRANDGHYHWYALRARPVIGSDG
                     EVVRCVGTLVNVTEQKKAEERLLHDAVHDNLTGLPNRELFLDRLSSMMNMARGESNLH
                     PTVFVIDIDRFKQVNDSLGMSAGDTILLTISRRLARLMKPQDTLSRLSSDQFGLLLAS
                     EVDPGRIATFAEALRQAVRSPIAYAKREIVLTASIGLITWTKTATTAEDFVKDAELAM
                     FQAKRFGGDRIEPFRPAFRAIGSDKLQLESDLRRALERDEISLVYQPIVKLEEGTVAG
                     FEALMRWEHPRRGAISPSEFIPIAENSGLIVQLGLFAMQRAAEDLFAWQEQFPKLDLF
                     VSVNLSSTQLIRQDLINDVRSVLSRIHLNPSSLKLELTESVLMENPEQSAYVLARLKA
                     MGIGLSLDDFGTGYSSLAYLTRFPFDIIKIDRSFVKGDQPQKTTLLRSIVSMAHDLGL
                     AVVTEGVESETDALQLRQMGCEYVQSFMFGQPTSHDEATRMIREQLDAAA"
     CDS             complement(175103..175723)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10171"
                     /product="acetyltransferase, GNAT family"
                     /db_xref="GOA:A0A1M4L9B6"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9B6"
                     /protein_id="SBW13367.1"
                     /translation="MIGLPFRRSNPTVLRGQRIYLRDPMMSDYASWASLREQSRAFLT
                     PWEPTWPDDDLTRSAFRYRIRHYQDESSAGTGYPFFIFRNSDNRIVGGITIGNIHRGV
                     GQNGVIGYWSGAPFAGKGYMTEALSLVIPFAFDQLRLHRLEAACIPHNVRSIRLLEKA
                     GFQREGLLRSYLKINGFWQDHLLLALIESDKRMTDRGVIIGKVERS"
     CDS             complement(175894..177186)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10172"
                     /product="peptidase M16 domain-containing protein"
                     /db_xref="GOA:A0A1M4L9A2"
                     /db_xref="InterPro:IPR001431"
                     /db_xref="InterPro:IPR007863"
                     /db_xref="InterPro:IPR011249"
                     /db_xref="InterPro:IPR011765"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9A2"
                     /protein_id="SBW13368.1"
                     /translation="MGVEVTRLPNGLTIATDTMPHVESVALGIWVKAGARNEAPDRHG
                     IAHLLEHMAFKGTENRTAWQIASDIENVGGEINAATSVETTSYYARVLRNDMPLAIDI
                     LSDILTASKFDEGELEREKQVIMQEIGAAHDTPDDIVFDRFTETAYRHQPIGRAILGE
                     PETVMSFTSDDLRQYMQEQYSADRMVVTAAGGIDHDEFVREVEKRLGSFRPHNTAPTL
                     DLAHYVGGDFRENRELMDAQVLIGFEGRAYHVRDFYASQLLSMILGGGMSSRLFQEVR
                     EKRGLCYSVYAFHWGFSDTGLFGIHAATGRDELVELVPVIIDELHKAADSIGIEEVDR
                     ARAQYRASLLMSQESAASRAGQIARQFLLYGRPVENSELLDRLSLITPERLTDLAGRL
                     FLNNKPTIAGVGPVGRLMSFDRLTDALSTNAHTRKIAV"
     CDS             complement(177240..178631)
                     /codon_start=1
                     /transl_table=11
                     /gene="thrC"
                     /locus_tag="BR10RB9215_C10173"
                     /product="threonine synthase"
                     /EC_number="4.2.3.1"
                     /db_xref="GOA:A0A1M4L9E4"
                     /db_xref="InterPro:IPR000634"
                     /db_xref="InterPro:IPR001926"
                     /db_xref="InterPro:IPR004450"
                     /db_xref="InterPro:IPR029144"
                     /db_xref="InterPro:IPR036052"
                     /db_xref="InterPro:IPR037158"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9E4"
                     /protein_id="SBW13369.1"
                     /translation="MKYVSTRGEAPVLGFSDALLAGLARDGGLYLPQEYPQFTAEQIR
                     ALRGKSYVEVALAVLTPFTGGEIPAADFERMVREAYGTFRHDAVCPLVQTDANEFVLE
                     LFHGPTLAFKDVAMQLLARMMDYVLAQRGERATIVGATSGDTGGAAIEAFGGRDNTDI
                     FILFPNGRVSPVQQRQMTSSGFSNVHALSIEGNFDDCQNLVKGMFNDLEFRDSLSLSG
                     VNSINWARIMPQVVYYFTAALSLGAPDRAVSFTVPTGNFGDIFAGYVAKRMGLPIEQL
                     IIATNDNDILSRTLESGAYEMRGVAQTTSPSMDIQISSNFERLLFEAHGRDAAAVRGL
                     MQGLKQSGGFTISEKPLSAIRREFSAGRSTVDETAATIESVLSKDGYLLDPHSAIGVK
                     VAREKASGTAPMVVLATAHPAKFPDAVKAACGVEPQLPAWLCDLMQRKESFTVLHNEL
                     KIVEEYVRRYSRA"
     CDS             178991..179569
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10174"
                     /product="lipoprotein, putative"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9I4"
                     /protein_id="SBW13370.1"
                     /translation="MQKASQNRSSLFPVFATVLLASLAGCTTSGTENGANSSLPTKAT
                     SGEKRISETELRAYCPSVSLRDGTAFFNTYEKGGDKDPERVIYQAALTDTTRSCQYGN
                     GTLTMDIAGAGKVVPGPKYKTGTIVMPIRVAIRQGDQVVYSKLHKQRVSITNPDTATQ
                     FVFNDKGVTIPMPDKQNVQIFIGFDEGPYNTK"
     CDS             179882..181516
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10175"
                     /product="EAL domain-containing protein"
                     /db_xref="InterPro:IPR001633"
                     /db_xref="InterPro:IPR024744"
                     /db_xref="InterPro:IPR035919"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9C2"
                     /protein_id="SBW13371.1"
                     /translation="MRFRRNSLISPVFLVLLLMLILGAVAGQLVGKGLRILEEERHMD
                     IYMTALRDYSSRLLASARNTLEAANNSPFEICSPQDLAYQRKLVFAAYHIKDIGRLRD
                     DQLICSTLLSDIKTQPRRSVANVNLKDGTYIYADDALITPGSHGPIVGRGNANVVLSS
                     VAFDLMHTPRYAFSIFATDEEKKHFALLYNYSGNAERGPELSSGDWAQKFVEAPDGKV
                     LRENSCDPDTGVCISLSATIDRTSTAARLKNLLAICLGALAGGSVGLGWLYYRNRDHS
                     LLYRLNKALAAGEPHLLYQPVVDMADGKVLGFEALIRWEIRKGDFVPPDVFVARAEEA
                     GIATKITIYVLERLIEDMGDTLRQRRDLRININITASDLQSPAFMSRMERCLATADIE
                     PQQVGLELTERTAVDFSKATDGIRRLREQGHRIYIDDFGTGYSSLAYLGELHVDAIKI
                     DKAFTRTVGNDYATVSIIPQIISMAKEHGLDIVVEGVETEAQALYFRKLGTPLAAQGW
                     FFGKPLCVADAQALVATVKKKQSRVKLARKTTQKAK"
     CDS             181648..181833
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10176"
                     /product="hypothetical protein"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9E8"
                     /protein_id="SBW13372.1"
                     /translation="MKQKFERILEPTDTWAIFDTTADVPAMMGTRLLIGLTEEEAEEL
                     LAILNAPPKGRNKRSAA"
     CDS             complement(181874..182560)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10177"
                     /product="HAD superfamily hydrolase"
                     /db_xref="GOA:A0A1M4L9G3"
                     /db_xref="InterPro:IPR006439"
                     /db_xref="InterPro:IPR023198"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR036412"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9G3"
                     /protein_id="SBW13373.1"
                     /translation="MAAPSLIIFDCDGVLVDSEIIAAEVESALLTESGYPIAADEMAE
                     RFAGLTWQDILLTVEREAGIPLSASLLDKSERILDEKLKNEVNAVEDIVEVVSALRLP
                     KCICSNSTSLRLENMLKRVGLYDLFAPNIFSAKEVGSGKTKPAPDVFLHAARHFGVDP
                     ANVLVIEDSVHGVHGARAAGMRVIGFTGGAHTYPGHADKLTDAGAETVIHRHKDLQSV
                     IDALSIWTDA"
     CDS             complement(182721..184511)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10178"
                     /product="voltage gated chloride channel family protein"
                     /db_xref="GOA:A0A1M4L9K4"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="InterPro:IPR001807"
                     /db_xref="InterPro:IPR014743"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9K4"
                     /protein_id="SBW13374.1"
                     /translation="MNFAELRHNRYLRVLFVPFRTRALVRGSEIGIVIAGALIGILSG
                     LAVAAIGSISQWMHQAIFGLQQGERLSAAIQLYPSAFIAPMAGGILMGVLIWVLARWR
                     KRPIVDPIEANALHGGRLSLTDSFILVGQNLISNGFGASVGLEAAYTQLASGFASRIG
                     RALKLRRADMRTLVGCGAAAAIASAFNAPLTGSFYAFELIIGVYSIATLAPVVVAAII
                     GTLVTQAIGGAPFIIDIGLIDDITPRDYVPALMLGFISAGIAILIMRGVTLVEKVARR
                     SVVPNVLAPAIGGAIVGMIAFFSPQVLASGHGALHLDLNANITIPVLVLLILTKSLAS
                     AVSIGSGFRGGLFFASLFLGALTGKLFAAIAGTIMPASLALAPEVYAVIGMSSLAVAV
                     VGGPMTMTFLALEMTGDFPISMLVLGAVVSSSLMVRKTFGYSFATWRFHLRGEAIRSA
                     HDIGWIRDLTVARMMRHDVRTVAIDTDIETFRHDFPLGSTQRVIAVDSEGRYVGMIPV
                     PEAYGDSFDTADKTHSIAELLKYQDEFLLPQMNAKEAVARFDRAESEALAVIDNAQDR
                     KVLGLLSEAHTLRRYSEELDRRRREVAGEV"
     CDS             184821..185981
                     /codon_start=1
                     /transl_table=11
                     /gene="babI"
                     /locus_tag="BR10RB9215_C10179"
                     /product="modification methylase BabI"
                     /EC_number="2.1.1.72"
                     /db_xref="GOA:A0A1M4L996"
                     /db_xref="InterPro:IPR001091"
                     /db_xref="InterPro:IPR002052"
                     /db_xref="InterPro:IPR002941"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L996"
                     /protein_id="SBW13375.1"
                     /translation="MRSQVIEYSMSLVRLAHELPIEAPRTAWLDSIIKGDCVSALERL
                     PDHSVDVIFADPPYNLQLGGDLHRPDQSMVSAVDDHWDQFESFQAYDAFTRAWLLACR
                     RVLKPNGTIWVIGSYHNIFRVGTQLQDLGFWLLNDIVWRKTNPMPNFRGRRFQNAHET
                     LIWASRDQKGKGYTFNYEAMKAANDDVQMRSDWLFPICTGSERLKDENGDKVHPTQKP
                     EALLARIMMASSKPGDVILDPFFGSGTTGAVAKRLGRHFVGIEREQPYIDAATARINA
                     VEPLGKAELTVMTGKRAEPRVAFTSVMEAGLLRPGTVLCDERRRFAAIVRADGTLTAN
                     GEAGSIHRIGARVQGFDACNGWTFWHFEENGVLKPIDALRKIIREQMAAAGA"
     CDS             complement(186064..186681)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10180"
                     /product="hydrolase, haloacid dehalogenase-like family"
                     /db_xref="GOA:A0A1M4L9C7"
                     /db_xref="InterPro:IPR006439"
                     /db_xref="InterPro:IPR023198"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR036412"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9C7"
                     /protein_id="SBW13376.1"
                     /translation="MNSSPVKHVVFDIGKVLIHYDPELAFLDIIPDAGDRRWFLENIC
                     TSAWNIEQDRGRSWQEAEALLLESHPQHHDHIRAFRRNWSRMVPHAYDDSVEILRGLI
                     AAGHDVTMLTNFASDTFREAQARFPFLTESRGVTVSGDIRLIKPDQAIYDHHVASFGL
                     DPAATLFIDDTLHNVEGAREAGWQAVHFTSAAKLADDLRARQLSF"
     CDS             complement(186678..187754)
                     /codon_start=1
                     /transl_table=11
                     /gene="mutY"
                     /locus_tag="BR10RB9215_C10181"
                     /product="A/G-specific adenine glycosylase"
                     /EC_number="3.2.2.-"
                     /db_xref="GOA:A0A1M4L9D0"
                     /db_xref="InterPro:IPR003265"
                     /db_xref="InterPro:IPR003651"
                     /db_xref="InterPro:IPR004035"
                     /db_xref="InterPro:IPR005760"
                     /db_xref="InterPro:IPR011257"
                     /db_xref="InterPro:IPR015797"
                     /db_xref="InterPro:IPR023170"
                     /db_xref="InterPro:IPR029119"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9D0"
                     /protein_id="SBW13377.1"
                     /translation="MDPTTFLLRWYDRHHRVLPWRVTPVDAAKGDVADPYRVWLSEIM
                     LQQTTVEAVKSYFLRFVERWPTVRAMAKASEDDILRAWAGLGYYSRARNLKKCADIVV
                     AEHGGEFPKSAAGLKELPGIGDYTSAAIAAIAFGEQVAVVDGNVERVISRLYAIDTPL
                     PAAKAQIRALMGQMTPPDRPGDFAQAMMDLGATICTPRRPACALCPLNEGCIALSERD
                     PEDFPVKAPKAEKPVRTGAAFIAIAGDGSVYLRKRKGEGLLAGMTEVPGSGWTARIDG
                     DATVHAAPFSAAWIPSGTITHVFTHFELRLSVYRASNVRKQAANEGWWSKPEELSGEA
                     LPTVMKKAITAAIPDAFKRGRKSR"
     CDS             complement(187720..187866)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10182"
                     /product="hypothetical protein"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9B2"
                     /protein_id="SBW13378.1"
                     /translation="MAYRTDEGDTRTSKSAFDLYYESHSFNESAWIRIKQAYGSHNFS
                     SALV"
     CDS             188027..188554
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10183"
                     /product="hypothetical protein"
                     /db_xref="InterPro:IPR007922"
                     /db_xref="InterPro:IPR010593"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9F4"
                     /protein_id="SBW13379.1"
                     /translation="MSEPNPKRGFRPLADMASGLVDPVLRKRAGINLALLQAWEDIVG
                     PAIGASSRPLRILWPRRIREDDPFTPATLVIACEGFAALQIQHETGEIISRVNGFLGF
                     AAIGRIRIEQKPPVIAVKRRVKRLAPLGPAEERSVDKATAGIEDDALRQALARLGRNI
                     LAEKRMRDKKGSSKN"
     CDS             188792..189445
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10184"
                     /product="twin-arginine translocation signal domain
                     protein"
                     /db_xref="GOA:A0A1M4L9J4"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="InterPro:IPR036249"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9J4"
                     /protein_id="SBW13380.1"
                     /translation="MPVALNRRHVISLAGAAAAGLAFTRGANAQQHAPEGIVDAIEIA
                     KPGKLKDMVYGKADAPVTIVEYASLTCPHCADFKLVTFPKIKEKYIDTGKARLIFRDF
                     PFDPRATAAVMLARCAPEDHYFPMIDLFFRQQQQWATAEDGKAALLQIAKLAGFTQES
                     FEACLTNQQLLDDVRATVERGSKEFGVNATPTFFINGKKYAGDLSFEEMSGFIDSAL"
     CDS             189524..192982
                     /codon_start=1
                     /transl_table=11
                     /gene="smc"
                     /locus_tag="BR10RB9215_C10185"
                     /product="chromosome segregation protein SMC"
                     /db_xref="GOA:A0A1M4L9D4"
                     /db_xref="InterPro:IPR003395"
                     /db_xref="InterPro:IPR010935"
                     /db_xref="InterPro:IPR011890"
                     /db_xref="InterPro:IPR024704"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR036277"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9D4"
                     /protein_id="SBW13381.1"
                     /translation="MRFSKLRLVGFKSFVEPMEFVIEGGLTGVVGPNGCGKSNLVEAL
                     RWVMGENSYKNMRASGMDDVIFSGSATRPARNTAEVTLFLDNSDRTAPPAYNDADELQ
                     VSRRIEREAGSLYRINGKEARAKDVQLLFADQSTGARSPSMVGQGRIGELIQAKPQAR
                     RALLEEAAGISGLHTRRHEAELRLRAAETNLERLDDVVGELGSQIESLKRQARQANRF
                     KSLSADIRRAEAALLHLRWSVAKGQEAEAQSALSQATATVGDMAEAQMKAARDQAVGA
                     HKLPELREAEAGAAAALQRLSIARTQLDEEGERIRARRAELMKRLEQLTADIAREEQM
                     LRENADILARLDEEEQELAASSEASGERNEELRALFEEAEIRLQDSESALARLTAERA
                     EAAAERAQVERALKEAQDRRDRLAVQMENIERDIAAVVGQIGGLFDPAEKRIVVDACT
                     QALEAAEEAVVAAEELVAHAREAEAASRQPLSEARTELNRIETEAQTLARILNAGETG
                     QFPPVVEELRVEKGYEVALGAALGEDLDAASDENAPVYWAYNPAAETDPALPEGAMPL
                     DRLVDGPQQLRRRLAQVGVVSEADGRRLQAGLRPGQRLVSKTGALWRWDGYTASADAP
                     TPAAQRLAQKNRLAELEQDAIGARRRVEDAGQAVERVEAAVRKAVEDERVARDQWRAN
                     QRKLDEAREALAAAERAAGELATRRSALDESRARLEENLEEAQIRVAEAGDRLGEMPD
                     MDAIAQRLSALTSEVQSDRTALAEARAAYEGLRREADARLRRLEMIALERRNWISRAE
                     NADRQIAALNDRRAETAEEAEVLAEAPDEIENRRRALLNELSLAEERRRAAADILAEA
                     ETRQAELDKAATLAIQHLAASREQRARAEERLTAAQERRKDAEARIFEALNCPPHEAI
                     RHAGLKPEDAMPDPDQLERQLERLKIERERLGAVNLRAEEESRELSDRLDALISERED
                     VIEAIKKLRQAIQSLNREGRERLLAAFDVVNAQFQRLFTHLFGGGTAELQLIESDDPL
                     EAGLEILARPPGKKPQTMTLLSGGEQALTAMALIFAVFLTNPAPICVLDEVDAPLDDH
                     NVERYCNLMDEMAASTETRFVVITHNPITMARMNRLFGVTMGEQGVSQLVSVDLQTAE
                     QLREAS"
     CDS             193005..193898
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10186"
                     /product="cation diffusion facilitator family transporter"
                     /db_xref="GOA:A0A1M4L9F9"
                     /db_xref="InterPro:IPR002524"
                     /db_xref="InterPro:IPR027469"
                     /db_xref="InterPro:IPR036837"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9F9"
                     /protein_id="SBW13382.1"
                     /translation="MGADHEHADVKNTPISRLWIAFGLTGIFMIAEVIGSFVTGSLAL
                     LSDAMHMATDTFALLLALIAIYLGRRPADVLRTYGYARFEILAAAFNALLLLGVAFYI
                     LYEAWERLSEPADVQSLGMLAVAIVGLVMNFISMRILTVHKDDSLNVKGAYLEVWADM
                     LGSVGVIAAAIIIYLTGWEWVDSAIAVGIGFMVFPRTWVLLKECINILLEGVPAGVDV
                     KKLEAAILAVPGVASVHDLHVWSLTKTEHSLTAHLVLAQEADGETVRRAVEHVLQNDY
                     DLHHTTLQTEKVTCAPKELIH"
     CDS             complement(194007..194348)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10187"
                     /product="glyoxalase"
                     /db_xref="InterPro:IPR029068"
                     /db_xref="InterPro:IPR037523"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9H5"
                     /protein_id="SBW13383.1"
                     /translation="MRITGKLDYLEMPALNGSLDATKNFYARAFGWAFTDYGPTYSAF
                     AEGLDGGFDAQSSTAKPLPVLFAANLDEALDAVTDAGGTVVKPIFTFPGGRRFHFTDP
                     AGNELAVWSDK"
     CDS             194611..197274
                     /codon_start=1
                     /transl_table=11
                     /gene="ppdK"
                     /locus_tag="BR10RB9215_C10188"
                     /product="pyruvate phosphate dikinase"
                     /EC_number="2.7.9.1"
                     /db_xref="GOA:A0A1M4L9L5"
                     /db_xref="InterPro:IPR000121"
                     /db_xref="InterPro:IPR002192"
                     /db_xref="InterPro:IPR008279"
                     /db_xref="InterPro:IPR010121"
                     /db_xref="InterPro:IPR013815"
                     /db_xref="InterPro:IPR015813"
                     /db_xref="InterPro:IPR018274"
                     /db_xref="InterPro:IPR023151"
                     /db_xref="InterPro:IPR036637"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9L5"
                     /protein_id="SBW13384.1"
                     /translation="MAKWVYTFGDGKAEGAASDRNLLGGKGANLAEMSSLGLPVPPGF
                     TITTEVCTYYYNNDRVYPPELDAQVQAALAHIATLTGRNFGDAEKPLLVSVRSGARAS
                     MPGMMDTVLNLGLNDETVQAIARESGDERFAYDSYRRFIQMYSDVVLGVDHGFFEEIL
                     EDTKADLGVEVDTALSADDWKNVIGLYKAKVEEELGQPFPQDPREQLWGAIGAVFSSW
                     MNARAITYRRLHNIPAAWGTAVNVQAMVFGNMGETSATGVAFTRNPSTGENKLYGEFL
                     VNAQGEDVVAGIRTPQNITEEARIAAGSDKPSLEKVMPEAFAEFLKVANRLEQHYRDM
                     QDLEFTIERGKLWMLQTRSGKRTARAALKMAVEMAAEGLISEEEAVLRIDPAALDQLL
                     HPTIDPRAERQVVGMGLPASPGAATGEIVFSSEEAEQAKAEGRNVILVRIETSPEDIH
                     GMHAAEGILTTRGGMTSHAAVVARGMGKPCVSGAGSLRVDYRNGTMLAAGQTFRKGDV
                     ITIDGASGQVLKGSVAMLQPELSGDFGKLMEWADRARRMKVRANAETPADARTARSFG
                     AEGIGLCRTEHMFFDGSRIVAMREMILSDTEEGRRLALAKLLPMQRSDFAELFEIMKG
                     LPVTIRLLDPPLHEFLPHTDEEVDEVARSMGVDAAKLRDRADALHEFNPMLGHRGCRL
                     AVSYPEIAEMQARAIFEAAVEAGKKTGEPVVPEVMVPLVGLKAELDFVKARIDAVAKE
                     VMSEAGIKIDYMVGTMIELPRAALRAAEIAESAEFFSFGTNDLTQTTFGISRDDAAGF
                     LTAYQNRGVIEQDPFVSLDVDGVGELVQIAAERGRKTREKIKLGICGEHGGDPASIAF
                     CEKTGLDYVSCSPFRVPIARLAAAQAAVRKV"
     CDS             197505..198182
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10189"
                     /product="polysaccharide deacetylase"
                     /db_xref="GOA:A0A1M4L9B0"
                     /db_xref="InterPro:IPR002509"
                     /db_xref="InterPro:IPR011330"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9B0"
                     /protein_id="SBW13385.1"
                     /translation="MFQKFSAAGAALLFTVGIACANDMASKEHGSETVTIVEPQLHIK
                     PGGAAAPQVALTLDACMGKTDHRILDVLVKDRIPATIFVTGRWIKQNAEAVAVLKAHP
                     DLFDVENHGAMHVPAITNMPLMYGIKTAGSLDAVRKEIEGGAEAITAEGMPKPLWYRD
                     ATARYSTDAVQLATSMGYKIAGYSLNGDMGASLPAETVERRIAGAHDGDVIISHINQP
                     ARSSGEG"
     CDS             198215..198328
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10190"
                     /product="hypothetical protein"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9D9"
                     /protein_id="SBW13386.1"
                     /translation="MKFVRLKDVQTTMELNPVPEHDLPVNTAAQKKQETVK"
     CDS             complement(198650..199054)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10191"
                     /product="hypothetical protein"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9E0"
                     /protein_id="SBW13387.1"
                     /translation="MDRVLSHGPAPTSVTEAPEQDAMTLEAVELEFALGAIDVLTEGF
                     DAALAKAAERVGGEVLFNMPALDTSEAQRIGAIAISGQPQDQVIFVTLRNDGTTLSLA
                     PLTGHNALFESLGRNYAAVMKILSPQQAANES"
     CDS             199405..200193
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10192"
                     /product="hypothetical protein"
                     /db_xref="GOA:A0A1M4L9C3"
                     /db_xref="InterPro:IPR010865"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9C3"
                     /protein_id="SBW13388.1"
                     /translation="MRKLRYQRRQSRSAVWALRFGVFAALLLAIAFLLHRFWRLETPD
                     FVLVAILSGALALLALICAAKGFRNLWVNGDKGGARSFWGSVFALVVMVPLALVGALW
                     YGSPPFYDVSTDFETPPQFTDNMPARLQWMNPLTERVNGDPLAQLSAYPDVVGRRYEA
                     APDRVMQGVDTTLKAFGWTVIARDVATPEQNAIRFAATAHSFILGLKSDIVIRLLDEG
                     ETTYVDMRSLSRYGKRDMGLNAGFITEFLGALEGEVNKAPADVE"
     CDS             complement(200194..201099)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10193"
                     /product="hydroxyacylglutathione hydrolase"
                     /EC_number="3.1.2.6"
                     /db_xref="GOA:A0A1M4L9G4"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="InterPro:IPR036866"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9G4"
                     /protein_id="SBW13389.1"
                     /translation="MALVFDNNFTPEYGKPVTLGKGIVRLTANNPSAFTFHGTNSYIV
                     GTDTLAIIDPGPENEAHYRALLETVAGRPVSHIFVSHTHRDHSPLAQRLKEELGALTV
                     AEGPHRPARPYHADEVNLLEASADTDFRPDILLADGATVDGDGWALEGIHTPGHTANH
                     MAFALKGTDILFSADHVMAWATPVVAPPDGSMSDYMASLEKLLARDDAAYLPGHGGAV
                     TKPAAFVRGLRAHRKMRERAILERIVQGDRTIRDMVKVIYRDTDPRLHGAAALSVLAH
                     LEDLVGRGEIITEGDPSLNGIYQPA"
     CDS             201300..201899
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10194"
                     /product="BioY protein"
                     /db_xref="GOA:A0A1M4L9K2"
                     /db_xref="InterPro:IPR003784"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9K2"
                     /protein_id="SBW13390.1"
                     /translation="MPQRAKSRVAAAALIADYLPLGQLSRAFWFVSLALIGTAILTLS
                     AKIKVDLVYVNVTMQTFAVFAIAALYGSRLAVATVALYLLEGALGMPVFTGTPEKGIG
                     LAYMVGPTGGYLLSYLAAAWIVGRAADKGLARNPFALGGVMLLAEAVILVMGAGWMAY
                     LFGFEKGIAFGFGIFIVGDLVKLALAAFGVPAVTALVKR"
     CDS             202053..202562
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10195"
                     /product="ureidoglycolate hydrolase"
                     /db_xref="GOA:A0A1M4L9E5"
                     /db_xref="InterPro:IPR007247"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR023525"
                     /db_xref="InterPro:IPR024060"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9E5"
                     /protein_id="SBW13391.1"
                     /translation="MQVETLTVEPLTKEAFAPFGDVIEVEGAQLRLINNGTTERYHDL
                     ARVEAAGTQARVLINIFRGQSFAAPIDIVMMERHPFGSQAFIPLNGRPFLVVVAEDAG
                     ARPARPRAFLARGDQGVNYLRNIWHHPLLALEQKSDFLVVDRAGREDNLEEYFFSDRA
                     YRIETTQTA"
     CDS             202574..202930
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10196"
                     /product="transthyretin family protein"
                     /db_xref="GOA:A0A1M4L9G6"
                     /db_xref="InterPro:IPR000895"
                     /db_xref="InterPro:IPR014306"
                     /db_xref="InterPro:IPR023416"
                     /db_xref="InterPro:IPR023418"
                     /db_xref="InterPro:IPR023419"
                     /db_xref="InterPro:IPR036817"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9G6"
                     /protein_id="SBW13392.1"
                     /translation="MGKLSTHVLDTAHGTPAAAMRVELYRIAASGTAELLKRVVTNLD
                     GRTDAPLLSGDEMRTGIYELQFHVAEYFEGRGAELAHEPFLDLIPIRFGIADEDGNYH
                     VPLLVSPWSYSTYRGS"
     CDS             203001..203837
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10197"
                     /product="hypothetical protein"
                     /db_xref="InterPro:IPR021251"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9I6"
                     /protein_id="SBW13393.1"
                     /translation="MDETPNLKLPYILPSQAQKHVTHNEALRMLDAIVHLGVKSRSLA
                     DAPSSPAEGDRYIVAAQASGSWAGKDGMVASFIDGGWLFVIPATGWLAYVADEALLLV
                     FNGSLWKNPSSVPDELSLSMLGVQATPDAVNRFALSSDASLFNNAGAGHQVKVNKQAA
                     SDTASLLFQTNWTGYAEMGLNGSNDFSVKVGDEGGNWREALRVDRATGNVAIGSNWPK
                     TRLDVDGPIRPASYSVAALPSAVSHGAGAMIFVTDSGTGAEMAYSDGNAWRSMRSGSL
                     IS"
     CDS             204375..206243
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10198"
                     /product="UDP-glucose 4-epimerase"
                     /db_xref="GOA:A0A1M4L9M7"
                     /db_xref="InterPro:IPR003869"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9M7"
                     /protein_id="SBW13394.1"
                     /translation="MSLKYPWQRLALLPRISKQIILVLSDCLLLLASAYLAFVVRFGF
                     VFVPNLAQLFLILIAPLLAIPVFIRFGLYRAIIRYLAERAIWSIFQATAVAALFWVAL
                     VFLMELYGSTGLPRSVPLLYWLLSTVFISASRFGAKWLLRTAEQDKRYTSSALIIGIG
                     EPARQLATALRSHSDTQVVGFIDPAGQLAGMDIIGLRVYRTEEIPGLIENYGIKQVVV
                     SEPALEQKERQEFARLLGRLPVNTRILPPIADLTAGKYLVSALRNVEIDDLLGRSPVP
                     PDTTLLREVVEGRRIMITGAGGSIGSQLCLTIAQWNPAAIVLFESSEFALYQIDRQLR
                     QFASCTVVPVLGSVRDRACVEKTIRDHSIDTVYHCAAYKHVPLVERNPLVGIFNNVFG
                     TLEVAEAALNTGVERMVLISSDKAVRPTNVMGATKRWAELVVYYYGRLAEQAGKKKAF
                     YSVRFGNVLGSNGSVVPLFREQIANGGPVTLTHEDMTRYFMSIKEAAELIVQSGAIAQ
                     SGDTVLLEMGEPVKIRDLAENMILLAGLTVRNEENPQGDIAIEVTGIREGEKMYEELF
                     YDPSLAQRTRHPKIMRAPQGSKAVIDIQESLAVLRTAMEKEDIEMVRKVLFEVIAS"
     CDS             complement(206230..207237)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10199"
                     /product="glycosyl transferase, group 4 family protein"
                     /db_xref="GOA:A0A1M4L9B8"
                     /db_xref="InterPro:IPR000715"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9B8"
                     /protein_id="SBW13395.1"
                     /translation="MRFLLVSFFVSALLCGIGLFLLSYLLPANFLAARMSSRSNHSIA
                     ARQIGGLALIPAILVTLAIFAPDLEVNMQLFLCLSGASLLLWVVGGLDDRYELSEIIR
                     LGSQLLAAITVLYGLGPDFRLLPNLLPYWLEATLIVFALVIAINVTNFMDGLDLMTVA
                     GLGVPLVGIALLGTLGLAGLTSSGIGAVAAGGLLGFALFNRPPASIFLGDSGSPPLGL
                     IAGTALLLLARETHIVVALVLPLYYILDAGTTIVMRAAQGENILKAHSKHAYQIAKRS
                     GWSVPKVVAHVALLNAILIACVVALLALDHPLAQLAFLLVAAVATLILLLDFRGRFRK
                     L"
     tRNA            207616..207689
                     /locus_tag="BR10RB9215_C10200"
                     /product="tRNA-Gln"
                     /anticodon=(pos:207647..207649,aa:Gln,seq:ttg)
     CDS             complement(208131..208499)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10201"
                     /product="hypothetical protein"
                     /db_xref="InterPro:IPR025948"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9E9"
                     /protein_id="SBW13396.1"
                     /translation="MVLEHEAEHALWWAAVSSIAAKTDCPAHTLIAMKVEIRRVFNEN
                     FQAYGVCKVRRQLLREGYDIARGTVARLMRDIGLQGIIRGKPVKTTASDKAAPCPLDR
                     VTGTSMHRHQTCSGFLILRM"
     CDS             208774..209625
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10202"
                     /product="putative membrane protein"
                     /db_xref="GOA:A0A1M4L9F0"
                     /db_xref="InterPro:IPR000412"
                     /db_xref="InterPro:IPR013525"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9F0"
                     /protein_id="SBW13397.1"
                     /translation="MSIEISRSDISHKIVAAEPTKGAKVAFADISESLSKYRLALIFG
                     WQDVAQRYRRSRVGAFWLTLNMAVFIGALGLIFGTLFQSEMREFLPYLCAGIITWGFI
                     STCLNEGCTTFTSSDGIILQVRMPLFTHVMRAVWRNIIIFAHNIVIFPILLIIMGRMI
                     TLNALWVIPGYILLCLNLSWMMLILAVLCARFRDMTQVVTNILQVLFYATPIMWMVKI
                     LPDHVSRAFIEWNPFYHFIELVRAPLFGSPPSLLDWTFGIVCAIIGWCVAILFFGRYR
                     WRVAYWL"
     CDS             209629..210390
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10203"
                     /product="ABC transporter-like protein"
                     /db_xref="GOA:A0A1M4L9D2"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9D2"
                     /protein_id="SBW13398.1"
                     /translation="MSLIQLKNVSVEFPIYNSTSRSLKNRVLSIATGGKIERRSDRLV
                     IVRGLDNVSMTFKDGDRVGLIGHNGSGKTTLLRVLSGIYTPTHGSSVINGDCVSLINI
                     NLGIDPDATGRENIRLRSAMMGMSPEEIAEKFDQIADFSGLGEFLDVPFRTYSSGMQL
                     RLAFATSTAVRPEILIMDEWLSTGDEDFKERANARMRDLVDSTKILILASHSKELMEK
                     NCNRVVWLEHGRVKMDGVPDEVLPAYFGAKVLSEE"
     CDS             210639..212315
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10204"
                     /product="hypothetical protein"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9H4"
                     /protein_id="SBW13399.1"
                     /translation="MSKLSSRFRQLINAMRYLGRGDFSGFSSRLKWYGREYSHVRLRK
                     RLANANGTVWGILCTPHTLFIAQTIAERLAYHGIESEIVNGSIKSFNHDFYIVLCAQM
                     FKRLPPASKRVIFQLEQSVSSRWFTQEYMKVLNDSFGVLEYSLTNIEFLAKNGIKYPK
                     VHYLPIGALSETANSEAKVEKKYDFIFYGDSLSSERRRKFIEHIKGTYSIKICNDLFG
                     SDLYTVIREAKAVINIHYYEDALLEMPRICECISLGVPVLSEGTADQNEYPELDGAVR
                     FFDQGSIDSMMTCASEMLNNLEVMDKTIGNAISASSARFQFMMDRFLVAIGVVPADII
                     LNDPIYLARKGDFYALSLPETIDRRRGIARSLPNGCELFDGIRHSMGWIGCGCSFNAL
                     SRYALTNNLSRLTVIEDDVALPSDFDSILSEVNEYLDTRMQNWDIFSGLMADIHPSAK
                     ILAVDEVAGRIYVTIDKMTSTVFNIYNESALEIISQWDPLDTNAVTNTIDRYLERRAG
                     LRVIVALPFIAGHKEDATSTLWGFDNERYTPMIAEAQRKIEVMVRDWRRQ"
     CDS             212625..213581
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10205"
                     /product="ISBm3 transposase, programmed frameshift"
                     /db_xref="GOA:A0A1M4L9L2"
                     /db_xref="InterPro:IPR001584"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR024967"
                     /db_xref="InterPro:IPR036397"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9L2"
                     /protein_id="SBW13400.1"
                     /translation="MNIHKNARLTPLRREEMAVAVLGGRLTKAQAARLYGVSLKIVSR
                     WTERFRISGRAAMTDRSSRPTCSPRQMGQDIVERILYLRIQRLTGKHIAMETGVSPAT
                     VSRILRRAKLSRMKDIDPVEPVIRYEYAEPGGLIHLDIKRLGRFERVGHRITGNRTGQ
                     SNARGVGWEYVHVCIDDASRIAFTDIFPDEKAISAIAFLKAAVAYYACLGVSVTRVMT
                     DNGACYIAKEFDKACKALDLKHNRTKPYTPKTNGKAERFIQTALREWAYAGAYPSSQI
                     RKVHLPNSTHMYNWHRPHGGLKSKTPISRLGLNRDNLLTLHI"
     CDS             213651..214154
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10206"
                     /product="transposase"
                     /db_xref="InterPro:IPR025161"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9F8"
                     /protein_id="SBW13401.1"
                     /translation="MSRRSLTDEQWNRIEAYLPGRVGTPGRSGVDNRLFVDAILWMAA
                     NAAHWRDLPATFGKWTAVHARFRRWSHAGVWERLFHALADTPDFEYVLIDSTISKVHA
                     DAAGAKGGGFGLPLQITPSPGHYGDCPQASSLLSGLKGVGHVIADAAYDADHLRAFIA
                     SDLKATA"
     CDS             complement(214485..215318)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10207"
                     /product="hypothetical protein"
                     /db_xref="InterPro:IPR001173"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9H2"
                     /protein_id="SBW13402.1"
                     /translation="MTYSVSAADSQISKQPLLTISIVTFNPDFDELKKTLDSLKTALN
                     EFARETFSITIVDNSFSNEAALFLQHYPTLPIKLIQGQGNIGFGRAHNLAMQQMGEFH
                     LILNPDIQLSPDAIKNAISFMRANERCGLLSPYATWPNGQRQYLCKRYPAVFDLILRG
                     FAPRIIRSFFSIRLARYELQAETQTDIYWNPPIVSGCFMFFRSSTLKKTGGFNDRFFL
                     YFEDFDLSLRSRKITNIAYVPTVRVIHAGGYASKKGSWHIKVFIHSAMTFYKIHGLKL
                     F"
     CDS             215440..216321
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10208"
                     /product="hypothetical protein"
                     /db_xref="GOA:A0A1M4L9J6"
                     /db_xref="InterPro:IPR005835"
                     /db_xref="InterPro:IPR005907"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9J6"
                     /protein_id="SBW13403.1"
                     /translation="MKGIILAGGSGTRLYPLTIAVSKQILPIYDKPMIYYPLSVLMLA
                     GIRDILIISTPYDLPLFQKLLGDGHEFGVSFSYAEQAHPNGLAEAFIIGREFIGNDSV
                     AMILGDNIYFGDGLSNLSQLSSQPIKGGTVFAYRVDDPERYGVVEFDSKTGQAISIEE
                     KPERPKSHWAVTGLYFYDNQVVDIARSIKPSARGELEITTVNNIYLERGELNVQRFGR
                     GYAWLDTGTHDSLHEASSFVRTIEKRQGIKIACPEEIGLDKGWLSSEAVLERAAKLGK
                     TEYAAYLRRRVEELGKD"
     CDS             216321..216872
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10209"
                     /product="hypothetical protein"
                     /db_xref="GOA:A0A1M4L9N6"
                     /db_xref="InterPro:IPR000888"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9N6"
                     /protein_id="SBW13404.1"
                     /translation="MQVRPLGLDGVFEISPRKFGDDRGFFSETHNAKSFAEAGIDLTF
                     VQDNHSYSAAKGIVRGLHYQLPPFAQDKLVRVTRGAILDVAVDIRKSSPTFGKWVALE
                     VSADKWNQILVPKGFAHGFMTLVENTEVIYKVTDYYSPEHDRSIRFDDPAIGIDWPVA
                     SSDVQLSDKDQKAPLFADAEVFA"
     CDS             216881..217957
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10210"
                     /product="UDP-glucose 4-epimerase"
                     /db_xref="GOA:A0A1M4L9C6"
                     /db_xref="InterPro:IPR005888"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9C6"
                     /protein_id="SBW13405.1"
                     /translation="MNILVTGGAGFIGSAVCRHLASDPKINVVNLDKLTYAGNLASLR
                     QIENHPNYSFLQADICDDATVLDALRANEIDVVMHLAAESHVDRSIDGPAAFIETNIV
                     GTFRLLNAALAYWRELPEPRKSRFRFHHISTDEVFGDLPFDSGIFTEETPYQPSSPYS
                     ASKAASDHLVRAWHETYGLPVVLTNCSNNYGPFHFPEKLIPLVILNALDEKPLPVYGA
                     GANVRDWLYVEDHARALALVATTGKLGESYNIGGRAERTNLNVVETICSILDKKRPRA
                     NGKSYADLITFVTDRPGHDRRYAIDASKIERELGWKPQESFETGLEKTIQWYLDNAWW
                     WEPIRSGTYAGERLGSASVKEVKA"
     CDS             217954..218832
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10211"
                     /product="NADH dehydrogenase (ubiquinone)"
                     /db_xref="GOA:A0A1M4L9F6"
                     /db_xref="InterPro:IPR005913"
                     /db_xref="InterPro:IPR029903"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9F6"
                     /protein_id="SBW13406.1"
                     /translation="MKILVTGREGQVVQSLLEKASQRADLEVIALGRPELDLTNPDTV
                     RGAIEAIKPDLVVSAAAYTAVDLAEDERELAFAVNAIGAKAVAEAAKNCGVPVIHLST
                     DYVFAGDADEPYAETDVTGPRSVYGRSKLEGERLVAHANPRHIILRTAWVYSPFGKNF
                     VKTMLKLAETRDALSVVSDQWGNPTSALDIADAIIQVADHLAATPDFSAYGVYHLVGA
                     GDTNWSGFARAIFDESARLGGPTAAVTDIATADYPTKAARPMNSRLSTKKFQAAFGWS
                     PSYWEASLALVMKRLL"
     CDS             218986..219174
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10212"
                     /product="hypothetical protein"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9G0"
                     /protein_id="SBW13407.1"
                     /translation="MKQVRKRANMLHDPSHYVLQCLDHFDNIDIYGAHIIRVTDKAFD
                     DFASGGTDEAANRRMLGL"
     CDS             219182..220354
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10213"
                     /product="Gfo/Idh/MocA family oxidoreductase"
                     /db_xref="GOA:A0A1M4L9E2"
                     /db_xref="InterPro:IPR000683"
                     /db_xref="InterPro:IPR004104"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9E2"
                     /protein_id="SBW13408.1"
                     /translation="MTIEAKIKETAAARIRLGMVGGGAGAFIGGVHRMAARLDNRFDL
                     VAGALSSSPERAQASGRELGLAEDRIYSSYKDMAIREARLKNGIEAVSIVTPNHVHYD
                     AAKEFLRRGIHVICDKPLTSTLADAKKLKKAADDSGALFILTHNYTGYPMVRQAREMI
                     ANGDLGDLRVVQVEYAQDWLTEAVEATGAKGAVWRTDPAQSGLGGATGDIGTHAFNLA
                     SFVTGLTLDSLAADLDSFVEGRRLDDNAHVMLRFAGGAKGMLWCSQVAPGNENALRLR
                     VYGTKGGIEWAQEDPNRLWFTPFGEQKRLITRGGAGVGPAATRVTRVPAGHPEGYLEA
                     FATIYSEAANAIEAHRNGKKPDSAVVYPTVDDGLKGVAFIDACVRSSRKNGGWVKL"
     CDS             complement(220396..221703)
                     /codon_start=1
                     /transl_table=11
                     /gene="xylA"
                     /locus_tag="BR10RB9215_C10214"
                     /product="xylose isomerase"
                     /EC_number="5.3.1.5"
                     /db_xref="GOA:A0A1M4L9I2"
                     /db_xref="InterPro:IPR001998"
                     /db_xref="InterPro:IPR013452"
                     /db_xref="InterPro:IPR036237"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9I2"
                     /protein_id="SBW13409.1"
                     /translation="MSTGFFGDIQKVRYEGPESDNPLAFRHYNADEIVLGKRMEDHLR
                     FAVAYWHSFAWEGGDPFGGRTFDRPWFSNEIDAAKLKADVAFEFFSLLGAPYYCFHDA
                     DVRPEGRNFAENTRYLNEIVDIFEKKQAETGMKLLWGTANLFSNRRYMAGAATNPDPD
                     VFAFAAATVKTCIDATKRLGGENYVLWGGREGYETLLNTDLSRELDHMGRFLSLVVEY
                     KHKIGFKGTILIEPKPQEPTKHQYDYDVATVYGFLKRYGLENEVKVNIEQGHAILAGH
                     SFEHELALARTLGIFGSIDMNRNDYQSGWDTDQFPNNVPEMALAYYQVLLAGGFTTGG
                     TNFDAKLRRQSLDPQDLLIGHIGGMDCCARGLKAAARMLEDGALSKPLDERYAGWNGE
                     FGKTLLSGLSLDQIAGEVEAKDINPQPKSGRQEYLENIVNRYV"
     CDS             complement(221750..223201)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10215"
                     /product="glycerol kinase"
                     /db_xref="GOA:A0A1M4L9M2"
                     /db_xref="InterPro:IPR000577"
                     /db_xref="InterPro:IPR006000"
                     /db_xref="InterPro:IPR018483"
                     /db_xref="InterPro:IPR018484"
                     /db_xref="InterPro:IPR018485"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9M2"
                     /protein_id="SBW13410.1"
                     /translation="MYLGLDLGTSGVKALLIDEAQNPVGAAHGELDVSRPHPGWSEQD
                     PAQWIKACRTAIEALRAAHPKEFSAIAGIGLSGQMHGATLLDAEDRVLRPCILWNDTR
                     SYREAAELDADPAFRAITGNIVFPGFTAPKLIWVARNEADIFARIRKVLLPKDYLRLW
                     LTGEYISDMSDSAGTSWLDTGARRWSAELLAKTGLGEGQMPQLVEGSEAAGCLRAELA
                     AEWGLTASVIVAGGAGDNAASACGMGTVKPGHAFVSLGTSGVLFAANGAYQPKPESAV
                     HAFCHALPRTWHQMGVILSAASALEWYSKIVGATPQSLDRELGETLKAPGSVTFLPYL
                     SGERTPYNDAKIRGSFCGLEHEADRSALTQAVLEGVAFAIRDNLLALQSAGTEITSLT
                     AVGGGSRSTYWLKAIATALNVPIALPEEGDFGAAFGAARLGLIAATGADPFTICTPPQ
                     TARTIEPEQALLSAYDEAYQRYHALYPALHALD"
     CDS             complement(223234..224265)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10216"
                     /product="transcriptional regulator, LacI family"
                     /db_xref="GOA:A0A1M4L9G8"
                     /db_xref="InterPro:IPR000843"
                     /db_xref="InterPro:IPR010982"
                     /db_xref="InterPro:IPR025997"
                     /db_xref="InterPro:IPR028082"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9G8"
                     /protein_id="SBW13411.1"
                     /translation="MKPTVHDIARTAGVSLATVDRVLNDRPGVRAKTRDRVMAAMNML
                     GYVRDVGAANLARGRLYQFDFILPDNENTFMLSLRSELYAASERALAERVRINLRLVP
                     AFDEAALVAALDESAARKPDGVAFVALDTDPVREGCARLAEKGIHAVTLVSDLGQSAR
                     EHYVGVDNGAAGRTAARLMGLFANGTEGSIAVVAGSLKVRDHRERFDGFRAAMQADFP
                     DREILPVLEGFDKDPQVEKLVGELLAKRSDIAGIYSLGAGNSGLVAALSAHKANHPLV
                     IAHERDEITSKALEDGIIHAILAQDAGHEIRSAIRVLKASADRLAIVPGQEYIRIEIF
                     LKDNLPRFN"
     CDS             complement(224529..225599)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10217"
                     /product="transcriptional regulator, AraC family"
                     /db_xref="GOA:A0A1M4L9I3"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR018060"
                     /db_xref="InterPro:IPR035418"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9I3"
                     /protein_id="SBW13412.1"
                     /translation="MNRELFLSTDMVDATQRDDFWREAVKLIYDVMSSDDQSGKGFKG
                     TLRSQQFGTCLIGSATSNGQNYQRTPSIIAQSNMDHYVLQAMIAGRMTGDFNGTNVSA
                     KPGDIVILDLLQTVSSSVEAGERITIVIQRGELEKLVGWRNLHGMVLPGEAPTTRLLF
                     EYLRGLDAVAAELPPNEALAAQEAMLTLLSASITSKEEEAIENTPANLPMRHRIVTYI
                     DENLTNPLLGPHSIMQHFHLSRSHLYRAFEPDGGVAKVIRDKRLDLAYRILIDRKGKP
                     ISLKEIAYRCGFNDRTQFTKAFKARFELSPKEAREIGAPLPQAPSGALILHSHLSEQA
                     AKIASEHATTSTKTPPSAPVKP"
     CDS             complement(226138..227601)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10218"
                     /product="5-carboxymethyl-2-hydroxymuconate semialdehyde
                     dehydrogenase"
                     /db_xref="GOA:A0A1M4L9K5"
                     /db_xref="InterPro:IPR011264"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016160"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="InterPro:IPR029510"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9K5"
                     /protein_id="SBW13413.1"
                     /translation="MKAQPKASHFIGGAFVEDKAGKPLPVIYPATGEEIASLYSATPG
                     IIEAAYAAALKAQGEWAALKPVERGRILRRTAEILREKNRKLSKLETLDTGKALQETL
                     VADAASAADALEFFGGIISGFNGEFVELGGSFAYTRREALGICVGISAWNYPIQIAAW
                     KSAPALAMGNAFIFKPSENTPLSALALAEAYKEAGLPDGLFNVVQGYGDVGAALVNHR
                     LTAKVSLTGSVPTGRRIMAQAGEQLKHVTMELGGKSPLIVFDDADLESAIGGAMLGNF
                     YSTGQVCSNGTRVFVHKNIRERFIERLVERTRKIRIGDPFDEATQMGPLISAAQRDKV
                     LSYIKKGKAEGATLACGGGVPKLQGFDKGFFIEPTVFTDVTDTMTIAREEIFGPVMSV
                     LEFSDEDEVIARANDSEFGLAAGVFTADLSRGHRVIGQIKAGTCWINAYNLTPVEVPF
                     GGYKQSGIGRENGIAALAHYSQIKTVYVEMGKVDSPY"
     CDS             complement(227787..229436)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10219"
                     /product="choline dehydrogenase"
                     /db_xref="GOA:A0A1M4L9P6"
                     /db_xref="InterPro:IPR000172"
                     /db_xref="InterPro:IPR007867"
                     /db_xref="InterPro:IPR011533"
                     /db_xref="InterPro:IPR012132"
                     /db_xref="InterPro:IPR027424"
                     /db_xref="InterPro:IPR036188"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9P6"
                     /protein_id="SBW13414.1"
                     /translation="MEADFVIIGSGSAGSAMAYRLSEDGRYSVIVIEYGVPDVGPLIQ
                     MPAALSFPMNMETYDWGFSSEPEPHIGGRSLVTPRGKVLGGSSSINGMVYVRGHACDF
                     DHWSQSGAQGWAYADVLPYFKRMENSQGGQEGWRGTNGPLYVQRGKRDNPLFHAFVEA
                     GHQAGFEVTDDYNGEKQEGFGPMEQTIHNGRRWSAANAYLKPALKRPNVKLVKGFARK
                     ILLEGKRAVGVEIEAGRTFSTIRARREVIIAASSINSPKLLMLSGIGPAAHLKEHGID
                     VVADRPGVGQNLQDHLEVYIQQECTQPITLYSKLNLFSKAKIGVEWLLFKTGDGATNH
                     FESAAFVRSKAGVEYPDIQYHFLPVAIRYDGKAAAQSHGFQAHVGPMRSKSRGSVTLR
                     SANPREKPVIKFNYMSHEDDWADFRHCVRLTREIFGQAAFDPYRGAEIQPGAHVQTDD
                     EIDNFIREHVESAFHPCGTCKMGAVDDPMAVVDPECRVIGVEGLRVADSSIFPRITNG
                     NLNGPSIMVGEKASDHILGRTPLARSNQEPWINPRWQVSDR"
     CDS             complement(229439..230035)
                     /codon_start=1
                     /transl_table=11
                     /gene="betI"
                     /locus_tag="BR10RB9215_C10220"
                     /product="transcriptional regulator BetI"
                     /db_xref="GOA:A0A1M4L9D6"
                     /db_xref="InterPro:IPR001647"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR017757"
                     /db_xref="InterPro:IPR023772"
                     /db_xref="InterPro:IPR036271"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9D6"
                     /protein_id="SBW13415.1"
                     /translation="MPKIGMEPLRRRELIDAAIRTIGQRGSLDVTVAQIAHEAGVSPA
                     LAHHYFGGKDKLILATMRHLLRELGHDLNAAIKQTNTPHERIAAIIAVNFSAAQFAQE
                     TIAAWLTFYVHAQQSDDIKRLLRIYARRLHSNLVFALEQLTSRARANRIAEGAGAMID
                     GLYIRHALGADAPDAASAIALVEDYIAIQLSGQPSAEN"
     CDS             230225..231247
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10221"
                     /product="L-asparaginase II"
                     /db_xref="InterPro:IPR010349"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9H0"
                     /protein_id="SBW13416.1"
                     /translation="MESNPVLVEVYRGPVVESRHRGAIAVVDGDGRNVFSLGDIERPT
                     FPRSAIKSIQALPLVESGAADAFGFENADLAMACASHSGEEEHVARAASMLQKAGLDS
                     TALECGSHWPFQQPVLVKLAQSGRQPTPLHNNCSGKHAGFLAACVHCGMETKGYVALG
                     SSIQDMVRDTMEAVTGAPHSIDHCGTDGCSIPTYAIPLSNLAHGFAKMATGAGLGDKR
                     AKAAQRLIHACMAEPFYVAGTKRACTELMRMAPGRIFVKTGAEGVFCGSVPELGFGFA
                     MKCDDGATRASEAMVAAVLSRLFRKDEALSAKLADFASPEMKNWNGIPLGSVTPAAVL
                     GTAQIG"
     CDS             231292..231762
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10222"
                     /product="transcription elongation factor GreA domain
                     protein"
                     /db_xref="GOA:A0A1M4L9G9"
                     /db_xref="InterPro:IPR001437"
                     /db_xref="InterPro:IPR023459"
                     /db_xref="InterPro:IPR036953"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9G9"
                     /protein_id="SBW13417.1"
                     /translation="MSRAFTKEQDDAPTDLGERPISPHRNLVTPAGLKQIDDELARLQ
                     HDLAEANIAGERSAVARISRDLRYWTARRETAELSVPAPDSDVVRFGMTVELENLDDG
                     SIRCWTIVGEDEADPSRGKISHVAPVSILLFGKPVGDVVKINGTEWEIVSLKVD"
     CDS             complement(231869..232861)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10223"
                     /product="transporter, CorA family"
                     /db_xref="GOA:A0A1M4L9F2"
                     /db_xref="InterPro:IPR002523"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9F2"
                     /protein_id="SBW13418.1"
                     /translation="MITLYCLSGDHLEQIDVEPGTPLPDNVIWIDIFTPGVSEDHIVE
                     AWTGISIPTREDMTEIEESSRFYMESGAQYLTVPILHAVDLDHRELAPVTFITHGARL
                     ITVRYANPKSFSIYISRVTKPGNGLIPAKCTGISIMLGIIEATTNRLADILEGVAGKI
                     DAASHSIYRRQPKAHPMTTEDFRHVLTQIGGQGTFLSRTRESLAGLSRMLVYLSANNS
                     PVSAKKDTRSWIKSLERDAQSLTAYVDFLANKVTFLLDTIVGLISVEQNAIIKIFSVA
                     AVGFMPPTLVASIYGMNFSFMPELHSPWGYPMALIFMVASALLPLLYFRSKGWL"
     CDS             complement(232915..233454)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10224"
                     /product="hypothetical protein"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9J2"
                     /protein_id="SBW13419.1"
                     /translation="MEGEITRDKRCPVHIGAPRPLIQKLIQVCDNFGGRALCGKARGF
                     RFQKRARFKTVAQARMANPIQTARSIGGRAHIGARSLPRFQHSLRHQRAHSLTHSAPA
                     DAKPRGEICFIGQFLTHRPAARSNFGPDRLHGRFRQIGSGYSFHRLPKSSDDLMSYIP
                     IYCLSTPPFAEAMAYAVFR"
     CDS             233690..235000
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10225"
                     /product="cyanate transport system protein CynX, putative"
                     /db_xref="GOA:A0A1M4L9N2"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="InterPro:IPR036259"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9N2"
                     /protein_id="SBW13420.1"
                     /translation="MSHASALPLDGPAGDDILVRSQPPLIDAEADSVPAPDAQRPPSK
                     ALRILLGASLVLIAANLRPVFSSVSVLLPEIIQATGMSSISAGVLTTLPVVCLGAFAP
                     FAPRLAQRFGAERTLLFVLIVLTVGTAIRGLGTQSFLYMGAALAGAAIAVGNVLLPGV
                     VKRDFPKTAAIMTGLYTMALCAGAASAAGFTIPIKNMLGGSWNLALAFWAVPAALVFV
                     LWLPQALRAKHHVAHSGFKVAGLWRDRLAWQVTLFMGLQSSTAYIVFGWLAPILRERG
                     MSAGTAGGLVSFSIMAQVITCLLIPSIAVRQKNQSFINVFLCGCAVLALIGFLYLPGW
                     AFLPLAIIQGIGQGGLIAAAMMVIVLRSPDSHTAAHLSGMAQCVGYILAAIGPLLVGM
                     IHSATGSFAACGVLFVLLGLGASINGWGAGRAGHVGVQVSKDSA"
     CDS             complement(235057..235419)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10226"
                     /product="hypothetical protein"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9H8"
                     /protein_id="SBW13421.1"
                     /translation="MEELIARITSNVGIDAATAEKAVGMILAFLQKEGPADKVQQLLA
                     AIPGAEEAVSQVKGGGFLSNLVGGVMGLGTQLMGAGLGMGEISGVAKETIRFAKEKAG
                     DEPVDAVVGAIPGLGQFV"
     CDS             235755..237266
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10227"
                     /product="hypothetical protein"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR033186"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9J3"
                     /protein_id="SBW13422.1"
                     /translation="MTVEDAIFLGASRKPDDTYQQPEYLALQYGNRHGLVTGATGTGK
                     TVSLQVLAESFSAAGVPVFCADIKGDLSGIAAAGVLNDGLKKRAAEVKLDPYEMRAAP
                     VIFWDIFGEKGHPVRATISEMGPLLLSRLMNLTDAQEGVLNIAFRLADEEGLLLLDLK
                     DLQAILTEMAGRSDELSAKYGNVNKASVGAIQRSLLVLDQQGGSKFFGEPALRIADLM
                     RTTTDGRGVVSVLAADKLMMNPRLYSTFLLWLMSELFEELPEVGDPDKPKMVFFFDEA
                     HLLFDEAPKALIDRVEQVVRLIRSKGVGIYFVTQNPLDVPETVLAQLGNRVQHALRAY
                     TPRETNAVKTAADTFRPNPDFNTFQAITSLGTGEALVSTLQAKGVPSMVQRTLMRPPS
                     SRIGPLTPEERAQIIAASPVAGQYDQPLDRDSAFEVLARKAANAAAAQQKTGQEEEGG
                     GGLLGDIIGTAFGTGRRSGRQTVAEAAMKSVVRSVGSSLGRALVRGILGGFRR"
     CDS             complement(237403..238119)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10228"
                     /product="ErfK/YbiS/YcfS/YnhG family protein"
                     /db_xref="GOA:A0A1M4L9L3"
                     /db_xref="InterPro:IPR005490"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="InterPro:IPR038063"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9L3"
                     /protein_id="SBW13423.1"
                     /translation="MQTTLTRRSFLTAMTATAATGLAGCAQLGQTVPIIDVDAFGNPA
                     NRVPQANVDSSYGGWVQMYAAVEDNGYQLPAIPIQKMDTRYLRQVVPDPTGEMPGTIV
                     IDTANRFCYLVLDNGQALRYGVGIGREGFAWSGRAVIQYKRQWPRWTPPDEMVARQPE
                     LVQYSAKNGGMAPGLKNPLGARALYIFKDGKDTLYRLHGNPEWWSIGKAVSSGCVRFL
                     NQDIIDLYDRVPAKTPILVM"
     CDS             complement(238416..239069)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10229"
                     /product="haloacid dehalogenase, type II"
                     /EC_number="3.8.1.2"
                     /db_xref="GOA:A0A1M4L9Q5"
                     /db_xref="InterPro:IPR006328"
                     /db_xref="InterPro:IPR006439"
                     /db_xref="InterPro:IPR023198"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR036412"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9Q5"
                     /protein_id="SBW13424.1"
                     /translation="MSYSSYAFDAYGTLFDVHSAVRRHADKAGPDGRALSELWRAKQL
                     EYSWVLSLMGAYSDFWKLTEESLDYALAHYPSVDPALRNDLLDAYWKLDCYPEVPAAL
                     KALKDRGARLAILSNGSPAMLEAAVRSAALDVLLDDVISVDMVKKYKTSLAVYELIAV
                     QWRLYPSAISFQSSNRWDVAGAVRFGMRGVWINRSNEPDEYKQFPPALILPSLHLLD"
     CDS             239292..239891
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10230"
                     /product="superoxide dismutase, Fe-Mn family"
                     /db_xref="GOA:A0A1M4L9E7"
                     /db_xref="InterPro:IPR001189"
                     /db_xref="InterPro:IPR019831"
                     /db_xref="InterPro:IPR019832"
                     /db_xref="InterPro:IPR019833"
                     /db_xref="InterPro:IPR036314"
                     /db_xref="InterPro:IPR036324"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9E7"
                     /protein_id="SBW13425.1"
                     /translation="MAFELPALPYDYDALAPFMSRETLEYHHDKHHQAYVTNGNKLLE
                     GSGLEGKSLEEIVKESFGKNQALFNNAGQHYNHIHFWKWMKKDGGGKKLPGKLEKAFD
                     SDLGGYDKFRADFIAAGAGQFGSGWAWLSVKDGKLEISKTPNGENPLVHGAAPILGVD
                     VWEHSYYIDYRNARPKYLEAFVDSLVNWDYVLEMYEKAA"
     CDS             complement(240063..240398)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10231"
                     /product="hypothetical protein"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9I0"
                     /protein_id="SBW13426.1"
                     /translation="MKINSLAFLTSLALALPAILPTATGAAAQVRKDVSEYAGRRCNT
                     PPRGSGIIVGQFSGVDDSPFISDGDALVAIDRYRCFTTMSECKGWLYTMQSKYTNAGA
                     ATLARCIKR"
     CDS             complement(240517..242625)
                     /codon_start=1
                     /transl_table=11
                     /gene="ptrB"
                     /locus_tag="BR10RB9215_C10232"
                     /product="protease II"
                     /EC_number="3.4.21.83"
                     /db_xref="GOA:A0A1M4L9H7"
                     /db_xref="InterPro:IPR001375"
                     /db_xref="InterPro:IPR002470"
                     /db_xref="InterPro:IPR023302"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9H7"
                     /protein_id="SBW13427.1"
                     /translation="MPQDFPRPLPPHAPKHPASDTRHSITRTDDYAWLRAENWQEVFR
                     DPSVLAPEIRAHLDAENAYQAALMKDTENLQKVLFAEMRGRIKEDDSSVPAKDGPYAY
                     GVSYRTGGEQPYFIRTPRDGGPETILLDGDREGEGKAYFRLASADHAPNHNLLIWGYD
                     DKGSEFYKLKVRNLATMADLEDIVTDTNGGGAWDAKSEGFFYTRLDENHRPSKVFYHK
                     IGTQQADDKLIYEETDPGFFLGVGGSALDDYIFIDIHDHETSECWLLPADDPSAEPKL
                     VMARKAGTEYDIAPGGDVFYILTNGDGAKDFKICQAPASAPQPENWKEIVAEKPGRLI
                     LSHSAYKHHLVWIERDNGLPRIVIHDRKTGEEHAIAFDEEAYSLGLHGSAEYDTDVIR
                     FSYSSMTTPEQLFDYNMRTRERTLLKTQEVPSGHNPQDYVTRRILAPAFDGELVPVSL
                     LYHKDTKLDGSAPCLLYGYGSYGITIPASFSTSRLSLVDRGFVYAIAHIRGGKDKGFA
                     WYENGKRDKKANTFKDFIATAQHLVKEGFTSHDRIVAHGGSAGGMLMGAIANMAPQAF
                     GGIIAEVPFVDVLNTMLDDTLPLTPPEWPEWGNPIASEADYRTIASYSPYDNVTAQAY
                     PAILAVAGLTDPRVTYWEPAKWVAKLRELKTDSHPVLFRINMDAGHAGASGRFSRLEE
                     VAYSFAFALKVVGKVPSFKN"
     CDS             243198..243626
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10233"
                     /product="transcriptional regulator, Ros/MucR family"
                     /db_xref="GOA:A0A1M4L9G1"
                     /db_xref="InterPro:IPR008807"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9G1"
                     /protein_id="SBW13428.1"
                     /translation="MENLETNDESTELLLSLTADVVAAYVGNNSIRAGELPVLIAEVH
                     AAFKRHVEREEAPVVVEKPKPAVNPKKSVHDDYIVCLEDGKKFKSLKRHLMTHYNMTP
                     EQYREKWDLDPNYPMVAPNYAAARSRLAKKMGLGRKPKDA"
     CDS             complement(243834..244145)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10234"
                     /product="hypothetical protein"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9K7"
                     /protein_id="SBW13429.1"
                     /translation="MMQATLKIDRNAFLANRAQERMNAMQRAALQIIAGIDMDLLMKA
                     SKEEKQQASRRLGRLIERERLKGTNGHWSYDLNRHIALKQALDVLEGRTVRRRQMRHY
                     C"
     CDS             244321..244782
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10235"
                     /product="hypothetical protein"
                     /db_xref="GOA:A0A1M4L9P2"
                     /db_xref="InterPro:IPR010921"
                     /db_xref="InterPro:IPR013159"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9P2"
                     /protein_id="SBW13430.1"
                     /translation="MSLELLDVIHTRAQAFEALKRIAARHGRPLNPDALVRLTHRADK
                     KRRERCIELCEALIDLLAASFGASGAEIRSPLRGRQEVSRIRQIGMYVAHTSLGMAMN
                     EVALGFARDRTTVMHACHTVEDLRDDLEFDALVSLFEKIVSSAFTAWRMAA"
     CDS             244779..245588
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10236"
                     /product="hypothetical protein"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9I9"
                     /protein_id="SBW13431.1"
                     /translation="MTRQISAAETRIIRFLKQGGCELQDSVRETHALLVGEQGTIAAS
                     RLEIERMRKAGTIQCDGQRIALSAMGRKRPKEQKKPAPTAASVRETYEIEPGEKVEVN
                     PAESPLAMLYRRRNADGRAFISEDEFRAGERLRADFTRGSLMPSVTSRWDVQAGSGGH
                     YGAGGMAELTDIALASRIRVERALEAVGPELSGILIDVCCFLKGLETVERERQWPVRS
                     AKVLLKAGLAMLHRHYNPPREGERRRGRSCIGGRRIIAPRFDRGVCEEGRD"
     CDS             245663..247000
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10237"
                     /product="amidase"
                     /db_xref="GOA:A0A1M4L9K3"
                     /db_xref="InterPro:IPR000120"
                     /db_xref="InterPro:IPR020556"
                     /db_xref="InterPro:IPR023631"
                     /db_xref="InterPro:IPR036928"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9K3"
                     /protein_id="SBW13432.1"
                     /translation="MVGVRDRLEATLARLAARAGEEHVFSKIYAERARAEADAADTRL
                     RAGRPLGPLDGRIVSIKDLFDVAGEPTLAGSVVRHDAPPAGCDALIVQRLRNAGAVIL
                     GKTHMTEFAFTPVGLNPHYGEPGNAIDPARIPGGSSSGAAVSVAEGTSEIAIGSDTGG
                     SVRIPAALNGLVGFKPTARRIPLEGAFPLAPSLDSVGPLTRAVADAILTDAVMAGEKP
                     IPPEVLPVNGLRIALPKDYLLADMEPDVAAQFEASLAALEKAGAIIADLAVDDLIGRL
                     KEATRIGSIAGIEASHIHASTWLADPDANVDIRVKRPLSVRMKVPLEAYHALMETRKA
                     LAREMDERLSGFDMFATPATPIVAPTIASVSHDEEEYDRVESLLLRDTQVANQFDLCS
                     ITLPMPGMKLPTGLMLTARNGLDKRLLAAALSVEKILEHDPEKCERFLEKDHA"
     CDS             complement(247139..248026)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10238"
                     /product="hypothetical protein"
                     /db_xref="GOA:A0A1M4L9M3"
                     /db_xref="InterPro:IPR002104"
                     /db_xref="InterPro:IPR010998"
                     /db_xref="InterPro:IPR011010"
                     /db_xref="InterPro:IPR013762"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9M3"
                     /protein_id="SBW13433.1"
                     /translation="MHEYLRLTRDRKIAEAKPKTLAWLVSEYLASADYQKLSVNTKRD
                     YERMTGVISIKFGTLPVQALEARGARRLFMDWRDEMRATPRSADLHITVLARILSWAK
                     NREIIIRNPLEKAGKLHKSNRKDIIWMPSQLSKFLNEAPAHLSDVVKMALWTMQRKGD
                     VLGMPTIAYSDDLLWITQGKTGARVRIKPADEILPILRTAKEKNRTRVLANSFGDMWT
                     SSGFDSSFKKEMNRLEIKGVTFHDLRGTAITYAYANGMDVERIAEISGHSKSECETII
                     RRNYLAGGDVIEAIRKGTQ"
     CDS             248072..248635
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10239"
                     /product="hypothetical protein"
                     /db_xref="InterPro:IPR003961"
                     /db_xref="InterPro:IPR013783"
                     /db_xref="InterPro:IPR036116"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9R3"
                     /protein_id="SBW13434.1"
                     /translation="MKLEWFRANPNWVGTFNTNLMGLAAFGERLIRIQYPLFGINSVF
                     EVLDFKFILGEGGILQGATIQVQSMPDTAYQWDTSQEGTAPVSDETTSDDDLPVPDAP
                     DVLIIAGPAAELSFSPTGNILLNYMVRWKKTADTEWRVAGPLENDAESFETPTLSALT
                     QYEFQLAVRTQKGRVGAYSASTIKTTP"
     CDS             248701..250755
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10240"
                     /product="hypothetical protein"
                     /db_xref="InterPro:IPR006626"
                     /db_xref="InterPro:IPR011050"
                     /db_xref="InterPro:IPR012334"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9F7"
                     /protein_id="SBW13435.1"
                     /translation="MTVRTIDEIFRDFVIDGVPASGPFNPHKPDIRDTLKVLLEGVST
                     FPDNRVIRLNNADEGTANNIVVTSSVAIPTAAYQVLYILNVTQVNTGPVTVSGAINRS
                     LVTNINQPIAPGYLIPGMAVLCVDTGTELRLLSYGDAEAEQAAAEAAADRAEDAAAAA
                     EAAAGGLLSNFASRLEVEAANIPALVSFLRTAGYYSAGDGGGALYKRSASEPTHAGKV
                     QSVDGAWWEISGVTINVLQFGAKGDNTQDDSLNFQAAVDYVKSKGRGEIVVPGYGRVY
                     NFQSKRPAGLTPWAFEDPNVFFSECNDLTIRGEGNPTLTNSIYPNNRAEIFLFYKSNR
                     CRIERIKFLGNNVGLPNEINNCAIGMLSCVGIDIDRNHFTGFQGSYIASSWLFDSLIS
                     RNRFDVLGGSGIDCAFWQNVTVRDNAFNGNQMGNNGLGTQGFQHMFDTPNFGNNETGI
                     SLIGGSSNNIKLTNNTVENFRTGVIMGDAYDWSLHGNTVRLNGSDGMLVMNNDTSVSL
                     FAMTGGAFVDNKITRNGSAVNSAGVRIVKGTASLVEISFSNNTIQDNKNNGINPDAPV
                     ILKMSNNRMSNKYTNDQTVDVANILSLGAGSLLTGNYPINPSPPFGAPLPSGTNVAVY
                     NTRPWPITITQLGGVGIVLVSPAGVETAMFPNNVTTFRVPPYYGVKFTTTNTSGWLWT
                     SD"
     CDS             251009..252172
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10241"
                     /product="hypothetical protein"
                     /db_xref="InterPro:IPR006342"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9I7"
                     /protein_id="SBW13436.1"
                     /translation="MEQSRTKNESTLPLTAIAEGRYGKIHYLVNDDPIGQSLREYGEW
                     GQIEIEKILQLIHDGDHVLDVGANVGAYTLAFSCKVGSSGKVLSFEAQPFINTLLKAT
                     IDTGKLTNVDLIENAVSDKAEILYFDELEYAEHINAGAVKLSESDSSGMQQVHAITID
                     QLSLAKCELIKCDVEGMSNKVIAGALETIKKFKPIIVSEVNDVAEGVDLFNALHGLSY
                     EVWMIQSPAYNPNNFNKNKKNIFGYAAEVSFIAVHPSNRLKAALDAMGTKIESHDHLA
                     MLILQCPRFGDLTDYDRNYKVLRSKLEDMEERVCRLADASKRFSYRAALLEKRMAGRS
                     GLAAENKRLEEANGALMAQLRDAQMRLNQLYSSRSWRLMAPARFAFRFVRRFV"
     CDS             252182..253585
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10242"
                     /product="hypothetical protein"
                     /db_xref="InterPro:IPR001173"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9J0"
                     /protein_id="SBW13437.1"
                     /translation="MQRIKPIIPTRADWEKLAEFSTKSDSRSKNIDVIVPVYKGMEET
                     MRCLYSVCSAKQKTVFDVVVINDRSPDPELVKQLNYVADLGFIDLHHNAENLGFVGTV
                     NYGMQLHPDRDVVLLNSDTEVYNDWLDRIYRFAQSDPAIGTVTPLSNNAEICSYPVFV
                     QDNNFELEVDGCTIDRIAKKVNEGCSANAPTGVGFCMFIKRECLSAVGYFDVETFGRG
                     YGEENDFCQRAIENGFRNAILADTYVRHYGSTSFGADKMQLVRTATAAIQKKHPNYLS
                     DVGEFISKDVLKEFRRNIDIERLKTHRNGKLICFISHNLGGGTERHVLDLKKQLEGDD
                     EAKVLVLRPQPGDSSALIVDDSGFPNVGPFRIDGDATDFSRFLIDAGVDLVHIHSLVG
                     ASPELSDYLRVSCRAAGVGYDFTVHDYFTVCPRFHLIDYCGQYCCEPDISACEECCSS
                     GGYLHSIGGTSVWAWRD"
     CDS             complement(253601..253819)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10243"
                     /product="hypothetical protein"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9H1"
                     /protein_id="SBW13438.1"
                     /translation="MKKTRPLMRSYRPQKKNSLYIFRVLVARPDCGRTAGPQMRFWMQ
                     PNDSLYMLKVSLDTALNVIGWHPHTPSA"
     CDS             253850..254263
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10244"
                     /product="hypothetical protein"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9M0"
                     /protein_id="SBW13439.1"
                     /translation="MNLEFVVVGYTDGMQDLEAIGNVKITGAYKDSELDELIAENRPN
                     IAWMSSICPETHSYTLSEILSRGIYPVCFDFGAVAERVRDASFGTVLDARLILDAESL
                     CNKLFDIASDQRDSNTSYVPQSYNSIVNEYYELLD"
     CDS             254592..255275
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10245"
                     /product="putative membrane protein"
                     /db_xref="GOA:A0A1M4L9Q2"
                     /db_xref="InterPro:IPR002196"
                     /db_xref="InterPro:IPR023346"
                     /db_xref="InterPro:IPR033907"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9Q2"
                     /protein_id="SBW13440.1"
                     /translation="MARRINAAGLSLVQQWEGLRNTAYRDVASVLTIGYGHTSAAGAP
                     KVMPGMTIGDKEAERILKADLAKFEARVERLVKVPLTDNQFAALVSFDFNTGALDKST
                     LLKKLNKGDYAAVPVELMKWVNAGGKKINGLVNRRAAEAGLWAKGDFVSSNYVPATTA
                     ANKTDVATIGGAGAAGAAATIGPVIPEVTKAITDQQDELSSGQWVRVAIAAIIIGLTL
                     WGVYRKIKP"
     CDS             255272..255541
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10246"
                     /product="putative membrane protein"
                     /db_xref="GOA:A0A1M4L9K0"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9K0"
                     /protein_id="SBW13441.1"
                     /translation="MIWALIPAWLKYSLAALVAAFLLVAGGYVIGTIKERQRAALAAV
                     EATARAIQKRAGVNEKIIGMDSYRLCLELGGLQPDCEQLRWMETD"
     CDS             255653..255895
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10247"
                     /product="hypothetical protein"
                     /db_xref="GOA:A0A1M4L9L4"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9L4"
                     /protein_id="SBW13442.1"
                     /translation="MDNEARTVNRMGELPERTKEFLSKLDEDDIETLEDAMKFYSTVR
                     TLGRVGKWTVLSILAIIVGIVSLYENLLKMWGWFHK"
     CDS             complement(256136..256561)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10248"
                     /product="hypothetical protein"
                     /db_xref="InterPro:IPR003808"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9N3"
                     /protein_id="SBW13443.1"
                     /translation="MTTTIDSIMSDFEFLDDWEDRYRYVIDLGKELTPYPDDARDAAH
                     KVQGCVSQVWLKTLPQDGNDPVIEFLGDSDAHIVRGLVAIVLALYSGRRASEILATEP
                     EEVLKKLGLDEHLTPQRSNGLRAMVARIHREAELAKESA"
     CDS             complement(256641..257090)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10249"
                     /product="hypothetical protein"
                     /db_xref="InterPro:IPR035220"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9S4"
                     /protein_id="SBW13444.1"
                     /translation="MIRFLLKSAFWLSLAFIAVPHFFPADQENKAPEKPAHEQAKQEP
                     SSIEQILANGKTAVEIGKLCMDNPSFCKSGTSLVSSAGSGFLEGSRVMLEYLSARFGA
                     KKETPVQEQPAAAETVSVKSQIPVPTPREEALRALDHRVTGSITPNR"
     CDS             257381..259210
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10250"
                     /product="sensor histidine kinase"
                     /db_xref="GOA:A0A1M4L9G7"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="InterPro:IPR036097"
                     /db_xref="InterPro:IPR036890"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9G7"
                     /protein_id="SBW13445.1"
                     /translation="MNVIHLKAAQIVRNSLHGLACFHDRFCRRWVATPDAASIRVIGA
                     VFTLPFLLCAAVAASGVAAGLTDFAILAGSFTGVAMIFCALSLMGLRAGILGVLNFAA
                     YGAGLATIGAFSNGNAVLWLMAAGLPLEIWFACRKPGITIAGSLAAMVILAFLAVKTG
                     GTISGGSLISGAILLLYAASLVLRGVAVARKPVQISVAAPQVAVAAGDMQFGLDIEGI
                     VSSVDGETAKLLGVQPKMLEGTALIDRVHVADRVQYLSLLADLRAGMATRKVDVRLRS
                     IENGNPVFRAYRFEGAGSDRAITLIGRSLEGEQKLLDEIAMLKAELESERIGKGRLLA
                     TVSHELRTPLNSIIGFSDMLTHEIGGKLASDRQREYAGLIHQSGHYLLELVNAVLDKS
                     RLETGTYSIAPQSFVFRDAVEMCTAVMLPQAEKKGVAFCHRVGNGVGELVADRRAVQQ
                     ILLNLATNAVKFTQSGGCVTIDAARVMADGCPMLEFSVSDTGIGIEPEDLQRIGTPFV
                     RADNSYTQAQEGSGLGLSVVKGLVELHQGSMQLKSRPGEGTVVMIRLPLAGPQYRAGE
                     EQQELGTVIDMHRHQGERRNDWQKDEIRDQSPEQPHAQTRKTA"
     CDS             259284..260153
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10251"
                     /product="peptidoglycan-binding protein, putative"
                     /db_xref="InterPro:IPR002477"
                     /db_xref="InterPro:IPR036365"
                     /db_xref="InterPro:IPR036366"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9J7"
                     /protein_id="SBW13446.1"
                     /translation="MRNPVLTGGATAFLVVMGFVSANALWYQPEAHDAVFFRTRPDFV
                     FKPTPRAALPGTAAINSEGKPAAQSVRQPENNGPNPSVATADLSPDRLQLSGSVDDML
                     PALAPNADLEIARLQQRLSMLGIYKGPVDGFTGPQTREAVEHWRALQQKLGVKQASLP
                     AQLENNAPAQDDVAGIIEVAVPSPRPQPAVLKDAAPIKPKADLASYEKPVHKKQPAAA
                     AAQPSKISSQDIVRVQAGLKAFGNDTVPVNGQPGKATQEAVREFQKLFGLHVTGEIDS
                     ALISKMREIGLIS"
     CDS             260167..260514
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10252"
                     /product="hypothetical protein"
                     /db_xref="InterPro:IPR009964"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9K1"
                     /protein_id="SBW13447.1"
                     /translation="MRLTSDFWVSALIRKVRGGGGFAYLARRGSPEAGAIFIKVSSRL
                     GACDLYSPAPQTSYEEDSDGERMFLRILHNADDMAANTRMEREIRFDPDLWLVELEDI
                     ADATEFFRISVDE"
     CDS             complement(260525..261601)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10253"
                     /product="hypothetical protein"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9I1"
                     /protein_id="SBW13448.1"
                     /translation="MAVSVCLPEYLCVTNDQFRVLEEISGNRSPSSSKTESSKADDLL
                     AAALSAFATIMRPGRQDMQQLEDLAMPLLQCASTRGKRHAANALAHLEEAPRRLVLAL
                     ANEPVEISAPLLLRSPLLRPSDLVDIIARNGIGHARAIARRQSDDVLLRGVLRSFADA
                     AIDRTLALQENLANIDAEPLEKPEIPDLSVASGPLMRENHSERLVRALQQPFFTAGAL
                     PGCEHLIDTALLIDSQLFRTALADALDISFDRADAIIGKWPDSYLPIALKALGLSAPE
                     CYLVMTAVLGSIETTRDGLRDFVHIYRSIDRAKAMSLVRRWKSDDMSAMLRNKLREMA
                     VSAENEPLDDAANTDAPKPTRSVK"
     CDS             complement(261825..262367)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10254"
                     /product="hypothetical protein"
                     /db_xref="GOA:A0A1M4L9M6"
                     /db_xref="InterPro:IPR014456"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9M6"
                     /protein_id="SBW13449.1"
                     /translation="MAKLVRLVLLGLIGAAIVHIAIVFLVPVYSDKNAWSRIEASGDP
                     YRFYRLDQKKGPISDSDPLVKEATCRFDLSNGPVHITTQSNVPYWSLSIYAPNGDNLY
                     SLNDNVSNDRKLDLVIADPIGMASLRSDASRSDMRSIFIEQNIGEGAAVLRVFVPDTT
                     WNAQVQHFFDEAQCEPFEGF"
     CDS             complement(262360..262971)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10255"
                     /product="hypothetical protein"
                     /db_xref="InterPro:IPR010621"
                     /db_xref="InterPro:IPR012038"
                     /db_xref="InterPro:IPR037049"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9R2"
                     /protein_id="SBW13450.1"
                     /translation="MFKTIFKVVAVLALALGGGIWSVDYVLDSFEGFGELRVGAWRAY
                     PAAGTPDADPYSKARAARKAYLPLGTTEGLPFYAQRDSARRELRRGCTYRLSGFTPPA
                     RFWTLYPATPDLKPIAPREGLQSALHSRAVLYEKDGSLSITISPDASPGNWLPVEGQG
                     NFVLVMTLYDTPAGSSSGLSDLVMPSLARIVNQGPKGQEACRG"
     CDS             complement(263007..265151)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10256"
                     /product="1A family penicillin-binding protein"
                     /db_xref="GOA:A0A1M4L9L1"
                     /db_xref="InterPro:IPR001264"
                     /db_xref="InterPro:IPR001460"
                     /db_xref="InterPro:IPR012338"
                     /db_xref="InterPro:IPR023346"
                     /db_xref="InterPro:IPR036950"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9L1"
                     /protein_id="SBW13451.1"
                     /translation="MPKSVFMRNTAEKDRGNDKRKPFRVSRLIGLDAWIDSTLYNLHF
                     RLGEWWENITIFSRRFRVRGFRRFMVEVLDEGFTLGVAGSVLMLMLALPAFEETKKDW
                     RAQDDYAVTFLDRYGNEIGRRGILHRQAVPIDELPDHVIKAVLGTEDRRFFDHYGIDL
                     MGLSRALSQNMRANGVVQGGSTITQQLAKNLFLSNERTIERKVKEAFLALWLESNLSK
                     KEILQLYLDRAYMGGGTFGIAAASEFYFGKNVKDISLAEAAMLAGLFKAPAKFAPHVN
                     LPAARARANVVLSNMVESGFLSEGQVAVARRHPASVIDRAKDESPDYFLDWAFDEVKK
                     VADRFNQHTLIVRTTLDRNIQKAAEESLEFHLRQYGKEYNVSEAATVVLANDGSVRAL
                     VGGRDYGESQFNRATKALRQAGSSFKPYVYAAAMEKGLTPSTIVSDAPISWGNWSPRN
                     YGRSFAGRVDLTTALVRSLNSVPVRLARDYLTTAPVVALTKAMGVESPISSHKTMVLG
                     TSEMTVMDQATGFNVFANTGMAGNRHAFTQILASDGKVLWDFGRDAPKPHRALSEKAA
                     LEMNSMLVQVPERGTGRRAALTMTRVAGKTGTTQNYRDAWFVGFTGNFTAAVWFGNDN
                     FTPMKELTGGVLPAMAWQRMMAYAHQNIELKPLPGVNPPFPPSRRTRPHRWPIRGRRK
                     QWLPRHGFYRRWRQKFSRNCMTASLPRRLCLR"
     CDS             265491..266003
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10257"
                     /product="hypothetical protein"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9M5"
                     /protein_id="SBW13452.1"
                     /translation="MRTGKGLAQRHERIRLAHQLQVRHGIAAEDLAKILGLSEERYEL
                     WLRRLKCTGSEAKAPQRPIEGAFGRLQVELQRLLDGEQLPDKSKAEALMALAKAVKTV
                     DELTAESATTETGREIATPDIKEVRQALARIDRRIEELAEKRAREILGGGPGVSADIG
                     SARRMADPGA"
     CDS             265942..267201
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10258"
                     /product="phage terminase large subunit, putative"
                     /db_xref="InterPro:IPR035421"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9P3"
                     /protein_id="SBW13453.1"
                     /translation="MGLAFRQILAAQDEWLIRARDAQLPPDGDWRVWLIMGGRGSGKT
                     RAGAEWVSGMALGLPPFAGKPSGHIALVGETFNDAREVMVDGPSGILSVSRLVRPRYE
                     ASRRRLIWDNGAVATLFSSEDPDSLRGPQFDAAWCDELAKWKNPQETWDMLQFGLRLG
                     DNPRQVVTTTPRAVPLLKALLTDRTVSMTHMRTAENAGNLAEGFMQTIAHRYAGTRLG
                     RQELDGELVEERPGALWSRDRIEQCFEENPPPLARIVVAVDPPASSGKASDACGIVVA
                     GIDAEGVGHVLADESMTMAKPHQWARRAIALYHTHEADAIVAEVNQGGEMVAAVLAAE
                     DPSVPVLKRRASRGKWLRAEPVAALYEQGRVRHAGRFPALEDEMCDFAPEGLSSGRSP
                     DRLDALVWALGELMLGADHKPRIRRFG"
     CDS             267233..268426
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10259"
                     /product="phage portal protein, HK97 family"
                     /db_xref="InterPro:IPR006427"
                     /db_xref="InterPro:IPR006944"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9T2"
                     /protein_id="SBW13454.1"
                     /translation="MAWNWPWRKSAANLPTRANAVSQTKMANGFVALHMERNASWIAR
                     DYSTLAREGFMRNPVAHRCVRLIAEAASTIPWLLYEGATEHEAHPLLDLLTHPQGAVE
                     GGSFFERLYGHLLIAGNAYVERVDLPSGRMELHLLRPERVTVETDADGWPQALVYRSG
                     SASRTIPVAGLDAPGLHLKLFHPLDDHYGFPPLEAALMALDIHNAAGAWNKALLDNSA
                     RPSGALVYAPKEGGNLTEEQFERLKAELEEGYTGASGAGRPLLLEGGLDWKAMGYSPQ
                     DMDFIEAKNGAARDIALAFGVPPMLLGIPGDNTYANYAEANRAFYRLTVLPLIGRTAK
                     AFGNWLGPLFGGGLRLEHDIDRIEGLSAERESLWRRVSEASFLTDDEKRDAVGYQPRV
                     GRRVS"
     CDS             268423..268800
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10260"
                     /product="hypothetical protein"
                     /db_xref="GOA:A0A1M4L9H9"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9H9"
                     /protein_id="SBW13455.1"
                     /translation="MNNWNDAVLASDTAWLWFAKIAGAVAGSAVSLAYMLPHGKREAA
                     IRFAVGIICGMVFGGAAGVKIAETLALGDALGRAELMLMGSAAASLAAWSALGVFRRF
                     AERLKQAPLPGVLPAERNMHGEI"
     CDS             268787..269455
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10261"
                     /product="phage prohead protease, HK97 family"
                     /db_xref="GOA:A0A1M4L9K9"
                     /db_xref="InterPro:IPR006433"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9K9"
                     /protein_id="SBW13456.1"
                     /translation="MARFDLKLDMKRAALAVEEVEIDGSFSGYASVFGLPDLGNDVIE
                     QGAFARALKERGASGVRMLWQHDAAEPIGVWTQIREDARGLYVEGRLAKGVARAREAL
                     ELMRSGGLDGLSIGFRTVRAHKDARTGLRHITQADLWEISVVTFPMLPQARVTGIKAG
                     LPTIREFERWLTRDAGLSRAAARTVIAKGYAALGASLNGREAIGQDEADLAGRMRRAA
                     RTMI"
     CDS             269477..270751
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10262"
                     /product="phage major capsid protein, HK97 family"
                     /db_xref="InterPro:IPR024455"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9L0"
                     /protein_id="SBW13457.1"
                     /translation="MEHSPIRALETKSVETKALAPNAGSDGDVAEAFDEFMTAFSAFR
                     EANDERLKKVEKHADTDVLLREKVDRINRALDEQKAALDQFVLKRARPPLGQNAPMGD
                     VEHKQAFDGYVRRGDEQALRGIEQKAHSYASGPDGGYLVPAELETEIGRRLAVLSPIR
                     GISGVRQVSGAVLKKPFSISGPATGWVGETDARPQTASAKLAELQFPTMEIYAMPAAA
                     SSLLDDSAVNVEQWIAEEVEAAFAEQEGAAFVSGDGVNKPRGFLSYETVADDAWAWGK
                     IGHVATGVAGALPPEDPSDKLIELIYTLKAGYRQNANFVMNRKTQSVLRKLKDKDGNY
                     LWQPPAAIGDKASLMGFGLVEAEHMPDIAADAAAIAFGDFGRGYLVVDRIGVRVLRDP
                     YSAKPYVLFYTTKRVGGGVQDFEAIKLLKFAA"
     CDS             270916..271851
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10263"
                     /product="phage tail protein"
                     /db_xref="InterPro:IPR011738"
                     /db_xref="InterPro:IPR021146"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9J1"
                     /protein_id="SBW13458.1"
                     /translation="MTMFLVTPPALEPVTIADARAFLRISAESEDDILGRLITTAREL
                     VEAETGLALIDQTWRLRVDRWPRSGRLALFKYPIKAVTGVVAYRPDGTAISFLPDEVA
                     LHHDRRPQRLYMAQYPDASTFCGIEVDFIAGFGESGVEVPDTSAFDRALSDLEKRSSS
                     FGNSLNSALKGAITSGKGLEDVLRGLASSLAGTALSAGLQPLQGLTSSMMGGLLSGIR
                     GIMPFAKGGVVSSPTYFGMGNGSLGLTGEAGAEAILPLARGSDGRLGIATGGGSKPVQ
                     VVFNMTSPDASSFRKSEAQLATMLAGAVRRGARKL"
     CDS             271854..272486
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10264"
                     /product="hypothetical protein"
                     /db_xref="InterPro:IPR011740"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9P1"
                     /protein_id="SBW13459.1"
                     /translation="MVEAFHDVRFPLGVSFGATGGPEWRNEIVTLTSGLEKRNARWAH
                     SRRHFDAGTGLRSLDDLRMVLAFFEARRGSLHAFRFRDPFDFSSATGKAPLSAFDQPL
                     GTGDGVAVHFQLRKNYESYDRPITLPVPGSVVIGVDGVKVPEGEAFTVDPLTGIVTFT
                     PDYLPARDVPVTSGFLFDVPARFDTDRLTASIASFQAGEIPSIPIVEVKR"
     CDS             272483..273169
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10265"
                     /product="hypothetical protein"
                     /db_xref="InterPro:IPR011928"
                     /db_xref="InterPro:IPR019228"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9R9"
                     /protein_id="SBW13460.1"
                     /translation="MIPVPPALESHLQGEVTTHCFAWLIRRLDGSVLGFTDHDAPLTL
                     DQVMCDPLTGLNSSEASTALGLGIAGGEVEGVLSSTQISDEDIEQGCYDGATIEAFLV
                     NWNEPDQHMLLRRWTAGKISRSGSRFVMELKGVAAAFDAVRGRRILRHCDAMLGDNRC
                     GIDTGDSRFLRREQCLPLKAHGLMWRALTALRRVGFPKAVLHGPAGPIGDGRSVLSAM
                     RGQACNLASR"
     CDS             273166..273357
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10266"
                     /product="hypothetical protein"
                     /db_xref="InterPro:IPR011928"
                     /db_xref="InterPro:IPR018964"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9L7"
                     /protein_id="SBW13461.1"
                     /translation="MILPVAAGDAFRLVCGCDKSFATCKAKFANGVNFRGFPHLPGND
                     AAYAYVNSTNDYDGGVLVP"
     CDS             273354..273788
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10267"
                     /product="phage cell wall peptidase, NLP/P60 family"
                     /db_xref="InterPro:IPR000064"
                     /db_xref="InterPro:IPR011929"
                     /db_xref="InterPro:IPR038765"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9N4"
                     /protein_id="SBW13462.1"
                     /translation="MMIAERVLAEAHRWIGTPYRHGASTLGVSCDCLGLVRGIWRALY
                     GVEPENPGVYAPDWAEVSQGDPMLEAAARYMARREEHAPQPGDLLVFRWKPGFAAKHM
                     GIMAREGRFIHAYQGHGVLASALVPQWRRRMAGIFLFPEPKV"
     CDS             273792..277655
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10268"
                     /product="hypothetical protein"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="InterPro:IPR025195"
                     /db_xref="InterPro:IPR032876"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9Q3"
                     /protein_id="SBW13463.1"
                     /translation="MATVVLQAVSAAVGGIFGPVGAAIGAGLGAMGGYAVDNALLNST
                     RHIEGARLNGGRVATAEEGGALPFIYGTARVSGTLIWATRFEERKTTTRQGGKGGPKV
                     TNYSYFGNAAYAVAEGEIAGIRRVWADGQELDLTEIDMRVYCGTATQNPDPLIEAKQG
                     TGNAPAYRGTAYVVFERIPLDTFGNRLPQFQFEVMRPVGEVARNMRAVALIPGSTEFG
                     LSPDTVSDEPVPGEKRWINRNAIRARSDWAAALDELQALCPGLRHVAIVLPWFGDDLR
                     AGQCRIRPGVTSLSVRKPSTIWKVENVSRGAAHLISMSGEGAAYGGTPSDASVIAAIR
                     DAKARGLGVTLYPFIMMDVPKENQLPSPYGGIGQPAYPWRGRITCHPAIRQEGPPDGT
                     PAAGEQAAAFVNGEWGYRRFLNHCADLAVRAGGVDAFLIGSELRGLTSIRDGRDSFPF
                     VSHLCALAAEMRGKLGAGCRITYGADWSEYFGYQVPDGTGDLFFHLDPLWAHPAIDAI
                     GIDNYMPLADWRDSDFLEGNPDGFKTPYDLAGLSRSVNSGEGYDWYYASAEDRLARRR
                     TPITDGLAAKPWVYRYKDLHGWWSNRHYNRIDGVEVAAPTAWVPQSKPLWFTELGCPA
                     VDKGPNQPNVFPDPKSSENAAPYFSNGSRSDAAMDRFLRAHYRHWQGENPLSPVYGGP
                     MLDMERIYLWAWDTRPFPEFPLGQDIWGDTANWRLGHWLNGRISGIALDELIAAILRD
                     FGLPEADCIGVEGHLSGFIVSEPSSARGVLEPLLNVFGVHGYERAGQFVFRNITRAEA
                     ALELGEFAQPEEGEALTVVVEDQGDLPSTAELYCNDPLRDFQIVGASARREVGQGTES
                     LSLSGSMENGQATALAEAWMARRHAERRTASFSLPWSNAALHVGDRVRLGMLDGQRDY
                     VVTALEDGATRAVTAAALAPNLVFADKGETPPRPPGGPALDMKPVFHFVDLPLWPGAE
                     DPAAQFRIACHAKPWRGVAVYASPSNDGFAERALIGERAIMGELTAPLAGGPSGRLIE
                     GQFVEVVLYSGELQSRPLVQVLNGANTGLLGLPDGQWEIFQFLDAEEVGLNRWRLGRL
                     LRGQLGTEAAALDDKPVETPFILLDSGVVSAGLQASELGLELGWRVGAAGKAFSDEFF
                     ETVRQSGGLHALRPLSPVHLGVMRSLDGDMGFTWIRRGRIDADSWLGEDIPLGEDREA
                     YRVEIWRDDTLVRSELVSAPAWNYGFAERRAELGEDAFRFCVAMIGAKTGPGDFAVLD
                     VDPNPSGKSGSDLEKYERLSQQDHA"
     CDS             277719..277925
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10269"
                     /product="hypothetical protein"
                     /db_xref="GOA:A0A1M4L9U0"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9U0"
                     /protein_id="SBW13464.1"
                     /translation="MTANKSWYLSRTVWAGLVALFLSVAGLFGVATDMIDQGNMTDVL
                     LQLATAIAGIVTVIGRIGATSRIL"
     CDS             278087..278383
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10270"
                     /product="hypothetical protein"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9I8"
                     /protein_id="SBW13465.1"
                     /translation="MKQNPALKVFALLAVSVGLLPVNAGALPMAAPQKPNLLIATAGD
                     CTAVGEQVAAQQGGQLAKATPTMQNGRTMCVIVVLIPGRNGERPRRVEVAVPAQ"
     CDS             278462..279151
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10271"
                     /product="Response regulator receiver"
                     /db_xref="GOA:A0A1M4L9L6"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR001867"
                     /db_xref="InterPro:IPR011006"
                     /db_xref="InterPro:IPR016032"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9L6"
                     /protein_id="SBW13466.1"
                     /translation="MRILIVEDDKDLNRQLSEAMIAAGYVVDSAYDGEEGHYLGDTEP
                     YDAVVLDIGLPQMDGISVVERWRRSGRTMPVLMLTARDRWSDKVAGIDAGADDYVAKP
                     FHIEEVLARLRALIRRAAGHASSEFVCGPLHLDTKTSKASIDGVALKLTSHEYRLLSY
                     MMHHMDEVVSRTELVEHLYDQDFDRDSNTIEVFVGRLRKKMGVDLIETVRGMGYRMRS
                     GGEGEAKGSGS"
     CDS             279226..280536
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10272"
                     /product="sensor histidine kinase"
                     /db_xref="GOA:A0A1M4L9L8"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="InterPro:IPR036097"
                     /db_xref="InterPro:IPR036890"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9L8"
                     /protein_id="SBW13467.1"
                     /translation="MALVVVATFISSLYGEAARNNFERLLTAHLFSLVGAVSVSGEGT
                     LQGRPELGDLRYSSPLSGWYWSVDPVTPNLTGKLEAPSLVGRIVPEMPVSQAPFDSSF
                     MRSYTLPGLDNEELSIVETEVVLDNSNRVARFRVMGNLSEVLNEIANFRARLLVYLGV
                     FGIGSILINAAVILFGLRPLDKVRQALADIREGRSSRLDATLPLEIAPLAREMNALIE
                     NNRRIMERSRTQVGNLAHSLKTPLSVLVNEARAMGGAPGRIVQEQSEAMQVQIQHYLQ
                     RARIAAQRDSVVFRTPVTPVLERLQRVTAKLHPTFNISFRNDLPGAVFAGEREDLEEI
                     IGNLLENAGKWGRKCINIRLAAAAGEQKQFEIVIEDDGPGLEADKIEAALKRGSRVDE
                     TKPGTGLGLAIVQDTVREYGGSLHLGKGALGGLAVRVVLPLTQD"
     CDS             280630..281082
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10273"
                     /product="outer membrane lipoprotein-related protein"
                     /db_xref="InterPro:IPR016364"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9J9"
                     /protein_id="SBW13468.1"
                     /translation="MMIVSRFSRPVPVISMMFVMSLVLSACGTTGGGKGSGFPSLGGS
                     SQKPETNLLASLGNGLLGNSASQLSAVDRRKALEAEYRALEYSPAGKSVLWSGAGSNA
                     GDVTAAQPYQVGSQNCRQYSHSFTIGGDQQTVRGTACRNPDGSWTPLT"
     CDS             281183..282322
                     /codon_start=1
                     /transl_table=11
                     /gene="ccmI"
                     /locus_tag="BR10RB9215_C10274"
                     /product="cytochrome c-type biogenesis protein ccmI"
                     /db_xref="GOA:A0A1M4L9P9"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR017560"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9P9"
                     /protein_id="SBW13469.1"
                     /translation="MEFWLVAALLTFAATLAVLLPLTRRRQAALPAEKNDLEVYRDQL
                     REVEADVARGMIDLQSAEQARIEISRRILNAEKAAMAATADGGQGRSGRVLAFVAVLA
                     VPLVAWGIYPLFGAPDMPSMPLAPRLAAAPDRSSVTDLIARAEAHLAQNPGDVRGWDV
                     LAPIYLRLGRASDAVSAYRTSIRIAGENLARILGLGEALTAASGGTITAEAEKLFNKA
                     AELSPDDIRPQYYLAQGEMQDGHPDRAADRLQAFLDKAPADAPWRGKLEKTIVILRDP
                     ASAKQAEAKGPTAEDVEAASTLSAADRQAMVEGMVQRLDETLRQNGGDIDSWKRLVRS
                     YMILNRRNDAQDALARGMKALQGENRTELQSFATTLGLDVGTAQE"
     CDS             282319..282816
                     /codon_start=1
                     /transl_table=11
                     /gene="ccmE"
                     /locus_tag="BR10RB9215_C10275"
                     /product="cytochrome c-type biogenesis protein CcmE"
                     /db_xref="GOA:A0A1M4L9T0"
                     /db_xref="InterPro:IPR004329"
                     /db_xref="InterPro:IPR036127"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9T0"
                     /protein_id="SBW13470.1"
                     /translation="MSATAEQNARNPKGKGGFARTVSQRKRKRLFLIGGALAVLAVAV
                     GLMLTAFNQDIRFFRTPADLTEQDMTSGARFRLGGLVEEGSVSRTGSELRFTVTDTIK
                     TVKVVFEGIPPDLFREGQGVVAEGRFGSDGLFRADNVLAKHDENYVPKDLADSLKKKG
                     VWEGK"
     CDS             282836..284827
                     /codon_start=1
                     /transl_table=11
                     /gene="ccmF"
                     /locus_tag="BR10RB9215_C10276"
                     /product="cytochrome c-type biogenesis protein CcmF"
                     /db_xref="GOA:A0A1M4L9N0"
                     /db_xref="InterPro:IPR002541"
                     /db_xref="InterPro:IPR003567"
                     /db_xref="InterPro:IPR003568"
                     /db_xref="InterPro:IPR032523"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9N0"
                     /protein_id="SBW13471.1"
                     /translation="MSVEIGHFALVLALALSIVQSIVPVVGAHRRDAQLMAVAVPTAL
                     AVFALIVLASAALIHAYVVSDFSVLNVVENSHSQKPLLYKITGVWGNHEGSMLLWVFI
                     LTLFSALVAAFSGNLPETLRANVLAVQGWIGTAFLAFIIFTSNPFTRIFPAPMEGGDL
                     NPVLQDIGLAIHPPLLYLGYVGFSVCFSFAVAALLEGRLDAAWARWVRPWALMAWMFL
                     TGGIAMGSYWAYYELGWGGWWFWDPVENASLMPWLVGTALLHSAIVMEKRSALKIWTV
                     LLAILTFSLSLLGTFLVRSGVLTSVHSFATDPGRGLFILGILALFIGGSLSLFALRVQ
                     SLSAGGIFHPISREGALVFNNLFLTTAAATVLIGTLYPLLLEVTTGEKISVGAPFFNM
                     TFGPLMVPLLFAVPFGPLLAWKRGDLYGVGQRLMTAFALSLAVVGIMLWRTSAHSVLA
                     ALGIGLAAWLIFGSLTDLVLKAGIGKVSASKAFARFKGLPRSVFGTSLAHIGLGLTLL
                     GIVSVTTFGTENVLVMQPGGTAKVQNYTLRFEGLRPITGSNFTENRGAFTLLDSSGRD
                     LAVIEPSKRFFPARQMPTTESGIKTLWFSQVYVALGDEPGNGAVVVRIWWKPLVTLIW
                     YGALVMMLGGLFSLADRRLRVGAPSKVRRSASKEAEAVA"
     CDS             284824..285300
                     /codon_start=1
                     /transl_table=11
                     /gene="ccmH"
                     /locus_tag="BR10RB9215_C10277"
                     /product="cytochrome c-type biogenesis protein CcmH"
                     /db_xref="GOA:A0A1M4L9P8"
                     /db_xref="InterPro:IPR005616"
                     /db_xref="InterPro:IPR038297"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9P8"
                     /protein_id="SBW13472.1"
                     /translation="MKKSNLFRALLISATFALQATAALAVNPDEVLADPKLEKRAREI
                     SAELRCMVCQNESIDDSNAELARDLRILVRERLTKGDTDGQVIDFVVDRYGEFVLLKP
                     RFNAQTALLWGFPVIILLIGGGALLVAFRRRRAAGTAPQPLSESEKAELSRLLDEK"
     CDS             285442..286983
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10278"
                     /product="peptidase Do"
                     /db_xref="GOA:A0A1M4L9R5"
                     /db_xref="InterPro:IPR001478"
                     /db_xref="InterPro:IPR001940"
                     /db_xref="InterPro:IPR009003"
                     /db_xref="InterPro:IPR011782"
                     /db_xref="InterPro:IPR036034"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9R5"
                     /protein_id="SBW13473.1"
                     /translation="MSRARISNYRKGVAAVALSAALAGAFVVTGPLGALNEARAEAVH
                     VTPPPQAGFADLVEKVRPAVVSVRVKKDVQEASNRGPQFFGPPGFDQLPDGHPLKRFF
                     RDFGMEPRGDSRSDNRRGKANKPRPGHERPVAQGSGFVISEDGYVVTNNHVVSDGDAY
                     TVVLDDGTELDAKLIGADPRTDLAVLKINAPKRKFVYVAFGDDNKVRVGDWVVAVGNP
                     FGLGGTVTSGIVSARGRDIGAGPYDDFIQIDAAVNKGNSGGPAFDLSGEVIGINTAIF
                     SPSGGSVGIAFAIPSSTAKQVVDQLIKKGSVERGWIGVQIQPVTKDIAASLGLAEEKG
                     AIVASPQDDGPAAKAGIKAGDVITAVNGETVQDPRDLARKVANIAPGEKAALTVWRKN
                     KAEEINVTIAAMPNDKGKSGSQSNDNGGGQGETLDSYGLTVVPSEDGKGVVVTDVDPD
                     SDAADRGIRSGDVIVSVNNQTVKTASDINKAITAAEKSGRKAVLLQLQSNDQSRFVAL
                     PINQE"
     CDS             287077..287784
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10279"
                     /product="DNA-binding response regulator"
                     /db_xref="GOA:A0A1M4L9U9"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR001867"
                     /db_xref="InterPro:IPR011006"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9U9"
                     /protein_id="SBW13474.1"
                     /translation="MKILVIEDDREAARYLEKAFAEAGHSADIAGDGETGYALAENGN
                     YDVLVVDRMLPKRDGLSVVAGLRAKGMETPVLILSALGEVDDRVTGLRAGGDDYLTKP
                     YAFSELLARVEVLQRRSSPREADTIYRVGDLELDRLAHTARRQSVDITLQPREFRLLE
                     YLMRHAGQVVTRTMLLENVWDYHFDPQTNVIDVHISRLRSKIEKGFDEPLLHTVRGAG
                     YMLKAGRGKQSAAARAE"
     CDS             287781..289187
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10280"
                     /product="sensor histidine kinase BvrS"
                     /db_xref="GOA:A0A1M4L9J8"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="InterPro:IPR036097"
                     /db_xref="InterPro:IPR036890"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9J8"
                     /protein_id="SBW13475.1"
                     /translation="MMSRFSALMRTTAARLSALYLLLFAVGAVALVFYMTNLSASILA
                     GQTQQALGEEVASIGKSYARGGIPQLVRTIDYRSRQPGAYLYLVADPTGRILAGNVES
                     VEPGVLNTDGIIERAFTYRRYGEQAPQVEHRAIAVVIALPNGMRLLVGRDLGEPERFR
                     DLIRNSLVLALGIMGVGALLIWLFVGRRALKRIDDVSRASQRIMDGDLTGRLPVNGSG
                     DEFDRLSGNLNVMLARILELNEGLKQVSDNIAHDLKTPLTRLRNRAEEALGGEKVEPE
                     YRAALEDIIGESDQLIRTFNAILMISRLEAGYSSENLDDMPVAPIIRDVVEMYEPVAE
                     DAGVTLTLGALDDVALHINRELVGQTVSNLVDNAIKYAGGEERTATVTLLMEKDAQWV
                     RIVVADNGPGIPADKRDHATERFVRLEESRTQPGSGLGLSLAKAVMKLHGGALRLEDN
                     GPGLRAVLEFPLPHREVG"
     CDS             289310..292261
                     /codon_start=1
                     /transl_table=11
                     /gene="glnE"
                     /locus_tag="BR10RB9215_C10281"
                     /product="bifunctional glutamine-synthetase
                     adenylyltransferase/deadenyltransferase"
                     /EC_number="2.7.7.42"
                     /db_xref="GOA:A0A1M4L9M4"
                     /db_xref="InterPro:IPR005190"
                     /db_xref="InterPro:IPR013546"
                     /db_xref="InterPro:IPR023057"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9M4"
                     /protein_id="SBW13476.1"
                     /translation="MTVENAKALFFERNLCALTPLDPERASGFLADLEARAREEELAG
                     VVALLGRKKAADFLSAILDLSPFIREALTRQPRILDRIVSATPESALEAILDEISAIG
                     TVAGVSESELMTSLRQLKREAHVLIALCDLARIFNTETTTDQLTDLAEACTGAAVRFL
                     LLDADAAGRINLPDRSNPEKDCGWIVLGMGKFGARELNYSSDIDLIVFIDETRPAIGD
                     PYECVDTFSRLTRRLVRILQDRTGDGYVFRVDLRLRPDPGSTPLAIPVGAALHYYEGR
                     GQNWERAAMIKARPVAGDRLSGKQILAELSPYVWRKYLDYAAIADVHSIKRQIHAHKG
                     HGDIAVRGHNVKLGRGGIREIEFFVQTQQLIAGGRFPELRGNQTVPMLARLAERGWIT
                     QQARDALAQEYWFLRDVEHRIQMIADEQTHILPEDDEGFARVSHMMGYADPAEFSEIF
                     LAALKVVEKHYAALFEQAPELGAASGNLVFTGDVDDPGTLETLAAMGYERPSDICRVI
                     RTWHFGRYRATQSAEARERLTELTPALLKAFAETRRADESLLRFDGFLQGLPAGIQLF
                     SLLQSNPRLLNLLVMIMSAAPRLADIITRNPHVFDGLLDPAIFSEVPTRAYLEERLRA
                     FLGSATDFEEVLDRLRIFAAEHRFLIGIRLLTGAINGVRAGQAFSDLAELMVGRALEA
                     VEAELQRRHGKVKGAKVALLAMGKLGSRELTAGSDVDLILLYDHDKDAEESDGEKPLA
                     PSQYYIRLTQRLIAALSAPTAEGVLYEVDMRLRPSGNKGPVATHIEAFGKYQRNDAWT
                     WEHMALTRARPIHGGEAFIARIKADIEDVLAMPRDVRKLAGDVREMRDLIAQEKPPRD
                     DWDLKLKPGGIIDLEFIAQFATLAGYVKKTPRPFATEEVLANLDPSFATPAMVDGLVE
                     AHRFYTNLSQAIRLCLNDSAGLDQFPPGMRELLCRVAGLPDIERIEYELLEHYRLVRA
                     AFDKLVGHGAD"
     CDS             complement(292305..294416)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10282"
                     /product="hypothetical protein"
                     /db_xref="GOA:A0A1M4L9M8"
                     /db_xref="InterPro:IPR002654"
                     /db_xref="InterPro:IPR007016"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9M8"
                     /protein_id="SBW13477.1"
                     /translation="MILPVFVINMASQPAAYKTVAASIEAYGQGFQLHRIDAVNGHTA
                     TQRIGIDDARFDAINGREMLPGEYGCYRSHLKALESFLSDGSPYGLILEDDVVFTETT
                     SARIHDIIKSLPDFDVVKLVNHRSPLFMSLLETDAGDRIGRAIHGPQGSAAAYLVSRE
                     GARKLLSALSTMELPWDVAMERFWHHKARLFSSDENILAFSSHSEISNISDQNSGYDE
                     AKHPWYMRLRTSLFRTFDYYVRVHHTLLQPQNPDGSSIKSQSGAYRLPGISLTGELIA
                     AISLLVFMSTVWVETDAYRYIALGFVVAALIRYARTDFWKYEKPMVGWAGLLCVAWTF
                     YVLVRFAYIYLFYPEMGTGSAEGIYLFPLFYPTLGFALLLFIRRPFLIAVAFMAISLV
                     ILIFGFHYDLSWNERAVTLLQHNPIHAAVSSGFIALCAMAFGIHTLNRNTLDTRARVV
                     LCLLALATFIAALIAIYSLYSKGVWLAMAIAFPTFVVLVALTDKSQTSRMAALVCILI
                     GLLSVFAGEHILQRVGGNTANTSWELLSDLKTGDNIMQDFDKAIKNPETGLSERERLM
                     IWANTLHIWHKNPIFGAGVSWLHYWEKRPYQQTDFTLLHNGYLEIAIRYGFLGLLFYG
                     VLTVWAVRCTWQATRAGLIDSAAFQCYVATLVFFAVTILSNSNVRLAIGESYMALAFG
                     FAFYCQYLLQQHNRQYPRTYF"
     CDS             complement(294690..297041)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10283"
                     /product="sensory box histidine kinase"
                     /db_xref="GOA:A0A1M4L9K8"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR001610"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="InterPro:IPR013655"
                     /db_xref="InterPro:IPR035965"
                     /db_xref="InterPro:IPR036097"
                     /db_xref="InterPro:IPR036890"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9K8"
                     /protein_id="SBW13478.1"
                     /translation="MASTDAYGAPAGTHCESGRKKRKGRLSGHVSLLAGPAYSKFIII
                     EPILRRLVPALIIIFLIILGVARVFSLLAWRDDIELQHKAALSGATAHLAQMIERVAN
                     GIETGAQLSAKDLQDAMTELRSRGLTSSGMTIAIVDAQSMIKAASGPAGIAGSQIDTI
                     LGDAQPLFLFAERAGVLRVVLQGEAAFGALAKPMTAPYSIIAVEPESTIFAEWKRAVS
                     LNVTLFAGTIGVMFAILYAYFSQAARAREADDLSGQIQRRIDMALARGRCGLWDWDMA
                     RGRIYWSRSMYEMLGYEAQDAVLPFGDVAAIINEEDGDLYSIAEQAAAGDISHVDRVF
                     RMRHADGSWVWMRVRAEIASEGDLHLVGIAFDVSEQHRFAQQTAEADMRIREAIENIS
                     EAFVLWDANNRLVMANSKFSEYAGLPVWTLKPGVPRNEVDAHTRPFTFERRMANEHNR
                     AGGQTFERQLSDGRWLQVNERRTQDGGMVSIGTDITQLKLHQERLVDSERRLMATVHD
                     LSIARKGERDRVRELSELARKYSLEKERAEAANRAKSEFLANMSHELRTPLNAIIGFS
                     EMIQAGTFGPLGSDRYEEYINDIHTSGNFLLNVINDILDMSKIEAGHFSLDREEIDLC
                     PLINETVRIISLQAEEKNIAVETRIEDAMELYADRRAIKQVLINLLSNAVKFTSYGGR
                     ITVRARKTGAALFMTIQDTGVGIPKSALRKIGQPFEQVENQFTKTHTGSGLGLAISRS
                     LAELHGGWLRIRSTERVGTVVSVCIPDRNPAPNAGHDARTHAA"
     CDS             complement(297432..300083)
                     /codon_start=1
                     /transl_table=11
                     /gene="pepN"
                     /locus_tag="BR10RB9215_C10284"
                     /product="aminopeptidase N"
                     /EC_number="3.4.11.2"
                     /db_xref="GOA:A0A1M4L9R1"
                     /db_xref="InterPro:IPR001930"
                     /db_xref="InterPro:IPR012779"
                     /db_xref="InterPro:IPR014782"
                     /db_xref="InterPro:IPR024601"
                     /db_xref="InterPro:IPR027268"
                     /db_xref="InterPro:IPR035414"
                     /db_xref="InterPro:IPR037144"
                     /db_xref="InterPro:IPR038438"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9R1"
                     /protein_id="SBW13479.1"
                     /translation="MRTETGHTFRLEDYRQTPYAIPETKLDFTLEPEKTIVCATLTIE
                     RRPDTPAGTPLVLHGDELKLVSLAIDGKALSDNSFSATPDQLTISDLPKDARFTLQIV
                     TEVNPTANRQLSGLYRSSGVYCTQCEAEGFRRITYFYDRPDVLSVYTVRVDADRKAAP
                     ILLSNGNPVENGMVEGHPERHFAVWHDPHPKPSYLFALVAGSLGVVKDHFTTRSGRPV
                     DLAIHVEHGKEGRALYAMDALKRSMKWDEEKFGREYDLNVFNIVAVSDFNMGAMENKG
                     LNIFNDKYVLADPETATDADYAGIEAVIAHEYFHNWTGNRITCRDWFQLCLKEGLTVY
                     RDHEFSADQRSRPVKRIAEVKILKAQQFPEDAGPLAHPVRPREYREINNFYTATVYEK
                     GSEVVRMIRTIIGPELFRKGMDLYFERHDGDAATIENFIQVFADVSGQDFSQFALWYD
                     QAGTPKVEAGFHHDAAAKTFTIKLEQSLAPTPGQSIRKPMHIPIAFGLIGPDGKDMQP
                     SSVEGGEVHDGVIHLRRPSETIVFHGIEARPVPSLLRGFSAPVNLAAPLMAEDRIFLA
                     LNDSDPVARWQAMNSLFSAALLDGAKRVRGGHQPETDPKIVALAGKVAFDEMLDPAFR
                     ALCLTLPSESDIAHEMGNNVDPDAILASRNHLIAAIASAYADGFAGLYDKLKQEGAFS
                     PDAAPAGKRALRSALLDYLSVQEKSPERAERQFVEADNMTDRATALTVLVHRFGDSGE
                     ARQALATFEQKFGQDALVMDKWFIVQATRPGETALEAVRELTRHPLFSLDNPNRVRAL
                     IGAFTASNPTGFNRQDGAAYGFLADTLLTIDPKNPQLSARLLTAMRSWRSLEEVRREH
                     ARAALARIAGAGKLSTDLRDIIDRTLA"
     CDS             300309..301268
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10285"
                     /product="hypothetical protein"
                     /db_xref="GOA:A0A1M4L9T8"
                     /db_xref="InterPro:IPR000620"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9T8"
                     /protein_id="SBW13480.1"
                     /translation="MNAHTRAAADAARLEMNPMLGIGLKIASVAVFVAMSTLLKAAEG
                     VPVGQLIFFRSFFAIFAILLYLGWRGQLGGVFSTRHGFSHFWRGLVGVCSMSMSFFAL
                     TKLPLPEAIAINYASPLITVILGAAILHEVVRFYRWSAVLIGLFGVMIIIWPRLTLFS
                     AGSVGRDEAVGALAALGAAVMSAVAMMLVRRLVQTERTPTIVIYFSISASVIALVSLP
                     FGWVVPNWSQLAMLVGAGFAGGIGQILLTECYRHAPMSTIAPFEYTSMLLGLVIGFML
                     FGDIPTFEMLIGSGIVMAAGGFIIYREHQLSLAPHKVNAPQAQ"
     CDS             complement(301272..302528)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10286"
                     /product="MFS transporter"
                     /db_xref="GOA:A0A1M4L9N7"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="InterPro:IPR036259"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9N7"
                     /protein_id="SBW13481.1"
                     /translation="MAGQLLPIAALLASTFLMLLAGGLAGILLPLRGGMEGWSTTTIG
                     WMGTSYSLAFTIGCIFIPHLVRRVGHVRVFSALLTLLSMALLFHALVVNPAAWMIFRG
                     IAGFSLAGSYMIIESWLNERVTNESRGMIFSIYMIITMVGLLLGQYILPFGNAATQTL
                     FIICAIIYASALLPTALSSAQSPNPLTQVSLDLKGLYRRSPAAVVGSFIAGIVAGTWN
                     FLAAIYGEMNGLSTFGIATMLASAMIGGAIFQYPLGRASDFVDRRYMMILAGAIGFTL
                     SFIMVLFHPTSPYTLYAMMFLFGSVVFPIYSLNVAHANDYADASEFVKISGGLLIVYG
                     VGSVLGPAISGPLMDIIGANGFFVIMAIAYCIYGLHAWWRIYRLERPAISDQKTEFKF
                     HTPDGQSTPETMQLDPRAEGTSGQAQ"
     CDS             complement(302690..303562)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10287"
                     /product="phage SPO1 DNA polymerase-related protein"
                     /db_xref="InterPro:IPR005122"
                     /db_xref="InterPro:IPR005273"
                     /db_xref="InterPro:IPR036895"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9Q9"
                     /protein_id="SBW13482.1"
                     /translation="MTDGRETLDIEGLLRFYAEAGVDVPLCETPIDRFAAATHPAPAQ
                     SRMQAAAQQPESNPAQAREERARTVAVPSPSSKPVQAAMDLPDNAQIALAREAASQAE
                     TLEELREKLAAFDGCNLKFTAKNLCFADGNPASDIMFIGEAPGRDEDMEGLPFVGKSG
                     QLLNRMIEAINLKREEVYIANTIPWRPPGNRAPTPLETELCRPFIERQIELAAPKVLV
                     ALGGPAGKALTGAAEGILRLRGNWKTHRTPTGMEIPVMPTLHPAYLLRTPAQKRFAWR
                     DFLAVKLKLAELRG"
     CDS             303952..305643
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10288"
                     /product="electron transfer flavoprotein-ubiquinone
                     oxidoreductase"
                     /db_xref="InterPro:IPR017896"
                     /db_xref="InterPro:IPR036188"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9S5"
                     /protein_id="SBW13483.1"
                     /translation="MSEANELPERESMEFDVVIVGAGPAGLAAAIRFKQINPELSVVV
                     LEKGGEVGAHILSGAVVDPVGIDQLLPGWREEEGHPFKTPVTADHFLVLGPAGSVRLP
                     NFAMPSLMNNHGNYIVSLGNVCRWLGTKAEELGVEIYPGFAATEVLYNDEGAVIGVAT
                     GDMGVERDGTHGPNYTRGMALLGKYVLIGEGARGSLAKQLITKFKLDEGREPAKFGIG
                     LKELWQVDPSKHKPGLVQHSFGWPLDMKTGGGSFLYHLEDNMVAVGFVLHLNYKNPYL
                     SPFEEFQRFKTHPAIRDTFEGGKRLSYGARAITEGGWQSVPKLSFPGGALIGCSAGFV
                     NVPRIKGSHNAILSGILAADKIAEAIAAGRANDEPIEIENSWRASAIGKDLKRVRNVK
                     PLWSKFGTAIGIALGGLDMWTNQLFGFSFFGTMKHGKTDAQALEPAANYKKIDYPKPD
                     GVLTFDRLSSVFLSNTNHDENEPVHLQVRDMELQKTSEHDVFAGPSTRYCPAGVYEWV
                     DADGNAAADPGVKDVRFVINAQNCVHCKTCDIKDPNQNINWVPPQGGEGPVYVNM"
     CDS             complement(305920..307020)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10289"
                     /product="AP endonuclease family 1 domain protein"
                     /db_xref="GOA:A0A1M4L9W4"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="InterPro:IPR036691"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9W4"
                     /protein_id="SBW13484.1"
                     /translation="MLEPCRKRRSSDNQKPIPLFPYSLTPLFPYPIHFLAVIRHYCRL
                     MSKSRLNLPFLILVAATLVSIPLVLSFLNSLHPAFDTFSHLRIHLAVLMGLLALPLLF
                     TKLRREGAVILLLAVFAIAVTPHVFPASEDAHAGEAAQPHYRLLQMNLRFDNGSPEQA
                     LSLIAHIRPDVVTLEEVSSMWREKFGHIASAYPYSIFCPHPGAVFGVAILSRRPFIAD
                     SAPACDPKGMMAVASVDFGGRPVDVAALHLHWPWPFQQSEQIEALSEQFRGLSENAIL
                     SGDLNATPWSATTKRIAELAAMTPAPPTGPTWLYRRLPASLRFAGLPIDQTFAKGRVA
                     ISKITRQQPIGSDHLPVLVEFSIIPQPETVAS"
     CDS             complement(307065..308513)
                     /codon_start=1
                     /transl_table=11
                     /gene="amn"
                     /locus_tag="BR10RB9215_C10290"
                     /product="AMP nucleosidase"
                     /EC_number="3.2.2.4"
                     /db_xref="GOA:A0A1M4L9K6"
                     /db_xref="InterPro:IPR000845"
                     /db_xref="InterPro:IPR011271"
                     /db_xref="InterPro:IPR018953"
                     /db_xref="InterPro:IPR035994"
                     /db_xref="InterPro:IPR037109"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9K6"
                     /protein_id="SBW13485.1"
                     /translation="MEPEVFSDAQAAVAALCKLYERNTAFLRSAFEKVARGEIAPQRY
                     RAFYPEICLSTSSFAHVDSRLAYGHVSTPGDYSATVTRPDLFGYYLREQIRLLMRNHG
                     VTVTVRESSTPIPIHFAFKEGAYVEASVASAFTHPLRDLFDVPDLAATDDKIVNADFE
                     PAPGEPMPLAPFTAQRIDYSLHRLSHYTATSPSHFQNFVLFTNYQFYMDEFCVYARQL
                     MAEGGGGYDQFVEPGNIVTRAGETAPSTGNPLQRLPQMPAYHLQKAGHGGITMVNIGV
                     GPSNAKTITDHIAVLRPHAWLMLGHCAGLRNSQQLGDYVLAHAYMREDHVLDDDLPVW
                     VPLPALAEIQVALEEAVEEITGLQGYDLKQIMRTGTVATIDNRNWELRDQRGPVQRLS
                     QARAVALDMESATIAANGFRFRVPYGTLLCVSDKPLHGELKLPGMATEFYKRQVAQHL
                     RIGIRAMEKIASMPDERLHSRKLRSFYETAFQ"
     CDS             complement(308608..308775)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10291"
                     /product="putative membrane protein"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9N5"
                     /protein_id="SBW13486.1"
                     /translation="MRAGAPSIAAIGLRIFLFTAIFTGPAAAFAYTQIGNHAEMNGAG
                     LVLYMSLQRTA"
     CDS             complement(308772..308939)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10292"
                     /product="putative membrane protein"
                     /db_xref="GOA:A0A1M4L9N8"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9N8"
                     /protein_id="SBW13487.1"
                     /translation="MLLQRFTIVCLMIAGFAAFASILTYRTYDIYADQPVVDAVALAH
                     MHDLADGKARQ"
     CDS             309134..309844
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10293"
                     /product="glutathione S-transferase"
                     /db_xref="GOA:A0A1M4L9L9"
                     /db_xref="InterPro:IPR004045"
                     /db_xref="InterPro:IPR004046"
                     /db_xref="InterPro:IPR010987"
                     /db_xref="InterPro:IPR036249"
                     /db_xref="InterPro:IPR036282"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9L9"
                     /protein_id="SBW13488.1"
                     /translation="MAEQTKPIELYYWPTPNGFKISIMLEELGVPYAVKYINIGKGDQ
                     FEPGFLKIAPNNRMPAIIDPEGPGGEPISVFESGAILQYLGRKFGKFYPTDERKRVAV
                     EEWLMWQMGGLGPMSGQAGHFRIYAPEKIQYGIDRYTNEVNRLYGVLNRRLEGRDYIA
                     DEYSIADMACIGWVNAYKNYEQNLDDFANLKRWHETMNARPAVQRGLLFGKEERERAA
                     AAANKEEEQKILFGQKAR"
     CDS             complement(309903..310250)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10294"
                     /product="hypothetical protein"
                     /db_xref="InterPro:IPR019223"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9S2"
                     /protein_id="SBW13489.1"
                     /translation="MIRTLILGVTLAAGFAAPAFADEAIVGTWKRPNGTLISYAACGA
                     NKFCGTVMTGEYKGKSIGTMSGKDGNYKGEVNKLDEGKTYSGKASVKGNTLSLSGCVM
                     GGLICKSESLARQ"
     CDS             complement(310247..310486)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10295"
                     /product="hypothetical protein"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9V1"
                     /protein_id="SBW13490.1"
                     /translation="MITIGRIGMVRIGAKRALQTAMMKLKIAPSASPETRLRLRLRKL
                     MRGAERMLLQRLKRMNSGFIAAPTIRDSRHFGRNE"
     CDS             310756..311013
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10296"
                     /product="hypothetical protein"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9P7"
                     /protein_id="SBW13491.1"
                     /translation="MAQFQSFNHNENPAAQDRILLEMGMKYAIGRDCEIDVIEAHKWL
                     NIAAIRGNQKAERMRNQVAATMSKSELAAALRCAREWMTAH"
     CDS             complement(311072..311842)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10297"
                     /product="hypothetical protein"
                     /db_xref="GOA:A0A1M4L9R8"
                     /db_xref="InterPro:IPR003740"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9R8"
                     /protein_id="SBW13492.1"
                     /translation="MQSDSGEDGIFGTALFRCFTHYPTQSRFALLLEMLWSLKLADIA
                     DSAPSLADASSPISVDRHRLYEDAIAMLIGTSFIALGITLYSHAMLMTGSTAGIALLI
                     HYATGTGFGILYFLINLPFYYFAVRRMGWAFTIRTFAAVALLSGFTRLMPLNVDFTSI
                     NPLFAALMGGTLMGMGVLALFRHRSGVGGVNILALYLQDAYGIRAGWFQLGLDVLIML
                     ASLFFIPWENMVLSLVGAVAMNVIIAINHKPGRYIGIS"
     CDS             312497..313147
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10298"
                     /product="hypothetical protein"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9T5"
                     /protein_id="SBW13493.1"
                     /translation="MSIRTITAMAGTAFIMGAAAIAFSSPASALTMKECSTKYQAAKD
                     AGTLGNMKWNDFRKAQCGDDAASAPAAAPAAAPATKKAAKAAAPASNDGARSLTMKQC
                     SAKYQAAKDAGTDNGMKWNDFRKAECGPGADPVALSTDGDSEPAAPSVAAPKGVKFPT
                     AVSAKYSKESAGKARMHTCLDQYHALKDANALGGLKWVQKGGGYYSLCNARLKGNS"
     CDS             complement(313192..313566)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10299"
                     /product="hypothetical protein"
                     /db_xref="GOA:A0A1M4L9X3"
                     /db_xref="InterPro:IPR006696"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9X3"
                     /protein_id="SBW13494.1"
                     /translation="MPSINGQPRSILFGTLAGLCGALGIASYAGAAHMGESHLGTIAP
                     LLLAHAPALLFLSLISPVSRVARVGGAILVVGLALFCGDLFMRDVTGDRLFPFAAPTG
                     GSLMILGWLCLGCSGWFSANTK"
     CDS             complement(313584..314717)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10300"
                     /product="histidinol-phosphate transaminase"
                     /db_xref="GOA:A0A1M4L9M1"
                     /db_xref="InterPro:IPR001917"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9M1"
                     /protein_id="SBW13495.1"
                     /translation="MAQPRLTPLVESLPSTVPFIGPETLELQRGKPFKARIGANESSF
                     GPAPSVIEAMRNEATEVWKYGDPENYALRHAIAAHHGLKAEHIMPGAGVDALLGLIVR
                     QYVQQGDKVINSLGGYPTFNYHVAGYGGQLVTVPYRDDKPDLDALIDAAAREKPALLY
                     IANPDNPMGTWHEGADIQSFIERLPETTLLILDEAYCETAPASAFPPFETDRPNVLRM
                     RTFSKAYGLAGIRCGYAVGNPVAIKTFDKVRDHFAVSRMAQAAAIAALKDQAYLHEVV
                     GKICAGRDRIAAIAEANGLHAVASATNFVAIDCGRGKDFAQAVLNGLISRDIFVRKPG
                     TPVLDRCIRVSVGVKEQLDQFEAAFPEALEEARKICAANAENT"
     CDS             complement(315081..316007)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10301"
                     /product="site-specific tyrosine recombinase XerC"
                     /db_xref="GOA:A0A1M4L9P4"
                     /db_xref="InterPro:IPR002104"
                     /db_xref="InterPro:IPR010998"
                     /db_xref="InterPro:IPR011010"
                     /db_xref="InterPro:IPR013762"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9P4"
                     /protein_id="SBW13496.1"
                     /translation="MIIVGETKIDTGDKYAPIIDYNLNYISGKNPKHRLVEHYSVAEL
                     TAKYINILWDDGSHKYNVRSFLGEIDEILKGARFSGFDQEMLDSIIGTLRERGNSNAT
                     INRKMAALSKLLRKAHKMGDIFNLPEFIRQKERVGRIRFLEQEEEKRLFAAIKSRCEN
                     SYRLSVFLVDTGCRLGEAIGLTWNDIQEQRVTFWVTKSNRSRTVPLTRRARKASHIPH
                     ERLKGPFSMLNQVRFRQIWNEAKAEVGLGADDQIVPHILRHTCASRLVRGGIDIRRVQ
                     MWLGHQTLQMTMRYAHLATHDLDSCVKVLEIH"
     CDS             complement(316282..317385)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10302"
                     /product="Outer membrane protein IIIA"
                     /db_xref="GOA:A0A1M4L9P5"
                     /db_xref="InterPro:IPR003684"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9P5"
                     /protein_id="SBW13497.1"
                     /translation="MNIKSLLLGSAAALVAASGAQAADAIVAPEPEAVEYVRVCDAYG
                     AGYFYIPGTETCLRISGYVRYDVKGGDDVYTGSDRKGWDKGARFALMFNTNSETELGT
                     LGTYTQLRFNYTSNNSRHDGQYGDFSDDRDVADGGVSTGTDLQFAYITLGGFKVGIDE
                     SEFHTFTGYLGDVINDDVVAAGSYRTGKIAYTFTGGNGFSAVIALEQGGEDVDNDYTI
                     DGYMPHVVGGLKYAGGWGSIAGVVAYDSVIEEWATKVRGDVNITDRFSVWLQGAYSSA
                     ATPNQNYGQWGGDWAVWGGAKFIATEKATFNLQAAHDDWGKTAVTANVAYQLVPGFTI
                     TPEVSYTKFGGEWKDTVAEDNAWGGIVRFQRSF"
     tRNA            complement(317568..317657)
                     /locus_tag="BR10RB9215_C10303"
                     /product="tRNA-Ser"
                     /anticodon=(pos:complement(317621..317623),aa:Ser,seq:gct)
     CDS             318226..319314
                     /codon_start=1
                     /transl_table=11
                     /gene="omp2b"
                     /locus_tag="BR10RB9215_C10304"
                     /product="porin Omp2b"
                     /db_xref="GOA:A0A1M4L9N1"
                     /db_xref="InterPro:IPR003684"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9N1"
                     /protein_id="SBW13498.1"
                     /translation="MNIKSLLLGSAAALVAASGAQAADAIVAPEPEAVEYVRVCDAYG
                     AGYFYIPGTETCLRVHGYVRYDVKGGDDVYSGTDRKGWDKSARFALRVSTGSETELGT
                     LKTFTELRFNYAANNSGVDGDYGNETSSGTVMEFAYIQLGGLRVGIDESEFHTFTGYL
                     GDVINDDVISAGSYRTGKISYTFTGGNGFSAVIALEQGGDNDGGYTGTTNYHIDGYMP
                     DVVGGLKYAGGWGSIAGVVAYDSVIEEWAAKVRGDVNITDQFSVWLQGAYSSAATPDQ
                     NYGQWGGDWAVWGGLKYQATQKAAFNLQAAHDDWGKTAVTANVAYELVPGFTVTPEVS
                     YTKFGGEWKNTVAEDNAWGGIVRFQRSF"
     CDS             319458..320099
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10305"
                     /product="hypothetical protein"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9T1"
                     /protein_id="SBW13499.1"
                     /translation="MKKWFWPCLTWTACLTALALWFGADRVETDIAEQTAKALEPYVW
                     TGFDVDGRDVVLKGMAPDPDMQRAAHAALEHVWAIRDITDLTTVLQLASPYRFKIARD
                     AQELVLSGFIPNNESRDQVVAVAGEVAPDISIDDEMAVARGNQPEFMERVLFAIDLAK
                     KLPEAEIEIADEKLSIRGTVSDEAIYDEIEALKAAQLPYGLKLAVLDVKKSVQ"
     CDS             320426..321079
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10306"
                     /product="hypothetical protein"
                     /db_xref="GOA:A0A1M4L9V7"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9V7"
                     /protein_id="SBW13500.1"
                     /translation="MPLLIVQLAILIAVAFVVGCFLGRILRRRKSAGSDHERTIVAAA
                     LSTPPLAEKPEPVPPAEPVRADSDPLKAKAGSVKARIEPVEASADSDVAAAPVLQEAL
                     PETPEDADRPQWREAPRRGKADELTAIEGIGKAIEAVLHELGIFHYDQIAQWTREEAI
                     WIERRIGFPGRVEREGWIAQAAKLAEPPAKSTTKRGAKTKKAANARSGTRRAKKQAG"
     CDS             complement(321144..323282)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10307"
                     /product="transglycosylase"
                     /db_xref="GOA:A0A1M4L9Q7"
                     /db_xref="InterPro:IPR008258"
                     /db_xref="InterPro:IPR008939"
                     /db_xref="InterPro:IPR023346"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9Q7"
                     /protein_id="SBW13501.1"
                     /translation="MFKKVAAISSRRTVLLAGCFIAAAVQPMVSFAQSSLPPEIPTPL
                     ARPFAPTATHQSPISLVTPRPRPIAPDPMATSAVSRTDNPAVIGGTLKNGLDALSAKN
                     VASAIASRNSLPRGSLDHQILTWAIATSGMDGVPSTEIAAAASELSGWPGMATLRRNS
                     ERALFKENPSSATIIATFGSTRPQTTEGMIALARAYVATGNSTKAHQLLSPWWTRKRL
                     SSDDEQKILKEFSAILTREDHQRRLLHSLYNGRLQSARLLAGPAQAQSLYNAYAAVAQ
                     KSPNAASAIAAVDRSWQANPVYQFLKIRYLRRAERYNEAAELLLKAPRKASVLVDPDA
                     WWVERRILSRELLDLGKPQLAYRLAAAHAAETPTMAAEAEFHAGWYALRALNQPKLAA
                     PHFAKITQISARPISASRAYYWLGRAAEAGSGGDARAYYRRSAHFGTTFYGQLAAAKL
                     NEKAPELAYPKPTEAERVRFASRPAVQAIKRLEQVGYGSKAAALYTQLSQELDSVGEL
                     ALLAVMAERNDNHYMALRVGKTAAMRGLDVGALSHPLGAIPASANIKGSGKALAYAIA
                     RQESEFNVSAVSKAGARGLLQLMPATAKTVATRNGMSFSAQKLTADAAYNATLGAHFL
                     GEQLDRFNGSYVLTFAGYNAGPRRASEWVEKYGDPRGKSVEQVVDWIERIPYSETRNY
                     VQRVMENYEVYKTRLTGRADIKTDLVYGRR"
     CDS             323676..324557
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10308"
                     /product="dihydrodipicolinate synthase"
                     /db_xref="GOA:A0A1M4L9S9"
                     /db_xref="InterPro:IPR002220"
                     /db_xref="InterPro:IPR005263"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR020625"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9S9"
                     /protein_id="SBW13502.1"
                     /translation="MLKGSITALVTPFDREGAFDEKAFRAFVNWQIEEGTKGLVPVGT
                     TGETPTLSHDEHKRVIEVCIEVAAGRVPVIAGAGSNNTVEAIELAQHAEKAGADAVLV
                     VTPYYNKPNQRGLYEHFSRVARSISIPLVIYNIPGRSIIDMTPETMGALVRDCKNIVG
                     VKDATGKIERVSEQRAICGKEFIQLSGEDATALGFNAHGGVGCISVTSNIAPRLCAEF
                     QEACQAGNFAKALELQDRLMPLHKALFLEPNPSGPKYALSRLGRIENVLRSPMVTIEA
                     ATAEKIDHAMKHAGLIN"
     CDS             324648..325124
                     /codon_start=1
                     /transl_table=11
                     /gene="smpB"
                     /locus_tag="BR10RB9215_C10309"
                     /product="SsrA-binding protein"
                     /db_xref="GOA:A0A1M4L9U6"
                     /db_xref="InterPro:IPR000037"
                     /db_xref="InterPro:IPR020081"
                     /db_xref="InterPro:IPR023620"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9U6"
                     /protein_id="SBW13503.1"
                     /translation="MNKPKNSPARKMIAENRKARFNFEILDTLEAGLVLTGTEVKSLR
                     ANQANIAESYASFEDGEFWLINSYIPEYTQGNRFNHEPRRLRKLLVSRREMSRLFNSV
                     SREGMTVVPLKLYFNDRGRAKLELALARGKKTHDKRETEKKRDWNREKARLLRDRG"
     CDS             complement(325261..325932)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10310"
                     /product="phage SPO1 DNA polymerase-related protein"
                     /db_xref="InterPro:IPR005122"
                     /db_xref="InterPro:IPR036895"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9X9"
                     /protein_id="SBW13504.1"
                     /translation="MISEPSPNCSICPRLHAFLQEWRQKEPAWHNAPVPPFLPGSDED
                     VRLLIVGLAPGLRGANRTGRPFTGDYAGELLYSTLCEFGFATGKFEARPDDSLRLLDA
                     CIVNAVRCVPPENKPVGSEINNCRQFLTPMLTRFPNLDAVVTLGTIAHQSTVRALGVP
                     VSRHPFGHGKATDIGPLRIFSSYHCSRYNTNTGVLTDAMFRDVFKNVRAYLSEKAAGS
                     ARLSV"
     CDS             complement(325963..326538)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10311"
                     /product="hypothetical protein"
                     /db_xref="InterPro:IPR021139"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9M9"
                     /protein_id="SBW13505.1"
                     /translation="MFDSREKIALFIDGANLYAASKTLGFDIDYRKLLKAFQKRGYLL
                     RAYYYTALVEDQEYSSIRPLIDWLDYNGYKVVTKAAKEFTDSTGRRKVKGNMDIELTV
                     DAMQLTDTVDHFVIFSGDGDFRSLVEALQRKGRKVSVVSTLTTQPAMISDELRRQADH
                     FIDLVSLKAEIGRDPSERAPRRQEEDFDESY"
     CDS             326935..327336
                     /codon_start=1
                     /transl_table=11
                     /gene="rpoZ"
                     /locus_tag="BR10RB9215_C10312"
                     /product="DNA-directed RNA polymerase subunit omega"
                     /EC_number="2.7.7.6"
                     /db_xref="GOA:A0A1M4L9Q6"
                     /db_xref="InterPro:IPR003716"
                     /db_xref="InterPro:IPR006110"
                     /db_xref="InterPro:IPR012293"
                     /db_xref="InterPro:IPR036161"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9Q6"
                     /protein_id="SBW13506.1"
                     /translation="MARVTVEDCVDKVENRFELVLLAGHRARQISQGAPITVDRDNDK
                     NPVVALREIADETLSPDDLKEDLIHSLQKHVEVDEPEAAPAQIANAAEEIAEGIAEAG
                     EEDVVTFDRMSEEELLAGIEGLVAPEKNDDF"
     CDS             327576..329828
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10313"
                     /product="RelA/SpoT family protein"
                     /db_xref="GOA:A0A1M4L9Q4"
                     /db_xref="InterPro:IPR002912"
                     /db_xref="InterPro:IPR003607"
                     /db_xref="InterPro:IPR004095"
                     /db_xref="InterPro:IPR004811"
                     /db_xref="InterPro:IPR007685"
                     /db_xref="InterPro:IPR012675"
                     /db_xref="InterPro:IPR012676"
                     /db_xref="InterPro:IPR033655"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9Q4"
                     /protein_id="SBW13507.1"
                     /translation="MMRQYELVERVQRYKPDVNEALLNKAYVYAMQKHGSQKRASGDP
                     YFSHPLEVAAILTDMHLDEATIAIALLHDTIEDTTATRQEIDQLFGPEIGKLVEGLTK
                     LKKLDLVSKKAVQAENLRKLLLAISEDVRVLLVKLADRLHNMRTLGVMREDKRLRIAE
                     ETMDIYAPLAGRMGMQDMREELEELAFRYINPDAWRAVTDRLAELLEKNRGLLQKIET
                     DLSEIFEKNGIKASVKSRQKKPWSVFRKMETKGLSFEQLSDIFGFRVMVDTVQDCYRA
                     LGLIHTTWSMVPGRFKDYISTPKQNDYRSIHTTIIGPSRQRIELQIRTREMDEIAEFG
                     VAAHSIYKDRGSANNPHKISTETNAYAWLRQTIEQLSEGDNPEEFLEHTKLELFQDQV
                     FCFTPKGRLIALPRGATPIDFAYAVHTDIGDSCVGAKVNGRIMPLMTELKNGDEVDII
                     RSKAQVPPAAWESLVATGKARAAIRRATRSAVRKQYSGLGMRILERAFERAGKPFSKD
                     ILKPGLPRLARKDVEDVLAAVGRGELPSTDVVKAVYPDYQDTRVTTQNNPAKAGEKGW
                     FNIQNAAGMIFKVPEGGEGAAAKVDPAATTPKPGKRALPIRGTNPDLPVRFAPEGAVP
                     GDRIVGILQPGAGITIYPIQSPALTAYDDQPERWIDVRWDIDDQMSERFPARISVSAI
                     NSPGSLAEIAQIAAANDANIHNLSMVRTAPDFTEMIIDVEVWDLKHLNRIISQLKESA
                     SVSSAKRVNG"
     CDS             329836..330414
                     /codon_start=1
                     /transl_table=11
                     /gene="pyrE"
                     /locus_tag="BR10RB9215_C10314"
                     /product="orotate phosphoribosyltransferase"
                     /EC_number="2.4.2.10"
                     /db_xref="GOA:A0A1M4L9P0"
                     /db_xref="InterPro:IPR000836"
                     /db_xref="InterPro:IPR006273"
                     /db_xref="InterPro:IPR023031"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9P0"
                     /protein_id="SBW13508.1"
                     /translation="MNTEDVLAVFREAGAILEGHFILTSGLRSPVFLQKARVFMHADK
                     TEKLCKALAEKIKAADLGPIDYVVGPAIGGLIPSYETSRHLGVPSVWVERENGVFRLR
                     RFDVPKGARVVIVEDIVTTGLSIRETIDCMKDLGIEVVAAACIVDRSAGKADVGTRLI
                     SLAEYEVPAYPADKLPPELAAIPAVKPGSRNI"
     CDS             330574..331329
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10315"
                     /product="transcriptional regulator, Crp/Fnr famil"
                     /db_xref="GOA:A0A1M4L9U3"
                     /db_xref="InterPro:IPR000595"
                     /db_xref="InterPro:IPR012318"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR018490"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="InterPro:IPR036390"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9U3"
                     /protein_id="SBW13509.1"
                     /translation="MVVVPFALDQNQKLAVRTPCNVCEDCCVRSMAVCSALDDGDLAA
                     LEAIMTSKKLDTNEMLVEEGEPKLRVYSLTSGMLRIYTSLPDGRRQIAGFLFPGDFLG
                     LADDEVYSQSAEAVVPSALCAFSAKEMERLMERFPKLKERLYQMTRLALRTARDNQLV
                     LGRLAPVEKLASFLLVLSARAEKRGEKPNPVHLLMNRTDIADYLGLTIETVSRSFTKL
                     KTQGLIQLRDANTVEILSRRSLAVVAGLDPDNL"
     CDS             331822..333156
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10316"
                     /product="coproporphyrinogen dehydrogenase"
                     /db_xref="GOA:A0A1M4L9W7"
                     /db_xref="InterPro:IPR004558"
                     /db_xref="InterPro:IPR006638"
                     /db_xref="InterPro:IPR007197"
                     /db_xref="InterPro:IPR023404"
                     /db_xref="InterPro:IPR034505"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9W7"
                     /protein_id="SBW13510.1"
                     /translation="MHDDAIRRYAALAVPRYTSYPTAADFVPVGMDTTRRWLRQIGPE
                     ESVSLYIHVPYCSQICHYCGCNAKMAVREDVIENFVNALLGEIRMVSASLTARPRVAH
                     LHWGGGTPSILNAGQFQTVLAAIRTAFDFDPSMEHAIELDPRTVTPLLVKTLAEMGVN
                     RASLGVQDVDSRVQMAIGRVQPIETVAEATRLLREVGINRINFDLIYGLPLQTVETLR
                     ETCERVVTLSPDRVACYGYAHLPQRRANQRLIDENTLPDADERFRQARIVADSFIGFG
                     YQPVGIDHFALPDDDLAIAAREGTLNRNFQGYTNDRCGTLIGFGPSSISQFPGGYAQN
                     ISDVGQYRKRVEAGELATVRGYTLRDTDRIRSAIISALMCNFCVDLNAVAPGMEFSDE
                     FALLRPLVADGLVAVEGRTIRATENGKSLIRLVAAAFDEFRRDSVHGFSFAV"
     CDS             complement(333340..334551)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10317"
                     /product="nitrite extrusion protein"
                     /db_xref="GOA:A0A1M4L9R6"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="InterPro:IPR036259"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9R6"
                     /protein_id="SBW13511.1"
                     /translation="MSVSAAQQPSNSSADNTVLTIILATSLGHFLNDMMQSLLPAIYP
                     MLKENYSLSFWQIGLLTFTFQMTASILQPLVGIYTDRKPMPYSLTFGMGCTLIGLVFL
                     ATAHHYSFLLLGAACVGFGSSVFHPEAARVARLASGGRHGFAQSLFQVGGNFGSSIGP
                     LLAAFIVLPFGQISVSWFSVAALIGMFVLWYVGNWYNRYRLANASKPKPDKTLPLPRN
                     RVIASVAVLALLVFTKYIYMASLTSYYTFYTISHFGVSVQTSQLLLFLFLGAVAAGTI
                     IGGPIGDKIGARKVIWASILGVLPFTLALPYANLEMTAVLTIIIGLILASAFPAIIVF
                     AQELLPGRVGMVSGLFFGFAFGMAGIAAAVLGIVADQKGIEFVYRICSCLPFLGLLTI
                     FLPKLERRRKA"
     CDS             334803..335642
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10318"
                     /product="AraC family transcriptional regulator"
                     /db_xref="GOA:A0A1M4L9U2"
                     /db_xref="InterPro:IPR003313"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR018060"
                     /db_xref="InterPro:IPR020449"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9U2"
                     /protein_id="SBW13512.1"
                     /translation="MPENEDLQRFHEHRIAMLESMTGPAIALPTRYPDGYFVPRHSHS
                     RAQLLCASQGVVLVTTDAGRWMIPSDHAMWIPAGVEHSVAILGDVFMRSIYISVDAIS
                     GVPNYLHVVGLTDLMRCLIIDATSHDSIPAPESRDGLVIELILRDLHTLPEYPLGLPF
                     PSDPRLQKLCRDFVKKPSSRATIDEWADRMAMSRRSFTRHFQRETGVSLSVWRQQACL
                     FAAVPRLSEGEPVTSVALDLGYDSVSAFTTMFRRMLGVPPKFYQPRLDLAPFERSDKA
                     VFG"
     CDS             335692..336267
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10319"
                     /product="hypothetical protein"
                     /db_xref="GOA:A0A1M4L9V4"
                     /db_xref="InterPro:IPR018639"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9V4"
                     /protein_id="SBW13513.1"
                     /translation="MLFQRRYPPTRWERLRLYLWPRRSFSRSFRYGGKRILRITASPH
                     AVAAGLAVGVFSAFTPFFGFHLIIAIVLAYFLAGNVAAAALGTTLANPLTLPFIWGST
                     FELGRFIMSGSVDSVPPVHLGHALETMRFEEVWTPLLKPMLFGSTILGAAFAVLVYFV
                     TRYAVSVFRRRRLERLAEKHRLHRQRELQKA"
     CDS             336264..336668
                     /codon_start=1
                     /transl_table=11
                     /gene="acpS"
                     /locus_tag="BR10RB9215_C10320"
                     /product="4'-phosphopantetheinyl transferase"
                     /EC_number="2.7.8.7"
                     /db_xref="GOA:A0A1M4L9Y9"
                     /db_xref="InterPro:IPR002582"
                     /db_xref="InterPro:IPR004568"
                     /db_xref="InterPro:IPR008278"
                     /db_xref="InterPro:IPR037143"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9Y9"
                     /protein_id="SBW13514.1"
                     /translation="MIVGIGSDLIDIRRVEKTLERHGSRFRDRVFTETEQRKSEGRKQ
                     RAASYAKRFAAKEACAKALGTGIAEGVFWRDMGVVNTPSGKPTMHLTGGAAKQLQKLL
                     PAGTNAAIHLTITDDFPLAQAFVIIEALPVLE"
     CDS             336779..337561
                     /codon_start=1
                     /transl_table=11
                     /gene="lepB"
                     /locus_tag="BR10RB9215_C10321"
                     /product="signal peptidase I"
                     /EC_number="3.4.21.89"
                     /db_xref="GOA:A0A1M4L9N9"
                     /db_xref="InterPro:IPR000223"
                     /db_xref="InterPro:IPR015927"
                     /db_xref="InterPro:IPR019533"
                     /db_xref="InterPro:IPR019757"
                     /db_xref="InterPro:IPR019758"
                     /db_xref="InterPro:IPR036286"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9N9"
                     /protein_id="SBW13515.1"
                     /translation="MSVSSKNETKKSGGLGETISVIVQALLLALIIRTLLFQPFSIPS
                     GSMRPTLLEGDYLFVSKYAYGYSRYSLPFGLDLFSGRIWSAEPKRGDVVVFKLPSDTS
                     VDYIKRVIGLPGDRVQMRGGVLYINDKPVKRERVGTINNPDVTEENRPVEVYRETLPN
                     GVTYDTLELAPNSIGDDTRVFEVPAGHYFMMGDNRDNSLDSRFGVGYVPFENLVGRAN
                     IIFFSIADKASPLEIWKWPTDVRFNRLFTWVSGEPHTAVTGN"
     CDS             337563..338267
                     /codon_start=1
                     /transl_table=11
                     /gene="rncS"
                     /locus_tag="BR10RB9215_C10322"
                     /product="ribonuclease III"
                     /EC_number="3.1.26.3"
                     /db_xref="GOA:A0A1M4L9R7"
                     /db_xref="InterPro:IPR000999"
                     /db_xref="InterPro:IPR011907"
                     /db_xref="InterPro:IPR014720"
                     /db_xref="InterPro:IPR036389"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9R7"
                     /protein_id="SBW13516.1"
                     /translation="MVSANKTASILEERTGHRFLNLKRLERALTHSSVQAPARANYER
                     LEFLGDRVLGLTVAEMLFEAFPEASEGELSVRLNALVNAETCAAIADEIGLADLIHTG
                     SDIKSLNDKRLLNVRADVIEALIATIYLDGGLEAARSFIQRYWKKRSLETGAARRDAK
                     TELQEWAHQQGNVHPVYAILSRSGPDHDPLFLVEVTVKGFAPEKGEGRSKRIAEQSAA
                     EAMLYREGVWKRDGSA"
     CDS             338412..339347
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10323"
                     /product="ribosome-associated GTPase EngA"
                     /db_xref="GOA:A0A1M4L9R4"
                     /db_xref="InterPro:IPR004044"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR005662"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR009019"
                     /db_xref="InterPro:IPR015946"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR030388"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9R4"
                     /protein_id="SBW13517.1"
                     /translation="MNNGTTPAGGETEATQTRSGFVALIGAPNAGKSTLVNQLVGTKV
                     SIVTHKVQTTRALVRGIFIEGPAQIVLVDTPGIFRPKRRLDRAMVTTAWGGAKDADII
                     LVIIDAQGGFNENAEALLESMKDVRQKKVLVLNKVDRVDPPVLLSLAQKANEKVPFDR
                     TFMISALNGSGCKDLAKYLAESVPNGPWYYPEDQISDMPMRQLAAEITREKLYLRLHE
                     ELPYASTVETERWEERKDGSVRIEQVIYVERESQKKIVLGHKGETVKAIGQAARKEIS
                     EILEQTVHLFLFVKVRENWGNDPERYREMGLDFPT"
     CDS             339374..340117
                     /codon_start=1
                     /transl_table=11
                     /gene="recO"
                     /locus_tag="BR10RB9215_C10324"
                     /product="DNA repair protein RecO"
                     /db_xref="GOA:A0A1M4L9Q0"
                     /db_xref="InterPro:IPR003717"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR022572"
                     /db_xref="InterPro:IPR037278"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9Q0"
                     /protein_id="SBW13518.1"
                     /translation="MEWRDEGVILGTRRHGETSAIVEVMTCGHGRHMGMVRGGRSRRM
                     QPLLQPGNHVDVSWWARLDEHMGTFTIEPLGFAAARLIETPVALYGIQLAAAHLRLLP
                     ERDPHRGLYETLRLIIEHFDDPLAAGELLLRFEVMMLEELGFGLDLKECAATGRKDDL
                     IYVSPKSGRAVCREAGAPWADKLLSLPSFVNDTALRASCYDDLDRAFTMTGYFLMRHV
                     WEPRAQTPPDSRSGFLNAVGRAINLSQAS"
     CDS             complement(340095..340604)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10325"
                     /product="hypothetical protein"
                     /db_xref="GOA:A0A1M4L9V6"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9V6"
                     /protein_id="SBW13519.1"
                     /translation="MSRIVVTPLSQLATQITLHRPSHVLTLTSGESAALPAGHGASRL
                     TLIFNDIVEPREGLVAPGESHVRALIDFVQGWPQKAPLLIHCYAGISRSTAAAYIAAL
                     ALDRDMDERRLAERLRRLSPSATPNIRLISIADTMLDRRGRMVEAIKAIGRGAEAYEG
                     EVFSLPVKD"
     CDS             complement(340601..341221)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10326"
                     /product="hypothetical protein"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9X6"
                     /protein_id="SBW13520.1"
                     /translation="MANADRTSGKPRAWQRMLSGRRLDLLDPSPLDVEIEDIAHGLAR
                     VARWNGQTVGEHAFSVAQHSLLVDQIFNRLVPGANIEWQMLALLHDAPEYVIGDMISP
                     FKAVMGGNYKLIETRLESAIHLRFSLPVSPPAKLKTLIKRADQVAAFFEATRLAGFTE
                     AEGVKYFGRPRGLNPVGLDIIPRPTQDVQADFLKRFSALDKARQTA"
     CDS             complement(341221..342084)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10327"
                     /product="aminomethyltransferase, putative"
                     /db_xref="GOA:A0A1M4L9S6"
                     /db_xref="InterPro:IPR006222"
                     /db_xref="InterPro:IPR013977"
                     /db_xref="InterPro:IPR017703"
                     /db_xref="InterPro:IPR027266"
                     /db_xref="InterPro:IPR028896"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9S6"
                     /protein_id="SBW13521.1"
                     /translation="MMTASKTVNLSYRALVHITGEEAEKFLQAVITTNLDQLGPHELK
                     PGALLTPQGKILFDFLVSRIEGGLRFDLPADAAGDFVKRITLYRLRAKAEIVQVPESL
                     VSVCWQGDSPASDNDSIKRDSRFPAQLNVRRLYHQASANAGLDAWVQLRAEYGIAEGE
                     ADFAYGDVFPHDVNFDQTGGVSFPKGCFIGQEVVSRMQHRGTARRRVLIAKSDAPLPP
                     MGTPITVEGREIGAMGSSANHIGLALVRIDRVKDAMDTGNSILAGDAAITLSLPPYVR
                     FGFPEAETGHG"
     CDS             342170..343504
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10328"
                     /product="dihydroorotase"
                     /db_xref="GOA:A0A1M4L9V0"
                     /db_xref="InterPro:IPR002195"
                     /db_xref="InterPro:IPR006680"
                     /db_xref="InterPro:IPR011059"
                     /db_xref="InterPro:IPR011612"
                     /db_xref="InterPro:IPR032466"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9V0"
                     /protein_id="SBW13522.1"
                     /translation="MAATFDTILKGATIVNHDGIGQRDIGIRNGRIAAIGSLAGNSAG
                     EVIDCTGLHILPGVVDSQVHFREPGLEHKEDLETGSLAAVLGGVTAVFEMPNTKPLTT
                     SAEMLEDKIRRGRHRMHCDFAFWVGGTRDNAKDVAELERLPGAAGIKVFMGSSTGDLL
                     VEDDDGVRSILKNTRRRAAFHSEDEFRLKEREGLRVEGDPSSHPVWRDEIAALQCTQR
                     LVRIARETGARIHVLHISTAEEIDFLKDYKDVATCEATPHHLTLSADDYKTLGNLIQM
                     NPPVRDKRHREGVWKGIDQGIVDVLGSDHAPHTLEEKQKTYPASPSGMTGVQTLVPIM
                     LDHVNAGKLSLERFVDLSSHGPNRIFGMARKGRIAVGYDADLTIVDMKRRETITHEQA
                     GSKAGWTPYHGKTVTGWPVGTFVRGIKVMWEAEIVNPHKGEPVEFLEALPRR"
     CDS             complement(343553..344317)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10329"
                     /product="hypothetical protein"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9W0"
                     /protein_id="SBW13523.1"
                     /translation="MALPLFSAKMLLPVGNPSSLKTLATGFILACGIALPASAKDTLQ
                     VALADRSEFLPLSRSSIDANRGNTPALVPLPDALPRAIPKSASDGAPAPLHISKAIPE
                     IHRDFDKLPEPVRAMRERMLEAARSGDIERLRPLLGVQDKATQLALEDNEEDVIDFLK
                     SLSGDEDGREVLAIITDLLDTGYVHLNVGQQNEVYVWPYFYAMPLDKLTPPQIVELFQ
                     IVTAGDFEDMKKAGGYIFYSIGIGPDGSWRFFTAGQ"
     CDS             complement(344366..344623)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10330"
                     /product="hypothetical protein"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4LA00"
                     /protein_id="SBW13524.1"
                     /translation="MEYAPADLDEMIAREKKLVAIEYQNEAWADGMSEGIEPEILAEA
                     AFTTALTELIREVGDDCALDLIEKMREQVIAGTFLSRRILQ"
     CDS             complement(344789..345067)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10331"
                     /product="hypothetical protein"
                     /db_xref="InterPro:IPR012645"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9Q1"
                     /protein_id="SBW13525.1"
                     /translation="MLRLAEVLGSLHYLRNLCGEKGSEWRDRMDAIIAAEKPPEAERL
                     KLVSSFNHGYRVFSDNYARCTPSALAAIDRYMKEGGDLSNEIISRYGN"
     CDS             complement(345252..345695)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10332"
                     /product="MutT/nudix family protein"
                     /db_xref="GOA:A0A1M4L9S7"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="InterPro:IPR015797"
                     /db_xref="InterPro:IPR020476"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9S7"
                     /protein_id="SBW13526.1"
                     /translation="MRTIAVTPIPLQIHGVSTICRREGRFLLVERAKEPWKGWLAFPG
                     GGVEVGETPEEAASRELKEETALDAHSLCHVITIDLAREGNAYEKSYYLSVYRALEIS
                     GTEQPGDDAAAIRWLTVEEMETANVTDSTLDVARMVAQDEDGSGY"
     CDS             345781..346560
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10333"
                     /product="hypothetical protein"
                     /db_xref="GOA:A0A1M4L9S3"
                     /db_xref="InterPro:IPR003738"
                     /db_xref="InterPro:IPR036590"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9S3"
                     /protein_id="SBW13527.1"
                     /translation="MCGRFSLTASRQELETLFGALIAEDFPPRYNIAPTQPILAILAG
                     ETPPPGSNRPDRIAMLVRWGFVPAWVKDPNDWPLMFNIRSETAAEKNSFKAALSHRRA
                     LVPASGFYEWRREGRNKSQAYWVRPRNGGVVAFGALMETWSSADGSQIDTAGILTTSA
                     NGLLQPIHERMPVVVQPEDYRRWLDCKQFLAREVADIMRPVQDDFFEAIPVSSKVNKV
                     ANTSPDLQERVTEDLTQGQPQPKRKKGPEPEEDSGGQLSMF"
     CDS             346615..347229
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10334"
                     /product="transporter, LysE family"
                     /db_xref="GOA:A0A1M4L9R0"
                     /db_xref="InterPro:IPR001123"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9R0"
                     /protein_id="SBW13528.1"
                     /translation="MFPAALSGFLLGASLIIAIGAQNAFILRQGLLRQHVFILCLICA
                     LSDALLISAGVAGLGTLIAQSPKLIAFVTLAGAAFLFWYASVAFRRAFHPEAMQVKSN
                     GAVSLKAAAATCLALTFLNPHVYLDTVLLIGSLSARLEGPARAAYGAGAATASCIWFF
                     ALGYGARLLQPIFAKPAAWRVLDCIIGVVMALIGLSLSARFFHG"
     CDS             complement(347206..347373)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10335"
                     /product="hypothetical protein"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9W6"
                     /protein_id="SBW13529.1"
                     /translation="MSKNDLQSRPERLVDQYRDIGPAVLVAACKATHRTGNQQRSNLD
                     RPSILAVKKPG"
     CDS             347740..349260
                     /codon_start=1
                     /transl_table=11
                     /gene="cysS"
                     /locus_tag="BR10RB9215_C10336"
                     /product="cysteinyl-tRNA synthetase"
                     /EC_number="6.1.1.16"
                     /db_xref="GOA:A0A1M4L9Y3"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR015803"
                     /db_xref="InterPro:IPR024909"
                     /db_xref="InterPro:IPR032678"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9Y3"
                     /protein_id="SBW13530.1"
                     /translation="MPDTAPQLRLYNTLTRTKEVFAPIDAKNVRMYVCGPTVYDFAHI
                     GNARPVIVFDVLFRLLRHVYGAQHVTYARNITDVDDKINARAARDYPDLPFNEAIRKV
                     TESTNAQFQADVTALGNLQPTVQPRATEHMDEMRAMIDRLVQRGVAYVAQDHVLFSPS
                     AMNARKGPRYGALARRSLDEMLAGARVDVASYKRDEMDFVLWKPSKKGEPGWPSPAGI
                     ETLGRPGWHIECSAMSMAKLLEPFGGGLKCDDPERNQFDIHGGGIDLVFPHHENEIAQ
                     SCCALGTERMANIWMHNGFLQVEGQKMSKSLGNFITIRDVLNDGLPQLGEWSDNTVRD
                     RWAGLAARLSMLQTHYREPINWTAQRLAESADELHRWYGLLRDEGFGAREKLSHAGAV
                     AAALCDDLNSWAAITALRQAFKSRDVAALGEGMALMGLFDPYFVTASDVPIFAKADVD
                     ASAIAARIAERLNFINAKNWAEADRIRDELLREGVQLKDGKDLATGERITTWDVVG"
     CDS             349279..349413
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10337"
                     /product="2-isopropylmalate synthase"
                     /EC_number="2.3.3.13"
                     /db_xref="GOA:A0A1M4L9T6"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9T6"
                     /protein_id="SBW13531.1"
                     /translation="MARERIYIYDTTSVDGQQTLPARSQPRSERGRAKAKAGVCLGGQ
                     "
     CDS             349413..351026
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10338"
                     /product="hydroxymethylglutaryl-CoA lyase"
                     /db_xref="GOA:A0A1M4L9V9"
                     /db_xref="InterPro:IPR000891"
                     /db_xref="InterPro:IPR002034"
                     /db_xref="InterPro:IPR005675"
                     /db_xref="InterPro:IPR013709"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR036230"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9V9"
                     /protein_id="SBW13532.1"
                     /translation="MARERIYIYDTTLRDGQQTPGIDFSVEDKKSIVTLLEELGVDYV
                     EGGYPGANPTDTAFFKRRQTARAKFVAFGMTKRAGVSVSNDPGLSSLLQASADAVCFV
                     AKSWDYHVRLALGCTNEENLESITASVTAARMAGREALVDCEHFFDGYKANPEYALAC
                     AKAAYSAGARWVVLCDTNGGTQPLEVAAIVEAVKAVVPGESLGIHAHNDTEQAVAVSL
                     AAIDAGVRHVQGTLNGIGERCGNANLVSLIPTLVLKPYWAERFELGIKPASLKSIMRI
                     SRAFDDILNRPATEQAPYTGTSAFATKAGIHASALMKEPQTYEHIPPESVGNSRRVMV
                     SDQGGKSNFIAELERRGIRVAKDDVRLDTLIALVKEREAEGYAYEGADASFELLARGM
                     LNPQPEFFKVESFRCLVERRFDANGMLKTVSEAVVKVEVDGEMHMSVAEGHGPVNALD
                     IALRKDLGRFQAEIEDLELVDFKVRILNGGTAAITRVLIESGDATGARWRTVGVSDNI
                     IDASFQALMDSVNYKLMKNRARAGLAAAE"
     CDS             351274..352194
                     /codon_start=1
                     /transl_table=11
                     /gene="rarD"
                     /locus_tag="BR10RB9215_C10339"
                     /product="rarD protein"
                     /db_xref="GOA:A0A1M4L9X4"
                     /db_xref="InterPro:IPR000620"
                     /db_xref="InterPro:IPR004626"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9X4"
                     /protein_id="SBW13533.1"
                     /translation="MADQAISDTRLSDSSRGFLMALGAYGLWGALPFYLKALSHVPAM
                     EVVSHRVIWSVPVALVLLILLGQFRGILSAVRQPRMLAMAALTAALVTMNWSVYVWAV
                     AHDQVMGAALGYYINPLFNVVLGRLFLGERLTKTQYVAVGLAFVAVVLLTINAGGLPW
                     VSLALPISFGLYGFFRKSLPMPPLQGFTLEVLILCIPALAYVAWLAATGQDHFVAGPV
                     SNITLLLLAGPFTAIPLILYAGGAKLLRYATLGLMQYMTPTMLFFFAIFIFHEPFSTA
                     QLAAFVLIWAGLALYTWSSLSQHRRNRAQA"
     CDS             352327..354060
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10340"
                     /product="peptidase, M23/M37 family"
                     /db_xref="InterPro:IPR011055"
                     /db_xref="InterPro:IPR016047"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4LA06"
                     /protein_id="SBW13534.1"
                     /translation="MVFGSARVGGEAVFTHNVVTPDGAALAEPLSLNIPKSSSYVHFS
                     LRTHARLCLALVSALAIAGGGLILTTGRLVPHGHAAQPVMVNPANLSHHTAAPKQPRL
                     APQMNVATNRRISKRIDIAEGAGDGDARLYTYQHVVLDLKGGTGSLDANVSPEPSKPA
                     QAALPLAPDQNGIPINVSLARPATAPGHQVHEIVIAPQSREEMGALLQAAGVSSDDSK
                     RLEEALARTVLVPGDNLELLIDKPAGRNKNADKTAHISLARFRHGDAAHAVYGRADDG
                     VFHANGNERLFARLSRDAMLTAYHPQPLQLSDGSISYRLKQAGAPEAVVREVKKLASD
                     NGISLAKNNNSLNLIDLLFRKSEENAPELVYVEFNINGKSKRLYRHEGNGGVDYFNED
                     GSPMTKYLMHKPLPNGRLNDGFGWRIHPVLHVRKHHNGVDYDAPLGSPIVAAGDGVVD
                     LISWQKGYGKYVRIRHQGGYSTTYAHLSAEAKGLKVGKHVKQGEVIAYVGSTGYSTGP
                     HLYYELKVGDKYVDPLTARLNAGEKLTGSSLSSFREEINHVGKIVNEMKLPILDNGSA
                     GSADKPAHNGQ"
     CDS             complement(354128..354958)
                     /codon_start=1
                     /transl_table=11
                     /gene="ksgA"
                     /locus_tag="BR10RB9215_C10341"
                     /product="dimethyladenosine transferase"
                     /EC_number="2.1.1.-"
                     /db_xref="GOA:A0A1M4L9Q8"
                     /db_xref="InterPro:IPR001737"
                     /db_xref="InterPro:IPR011530"
                     /db_xref="InterPro:IPR020596"
                     /db_xref="InterPro:IPR020598"
                     /db_xref="InterPro:IPR023165"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9Q8"
                     /protein_id="SBW13535.1"
                     /translation="MSIDSLPPLREVIERHDLMPKKSLGQNFLFDLNLTSKIARQAGD
                     LRDQPVIEVGPGPGGLTRALLAQGAYVTAIERDDRCLEALAEIAAHYPGRLRIIAGDA
                     LEQDFTALFPEGPKPRIVANLPYNVGTQLLLNWLLVEPWPPFYSSMTLMFQREVAERI
                     VAKPDSDHYGRLGVLAGWRTQAKIAFDVPPQAFTPPPKVMSSVVHIVPRETPLPCRAE
                     KLGQITQAAFGQRRKMLRQSLKSVGGAALLEKTGIDGTRRAETLSVEEFVALANACLP
                     "
     CDS             complement(354955..355986)
                     /codon_start=1
                     /transl_table=11
                     /gene="pdxA"
                     /locus_tag="BR10RB9215_C10342"
                     /product="4-hydroxythreonine-4-phosphate dehydrogenase"
                     /EC_number="1.1.1.262"
                     /db_xref="GOA:A0A1M4L9T7"
                     /db_xref="InterPro:IPR005255"
                     /db_xref="InterPro:IPR037510"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9T7"
                     /protein_id="SBW13536.1"
                     /translation="MRAKPLPPLAVSIGDPSGIGADVALAAWLKRCELSLPPFFLIAD
                     PEQLAARARHLGLAVDFAILSDPREAEAAFGERLPVLALKHSHTESPGKPLPENAAGV
                     IEAIERAVKLTLKGEAAAVVTCPIAKKPLYEAGFQHPGHTEFLAELAGRHRGKPVTPV
                     MMLAGPQLRAVPVTIHIPLSEVPGRLTTAEIVAVSRITANELRERFGIASPRLAISGL
                     NPHAGEGGALGKEDDAIILPAIEQLIREGIDARGPLPADTMFHAPARATYDAAICMYH
                     DQALIPAKALAFDETVNVTLGLPFIRTSPDHGTAFDIAGKGIARPDSLVAAIRLAQQL
                     AENAASGNA"
     CDS             complement(356051..357007)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10343"
                     /product="peptidyl-prolyl cis-trans isomerase, putative"
                     /db_xref="GOA:A0A1M4L9T3"
                     /db_xref="InterPro:IPR015391"
                     /db_xref="InterPro:IPR027304"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9T3"
                     /protein_id="SBW13537.1"
                     /translation="MMFARPLIASMLGAAVCLTALGTVAAPAFAAGESEVKVIVSGNA
                     ITNSDIKHRMAFLKLQRKSGNLNQLARNELTEEMLKRIEMKSRGINISDKEVDDAYAG
                     FASRNKMTLAQLNQVMNQSGVTPEHFKKYIMVQMGWGRLVSARFRATGMVSEQEAVQR
                     MLKNGGKKPVATEYHLQQVIFVVPASKRSPALLAKRRQEANALRARFQNCDSTRQQAK
                     GILDVTVRDLGRIIEPQLPGEWSKDVKAAGVNRTTKPHDTEKGVEFLAVCSTRQVSDD
                     RVAQLVFSMEGADSPAGQEKKAEELSKKYVQELREKATIVNR"
     CDS             complement(357335..359734)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10344"
                     /product="organic solvent tolerance, putative"
                     /db_xref="GOA:A0A1M4L9S0"
                     /db_xref="InterPro:IPR007543"
                     /db_xref="InterPro:IPR020889"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9S0"
                     /protein_id="SBW13538.1"
                     /translation="MGLSNTRMVLPHTLSRLARGTALACVLALPFVSVAILSSPAQAQ
                     DALSANYQSDPNARMLLQADELVYDRDVNTVTAQGKVRIEYDGNRLVADKVTYNQQTR
                     RMTATGNVEIVERDGNRIYSDHIDVTDSFRDGFVNGLRVETTDNTRFVAESAERSNGE
                     ITTFNNGAYTACEPCAKNPDKPVLWQIKARKIIWNSATKTVRFERGRFELFGMPLAYL
                     PAFEMADPTVKRKSGFLFPGFAYKDDLGFGIKNSYFWALAPNYDLTLSTTAYTKQGFL
                     TEAEWRHRLENGEYDFRIAGIHQLKPEEFGVATIDREKTNRGMVASKGNFDINSRWHF
                     GWDVLAQTDHNFSRTYEIQGYNAQTQVSKIYLTGINNRNYFDLNFYRFNVQESYLAGD
                     PNEMYSKQPWVFPSLDYSYTMPEPVYGGELNFTANLQALYRKNADYTNPFISVNENGS
                     WVTKPNPYPRIPGFSGTNLRFTSEAEWKRTFITPSGLVITPLLALRGDAIRVDTNFDP
                     ANAGFTDAVVRSEALRAMATAGLELRWPILFSTTSSTHILEPVAQIFVRNNERYAGQL
                     PNEDAQSFVFDASNLFSRDKFSGYDRVEGGTRANLGLRYSGNFKDSDWALYALGGQSF
                     QLGGLNSYASSDFVNVGADSGLEDARSDYVAMIGTSNSTGLALAARGRFGKDDFAVQR
                     GEFEAQQSWEKLTVSGQYAYIAPQPAYGYSDLRQEVTGSATARINTNWRVFGSGTYDL
                     VSDTLVRASSGLAYDDECFTYSMAYIQTRNPGDEKASHSVGFTISLRTLGDFGNGSQT
                     F"
     CDS             complement(359734..360822)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10345"
                     /product="permease YjgP/YjgQ family protein"
                     /db_xref="GOA:A0A1M4L9X7"
                     /db_xref="InterPro:IPR005495"
                     /db_xref="InterPro:IPR030923"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9X7"
                     /protein_id="SBW13539.1"
                     /translation="MIGWTLGRYFFTRYVQITLYFLLGIFALALLLDFTENASRLANL
                     PAYTVWAALGLSAMRVPFIMQQMIPFVALFSAMATLISLNRKYELVVARSVGVSAWQF
                     LLPACFGALLFGLATIFILNPLAAHGFSKAEEIAAMWKTGKVTDVSALRDPWLRQKTD
                     EGETIIGAKSILNQGTTLADATFIQFDEQKNTKDRYDARTATLQDGYWELTDVMRFAR
                     GQEPQKLETFRISTQLRPEYVEEKLASPETIPFTQLRHKIEVARSFGYSANAFDMQYQ
                     SLLALPALLMAMTLIAATVSLKFVRFGQSGAMILGGVIAGFVLYVVSVLVKAFGDAGF
                     VPPFVAAWVPVVIATFFGVSFLLHKEDG"
     CDS             complement(360819..362027)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10346"
                     /product="permease YjgP/YjgQ family protein"
                     /db_xref="GOA:A0A1M4L9Z3"
                     /db_xref="InterPro:IPR005495"
                     /db_xref="InterPro:IPR030922"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9Z3"
                     /protein_id="SBW13540.1"
                     /translation="MRLIELYILRRVAIMFFAVLGAAVGITWTVQVLQRINFLTTSGQ
                     TFQTIVQFSSLLIPSAIPLVMPFALIIAITQTLSTMNQDSELVVINASGAPRSAVMRP
                     ILILAATVSVTSFLIANYVEPYARINMRAMIANASADLMHVIIQEGTFRKLADNLYIQ
                     VAERRADGSIGGLFIADSRDPTLDLIYYAADGAIASTPSGDMLLMENGEVQRRNVSDG
                     TVSIIKFDSYAFDLNQFASAGDDFVIFAKDRPLTYLLNPDPNDPMLQTRPLTYKAELH
                     RRFTQWIYPLIFAMIALAIAGDSRSHREARVSASFSAISTALLVYWAGYFASDRADKD
                     PSYILVMYLVPLVVFLVTGFILLTGRRIGLPDKWSDRILDFLDNARRRLGEFYARFTG
                     RPRNNAGGRL"
     CDS             362437..363930
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10347"
                     /product="leucyl aminopeptidase"
                     /db_xref="GOA:A0A1M4L9U5"
                     /db_xref="InterPro:IPR000819"
                     /db_xref="InterPro:IPR008283"
                     /db_xref="InterPro:IPR011356"
                     /db_xref="InterPro:IPR023042"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9U5"
                     /protein_id="SBW13541.1"
                     /translation="MSKRPSISFSEFEVPQKGVAVVLVAKGGGFADEAAKAVGGAEKI
                     ARIADISGFTGALGKTAEAIETTPAGVEKIVLVGVGEPGKLGNDDWLKIGGAAFAQIG
                     NAERVTVTLALPETTIAGDEAADVALGMVLRSYKFDRYKTRKSEENGEPKHAAKITIC
                     VADTHGARKAFEVAEAVADGVIQARNLVNEPANILGPVEFAEEAEKLEKLGVKVEVLG
                     EKELKKLGMGALLGVAQGSVRPPRLVVMEWHGAKGKEKPIAFVGKGVVFDTGGISIKP
                     AANMEDMKGDMGGAAAVTGLMRALAGRKAKVNAIGVIGLVENMPDGNAQRPGDIVTSM
                     SGQTIEVINTDAEGRLVLADALHYTNDRFKPRFIINLATLTGAVMVALGQYHAGLFSN
                     DDELADQLYDAGQSTGEKLWRLPLGTEYDKMIDSKFADMKNSAGRYGGSITAAQFLKR
                     FVGETPWAHLDVAGTAMGSPANEYNQSWASGFGVRLLDRLVRDQFES"
     CDS             364002..364451
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10348"
                     /product="DNA polymerase III subunit chi"
                     /db_xref="GOA:A0A1M4L9W9"
                     /db_xref="InterPro:IPR007459"
                     /db_xref="InterPro:IPR036768"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9W9"
                     /protein_id="SBW13542.1"
                     /translation="MAEILFYHLTESTLDEALPGLVERSLGRGWRVTVQTVSEERRDA
                     LDSLLWTFSDTSFVAHGTDKEPNPEHQPVLLTTTETNPNGATVRFLVEGAKLEQAGDY
                     ERLVVMFDGHDQDQLDIARTQWKAFKAENHDLTYWQQTPDRRWERKA"
     CDS             364451..365014
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10349"
                     /product="hypothetical protein"
                     /db_xref="GOA:A0A1M4L9Y2"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9Y2"
                     /protein_id="SBW13543.1"
                     /translation="MRPVLFLMIAAGIALGIGYPWYMRHFTGSEIGRWTMLENRQSGF
                     KVQEVRLAASDAPVRVFIDATPLPGYVPAERRSAVTLAVSRDGQPVLSQGLDFVSTSG
                     SINTDRPQDGHVLRQSAGDIDPVIPGLYAFRLVQGNTDGLQLSKADLVLRRGAQTPNE
                     TYTTIGLVLGVLGLYGLMRTRLRRPQT"
     CDS             complement(365091..366974)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10350"
                     /product="putative ABC transporter, ATP-binding protein"
                     /db_xref="GOA:A0A1M4LA15"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR032781"
                     /db_xref="InterPro:IPR037118"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4LA15"
                     /protein_id="SBW13544.1"
                     /translation="MLILDDISVRIAGRLLIDHASVTLPAGSKTGFVGRNGTGKSTLF
                     RVITGDLAPETGSISFPKNTRIGQVAQEAPGTEEPLIEIVMKADKERAALLEEAATAT
                     DPHRIAEIHTRLADIDAHSAEARAGAILSGLGFDAQAQRQPASAFSGGWRMRVALAAV
                     LFAEPDLLLLDEPTNYLDLEGVLWLVDYVKRYPHTVIIISHDRDLLNSATSSIMHLDQ
                     KKISFWRGNYDQFERQRHEMLELQQKAHARQEAHRKHMESFVERFRAKATKARQAQSR
                     LKALQKLKPIELYVESHVQPFRFPDAEKKAASPIIALDGADVGYVPGKPVLRNVTLRI
                     DNDDRIALLGSNGNGKSTLAKLIAGRLAPEKGTLTISPNLKVAFFAQHQLDDLVPEDN
                     AIEHVRKLMPAEPEARVRARVAQMGLSTEKMLTPARDLSGGEKARLLMGLATFHGPNL
                     LILDEPTNHLDIDSREELVHALNAFNGAVILIAHDRHLIEATMERLWLVREGGVKPFE
                     GDLDEYRQIVLADAKGEPAADRDEGPKVNKAEQRKLAAQKREALAPLQKKIKETESLI
                     QKLQKQIQDFSMQLEDPALYEKEPQKAIRINKDMSDAKSTLAEAEDKWLELSAEYEEA
                     MAE"
     CDS             complement(367017..367529)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10351"
                     /product="hypothetical protein"
                     /db_xref="InterPro:IPR007837"
                     /db_xref="InterPro:IPR034660"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9S1"
                     /protein_id="SBW13545.1"
                     /translation="MEQHFQMFAYYNQWANKLLYDRAAQLSDEEYRLDLGLFFGSIHR
                     TFNHLLVADRIWMKRFTNEGDHPKTLDTIISDNFITLREKRQAEDERICRFTDSLDAE
                     RLSGRYSYTALNSMRTISQRLAPSMAHFFNHQTHHRGQIHAALTRIGAEAPSLDLVHF
                     LQQETGRRFA"
     CDS             367758..368180
                     /codon_start=1
                     /transl_table=11
                     /gene="ndk"
                     /locus_tag="BR10RB9215_C10352"
                     /product="nucleoside diphosphate kinase"
                     /EC_number="2.7.4.6"
                     /db_xref="GOA:A0A1M4L9U7"
                     /db_xref="InterPro:IPR001564"
                     /db_xref="InterPro:IPR023005"
                     /db_xref="InterPro:IPR034907"
                     /db_xref="InterPro:IPR036850"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9U7"
                     /protein_id="SBW13546.1"
                     /translation="MAIERTFSMIKPDATRRNLTGAIIAKLEEAGLRVVASKRVWMSR
                     REAEGFYAVHKDRPFFGELVEFMSSGPTVVQVLEGENAIAKNREVMGATNPANADEGT
                     IRKTFALSIGENSVHGSDAPETAAEEIAYWFSGTEIVG"
     CDS             complement(368287..369177)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10353"
                     /product="hypothetical protein"
                     /db_xref="GOA:A0A1M4L9U4"
                     /db_xref="InterPro:IPR005184"
                     /db_xref="InterPro:IPR038670"
                     /db_xref="InterPro:IPR039366"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9U4"
                     /protein_id="SBW13547.1"
                     /translation="MATIPDRIKGIYLLSDMNNDWGTKVRILTMRQGLAKTLSIAAAF
                     VVGIGALGGAAVFVATSMPTTSVAAEKTISGKVLYRERIALPPEASLVVQLVDMSVAD
                     TPSRALGETRIESVQGSPIPFAISFDTNAIEQGHSYALQARISAGDTLWFVNDERYVI
                     DPENPAAPLDINVVMVRKNTDDATSIGIEGKDWLAEDIQGSGVIDDAQTTLNVATDGA
                     VSGSGGCNRYFSKATVTGENIAFAEIGSTYVQCPPALMNQERKFLDVLGKTRSYKIEM
                     GKLMLLDESGKEIARLAQSL"
     CDS             complement(369324..369815)
                     /codon_start=1
                     /transl_table=11
                     /gene="moaE"
                     /locus_tag="BR10RB9215_C10354"
                     /product="molybdopterin converting factor, subunit 2"
                     /db_xref="GOA:A0A1M4L9S8"
                     /db_xref="InterPro:IPR003448"
                     /db_xref="InterPro:IPR036563"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9S8"
                     /protein_id="SBW13548.1"
                     /translation="MDGQPTCPLSISVRSEDFDIAAEIDRIGKNRREIGAIVTFTGLC
                     RDEDGQLAALELEHYPGMAQAEISRMAKQAMERWPLNGLTVIHRYGLIKPGENIVLVV
                     AASRHRHAAFEAASFLMDYMKTNAPFWKREHLADGTAGGWVSSKEEDEESRKRWEEPR
                     KSE"
     CDS             complement(369817..370074)
                     /codon_start=1
                     /transl_table=11
                     /gene="moaD"
                     /locus_tag="BR10RB9215_C10355"
                     /product="molybdopterin converting factor, subunit 1"
                     /db_xref="GOA:A0A1M4L9Y5"
                     /db_xref="InterPro:IPR003749"
                     /db_xref="InterPro:IPR010034"
                     /db_xref="InterPro:IPR012675"
                     /db_xref="InterPro:IPR016155"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9Y5"
                     /protein_id="SBW13549.1"
                     /translation="MSVKLVYFAWVREKIGKGEEFIELPAEAISVGELIARLKARGEE
                     YDAAFEHENVIRAAINQEHAEHDELVKDGDEVALFPPMTGG"
     CDS             complement(370079..370663)
                     /codon_start=1
                     /transl_table=11
                     /gene="pgsA"
                     /locus_tag="BR10RB9215_C10356"
                     /product="CDP-diacylglycerol-glycerol-3-phosphate
                     3-phosphatidyltransferase"
                     /EC_number="2.7.8.5"
                     /db_xref="GOA:A0A1M4L9Z8"
                     /db_xref="InterPro:IPR000462"
                     /db_xref="InterPro:IPR004570"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9Z8"
                     /protein_id="SBW13550.1"
                     /translation="MQKNHTLSLPNMLTYGRIIAVPLVVLCFFIEGRLESSDFARWTA
                     LGLFAIASITDFFDGYLARIWKQTSTIGRMLDPIADKLLVSAILLLLAADGTIAGWTL
                     WAAIIILCREILVSGLREYLAELKVSVPVSRLAKWKTTAQMVALAFLLAGPAGDKIIP
                     YVTQIGIGLLWISAILTLYTGWDYFRAGLKHVMD"
     CDS             complement(370782..372854)
                     /codon_start=1
                     /transl_table=11
                     /gene="uvrC"
                     /locus_tag="BR10RB9215_C10357"
                     /product="excinuclease ABC subunit C"
                     /db_xref="GOA:A0A1M4L9V2"
                     /db_xref="InterPro:IPR000305"
                     /db_xref="InterPro:IPR001162"
                     /db_xref="InterPro:IPR001943"
                     /db_xref="InterPro:IPR003583"
                     /db_xref="InterPro:IPR004791"
                     /db_xref="InterPro:IPR010994"
                     /db_xref="InterPro:IPR035901"
                     /db_xref="InterPro:IPR036876"
                     /db_xref="InterPro:IPR038476"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9V2"
                     /protein_id="SBW13551.1"
                     /translation="MATRKTTTGGQTHLPPDDEQDVAGIIIGEAETEDDDDAAANGEE
                     EPARIASAAESIQWDSSDGLPDTAGLSGPDIINAFVKHLPNNPGVYRMFNSDGDVLYV
                     GKARNLKKRVSNYARGIGHSNRITRMIRETVTMEFVVTRTETEALLLEANLIKRLRPR
                     FNVLMRDDKSFPYILLTGGHRAPGIFKHRGARSRKGDYFGPFASAGAVGRTINALQRA
                     FLLRTCTDSVFETRTRPCLLYQIKRCSAPCTYEISDEDYAGLVAEAKAFLSGKSQSVK
                     DHLAAAMQAASADLDFEHAAVYRDRLAALSHVQSHQGINPQTVEEADVFAIHQEGGMT
                     CIQVFFFRTGQNWGNRAYFPKADSSLGPAEVLGAFLSQFYDDKPCPKLVLLSETVEEQ
                     SLITEALSTRAGHKVQVTVPQRGEKKELVQHALTNAREALGRRLAETSSQARLLQGLA
                     ETFGLPRAPRRIEVYDNSHIMGTNAVGGMIVAGPEGFVKNQYRKFNIRSTDITPGDDF
                     GMMREVIERRFSRLVKEHGTPAGEVENPDAFPAWPDVILIDGGQGQVGAVRQILGEMG
                     ISDLVTAIGIAKGVDREAGRERFFMEGKQPFTLPPRDPVLYFIQRLRDEAHRFAIGTH
                     RARRKKEMVRNPLDEIAGIGPTRKRALLHHFGTAKAVSRAAVEDLMQIDGISEAMARA
                     IHDHFRDK"
     CDS             complement(372854..373672)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10358"
                     /product="glucose 1-dehydrogenase"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9Y7"
                     /protein_id="SBW13552.1"
                     /translation="MKRPENPDKKAFTVLNDPEARMVANCPVLVTGGARRIGKAIVED
                     LASHGFPVAIHCNRSLDEGEAIANRINDSGGNACVVQADLEGDVRGLLKQASDRIGPI
                     RLLVNNASLFQEDSVGALDMALWDRHFAVHLKTPVILAEDMAKALPDDQDGLVVNIID
                     QRVWKLNPQFFSYTLSKTALWNATRTLAQALAPRIRVNAIAPGPTLPSERQRPEDFER
                     QVSKLPLQRAPELPEFGRTVRYFWENRSITGQMIALDGGQHLAWETPDIAGITE"
     CDS             374011..374652
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10359"
                     /product="outer membrane protein"
                     /db_xref="InterPro:IPR011250"
                     /db_xref="InterPro:IPR027385"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9Z0"
                     /protein_id="SBW13553.1"
                     /translation="MRTLKSLVIVSAALLPFSATAFAADAIQEQPPVPAPVEVAPQYS
                     WAGGYTGLYLGYGWNKAKTSTVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWA
                     KKSKDGLEVKQGFEGSLRARVGYDLNPVMPYLTAGIAGSQIKLNNGLDDESKFRVGWT
                     AGAGLEAKLTDNILGRVEYRYTQYGNKNYDLAGTNVRNKLDTQDIRVGIGYKF"
     CDS             complement(374751..375350)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10360"
                     /product="glutathione S-transferase"
                     /db_xref="GOA:A0A1M4LA26"
                     /db_xref="InterPro:IPR004045"
                     /db_xref="InterPro:IPR034343"
                     /db_xref="InterPro:IPR036249"
                     /db_xref="InterPro:IPR036282"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4LA26"
                     /protein_id="SBW13554.1"
                     /translation="MTQILYSPASPYSAKVRMAAHHAGIPFESVIVNTSAEPETLIQA
                     NPLGKIPTLVTDDGKAVFDSRAITQYFNRVSGNKLFPRNAEKRTDAEHYEAIADGLCD
                     VLLAHVYERRMRPEEKIHQPWLDLQWRKAERALDLLNEAPPRLAGKLHAGHLAVAAAL
                     GYLALRFEGKWERNRSKLKRWMKRFQELHPELVELLPRG"
     CDS             complement(375405..376094)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10361"
                     /product="ribonuclease T2 family protein"
                     /db_xref="GOA:A0A1M4L9T4"
                     /db_xref="InterPro:IPR001568"
                     /db_xref="InterPro:IPR018188"
                     /db_xref="InterPro:IPR033130"
                     /db_xref="InterPro:IPR036430"
                     /db_xref="InterPro:IPR039378"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9T4"
                     /protein_id="SBW13555.1"
                     /translation="MLRTLAAARAVLLATGFSAAIGFNPAKADDRDGGRPGDFDFYIL
                     SLSWSPSYCASQGPRANQQQCGVQRPFGFVVHGLWPQNERGYPANCQFDNMRSRGSYV
                     PRRIISSLSDIIPSAGLIAHQWRKHGSCSGLPQNDYFATVRNAFEKVNIPPSLRNLAT
                     ERRVDPLLVEKAFIAANPGMKPDGISIACKRNYLQEVRICMTRDLQYRSCDEVDANAC
                     RSRSVIMPAMQ"
     CDS             complement(376107..376577)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10362"
                     /product="hypothetical protein"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9V8"
                     /protein_id="SBW13556.1"
                     /translation="MQRISDRIGQFSRAALFAASVVPLALASVPTVQAADYIAPAPAG
                     VADAGLCNQQSVLRRVVSGFGYQVRHVPNLPKVGITAMSDVRLTRYEPKVSPADIERT
                     YCQATAVLSDGQYRPVWYMVEEGQGFAALGRNVEFCVDGFDRWYVYDGRCRVLR"
     CDS             complement(376660..377532)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10363"
                     /product="hypothetical protein"
                     /db_xref="GOA:A0A1M4L9V5"
                     /db_xref="InterPro:IPR002052"
                     /db_xref="InterPro:IPR007473"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9V5"
                     /protein_id="SBW13557.1"
                     /translation="MNYRHAYHAGNFADVVKHVILTRIVEYLKRKEQAFRVIDTHAGI
                     GLYDLRGTEAGKTGEWAGGIERIMTAVEKGQVEQPVLELLKPYLDAVYAVNTGARLRH
                     YPGSPLLVRHLLRKQDRLSALELHPQDAAKLAKLFDGDYQVRVTELDGWLALGAHLPP
                     KEKRGLVLVDPPFEKDGEFDRLADGLAKAHKRFGGGTYALWYPVKDRRETERFARRLR
                     ETGIPKIMQIELAIRAPSPEPRLDGTGMIVVNPPYTLESEMQILLPCLTRLLEEEKGS
                     NFSLRWIRGETDRA"
     CDS             377688..378533
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10364"
                     /product="hypothetical protein"
                     /db_xref="GOA:A0A1M4L9T9"
                     /db_xref="InterPro:IPR000620"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9T9"
                     /protein_id="SBW13558.1"
                     /translation="MSGGVLLIVLFGAFLHASWNAIVKGSGDKFFGAASVTGAAGLIA
                     LFLVPFLPLPTAASWIYMLLSTITQTFYMSLVAAAYKSGDMSEAYPIMRGTPPLLVAL
                     VSGPLVGEIMGWQSWLGIVLICSGVLAMAVDARRRNRGTSSRTVLLALANAGFIASYT
                     LIDGLGVRVSGEPLSYTLWLFLLNAVPLAGWALYREPSRFINYIRNRWRPALIGGVGT
                     LGSYGLALWAMTMAPIAVVAALRETAILFGMLISALILKEKVGLPRFVAAGFIVAGAI
                     ALRLS"
     CDS             378611..380737
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10365"
                     /product="nitrate reductase subunit alpha"
                     /db_xref="GOA:A0A1M4L9Z5"
                     /db_xref="InterPro:IPR006655"
                     /db_xref="InterPro:IPR006656"
                     /db_xref="InterPro:IPR006657"
                     /db_xref="InterPro:IPR006963"
                     /db_xref="InterPro:IPR009010"
                     /db_xref="InterPro:IPR037920"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9Z5"
                     /protein_id="SBW13559.1"
                     /translation="MNRHTPISNIRIGHSACPHDCPSTCALDVELLDERTIGRVRGSR
                     DNSYTAGVICAKVARYAERVHHPDRLKHPMVRAGGKGEGFWKEASWQAALDLIAERFE
                     RAEREYGSETVWPFFYAGTMGLVQRDSIQRLRHAKGYSNQFDSYCTNTAWTGYFAGTG
                     SLTGPDPREMAKADCVVIWGTNAAATQVNVMTHAVRARKERGAKIVAIDVYANATVRQ
                     ADMGIVLKPGTDGAFACAVMHVLFRDGLADRDYLQRYTDDPKGLEAHLQTRTPQWAAP
                     ITGLSVGEIEAFAHLVGRTKRTYFRLGYGFTRQRNGAVNMHAAASIACVTGAFQYEGG
                     GAFHSNSGIFRMDKREIEGRAFQKNGIRYLDQSKIGRILTGDSEALYGGPPVTAMLIQ
                     NTNPMNVTPEQRLVRKGFAREDLFVAVHEQFMTDTARMADVLLPATTFLEHDDIYRGG
                     GQQHVVLGPKLIEPHADARPNIFVINELAKRLGVGHLPGFELDERTLIDRMNANSALP
                     DFDTLKEKRFVDLQPSFEEAHYLNGFKWPDGKFRFRPDWLGSPSPNKPPEAMGLQGPH
                     QTIPEFPDHWEVIEAADAEHPFRLTTSPAHNFLNSTFAETPTSTAKEIRPELLIHPDD
                     AEALGIADGDRIEIGNHRGEVVLHAVLHAGQKRGVVVSEGLFPNSAFERGEGINTLVG
                     AQSPAPYGGLAVHDTKIWIKAYPARA"
     CDS             complement(380970..381494)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10366"
                     /product="hypothetical protein"
                     /db_xref="InterPro:IPR009333"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4LA07"
                     /protein_id="SBW13560.1"
                     /translation="MSLRFSTSLLSAMAVVSGIAVAAPAGAADLVAPPVSGRTQPHSE
                     VGMLTCDISPAIGVIIGSRQDVDCVFKPKRGRGPLEHYNGTITKIGVDVGFINGGRLA
                     WAVWAPTVRPAGALQGRYFGASANAAIGVGFGTNILTGGSWKTISLQPISVQGQKGLN
                     AAVGISGLRLKYAG"
     CDS             complement(381670..382287)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10367"
                     /product="formyltransferase"
                     /db_xref="GOA:A0A1M4L9W5"
                     /db_xref="InterPro:IPR001555"
                     /db_xref="InterPro:IPR002376"
                     /db_xref="InterPro:IPR004607"
                     /db_xref="InterPro:IPR036477"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9W5"
                     /protein_id="SBW13561.1"
                     /translation="MKRNRVVIFISGGGSNMEALIRTAQAPGFPAEIVAVFSDKAEAG
                     GLAKAEAAGIATQVFKRKDFVSKEAHEDAILAALDVLKPDIICLAGYMRLLSGRFIAP
                     YEGRILNIHPSLLPLFPGLHTHQRALDAGMKLAGCTVHLVTEGMDEGPILAQAAVPVL
                     DGDTAETLAARVLKAEHRLYPLALQKFAAGEKAPDQFSDGMVLSA"
     CDS             complement(382284..383363)
                     /codon_start=1
                     /transl_table=11
                     /gene="purM"
                     /locus_tag="BR10RB9215_C10368"
                     /product="phosphoribosylaminoimidazole synthetase"
                     /EC_number="6.3.3.1"
                     /db_xref="GOA:A0A1M4L9Z4"
                     /db_xref="InterPro:IPR004733"
                     /db_xref="InterPro:IPR010918"
                     /db_xref="InterPro:IPR016188"
                     /db_xref="InterPro:IPR036676"
                     /db_xref="InterPro:IPR036921"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9Z4"
                     /protein_id="SBW13562.1"
                     /translation="MTMENKPAGQNGLTYAQAGVDIDAGNLMVEKIKPLVRSTRRPGA
                     DGEIGGFGGLFDLKAAGFKDPVLVAANDGVGTKLKIAIDADIHDTVGIDLVAMCVNDL
                     VVQGAEPLFFLDYYATGKLSPDQGVAIVSGIAEGCRQAGCALIGGETAEMPGMYRDGD
                     YDLAGFAVGAAERDRLLPRGDIAEGDIILGLASSGVHSNGFSLVRRIVELSGLGWKSQ
                     APFQPGATLGEALLAPTRIYVKPLLAAIRACDGIKALAHITGGGFPDNIPRVLPEGLA
                     AEIDLPAIAVPPVFSWLARTGNVEPNEMLRTFNCGIGMIAVVNPAKVDEVIAALAAEG
                     EKVVTLGRMTRREKDGVIYKGQLAL"
     CDS             383760..385001
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10369"
                     /product="permease, putative"
                     /db_xref="GOA:A0A1M4L9Z7"
                     /db_xref="InterPro:IPR002549"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9Z7"
                     /protein_id="SBW13563.1"
                     /translation="MVKKPTPARQTVTKTIRQSETIGRNGDIHVNVEVESFSGASVRR
                     QAGFWLGAMAFFVLFLVVFSSVLLPFVAGMALAYFLDPVADRLEKVGLSRLAASIVIL
                     LIFLMILIIGLMIVVPILATQLADFISNLPGYITQLQSLLANRDSEWLKKYIGIDSTV
                     IQQNLSSLLQQGAGFLSTLLQSLWNSGKSLIDIAGLFVVTPVVAFYMLLDWDRMVNSI
                     DSWVPRKQLHTVRRIAREMNAAVAGFIRGQGTLCLILGTYYAIGLTLTGLNFGLLIGF
                     FAGLISFIPYIGSFVGLALAIGVALVQFWPDWIMVCTVAAVFFLGQFIEGNILQPKLV
                     GSSVGLHPVWLMFALFAFGSLFGFTGMLVAVPAAAAVGVLVRFALNSYLRSPMYDPAN
                     HRSNPDAGPLIEAGDNTGHEK"
     CDS             385041..385736
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10370"
                     /product="hypothetical protein"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4LA37"
                     /protein_id="SBW13564.1"
                     /translation="MHDAPRQIPLNLEHQPGYNREDLIVTASNRAAVDLIDRWPNWLS
                     PVTILAGPTGAGKTHLAEIWRSGTDALLVDPSNITEEAVNSAAERPVLIDNIGAETFD
                     ETGLFHLINSVRQHAAQGPGPSLLMTSRLWPANWNVKLPDLASRLKAATVVEIAEPDD
                     MLLSGVIHKLFADRQVSVEPHVVSYLVSRMERSLLSAIQIVDRLDRAALEQKSRITRA
                     LAAQILADTGQAG"
     CDS             385733..386602
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10371"
                     /product="epimerase/dehydratase family protein, putative"
                     /db_xref="GOA:A0A1M4L9U1"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9U1"
                     /protein_id="SBW13565.1"
                     /translation="MRVAVTGARGFVGSALVSRLEAAGHNVMPLSREDIHDADFSGVE
                     TVVHCAALAHRTGAERPDARTFDAVNHRLAVELAQKAKAQGVRRFVFVSTIYTIAGNP
                     SPLAPDMPLAPRDDYGRAKARAEAALLAMTGLDIVIARPVLVYGPGARANLKALMKLC
                     DSRIPLPFGAANNKRSFVSLENVARALIFLSEAPAEKVAGRVFHLAEPKPRSTREIVG
                     KARAAMQRPARLVPVPPLIMKILLGGMGKRGLYDQLFGDLVADSSSLVQAGFEYLPGD
                     PQLELMARAAKDG"
     CDS             386816..387865
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10372"
                     /product="S-adenosylmethionine-tRNA
                     ribosyltransferase-isomerase"
                     /db_xref="GOA:A0A1M4L9W8"
                     /db_xref="InterPro:IPR003699"
                     /db_xref="InterPro:IPR036100"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9W8"
                     /protein_id="SBW13566.1"
                     /translation="MNPNFFDFSMENRSLPINPHWIDKDDDRKNCKLITIDKKSNSIE
                     KSSFSKIMDYIHPGDVIVLNNSRILANAMILKNETHVVKFILHGFTPNGIVITPFFAD
                     ICCNSSYTLCGFPHVSIEIKEKNSDSSWNASISDPQALVKYLSSNGERFDEYVSSRYF
                     YTNRNAYEAVFASEYGSLDIPSAGIHFTNDIIDEIKNKGAIVKFITLHVSTSEMALNR
                     IVNTDNIEDFKINPEYYDVPQETADCINEAVKRGSRIFAIGTTVTRALESAFDHSSNK
                     VVESKGWTTLYINPSYKIRVVDCLLTNLHQPKSSHMVLTAQFAGADLLMQAYKSKEMD
                     SMNFDLFGDCMLVLK"
     CDS             complement(387923..388702)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10373"
                     /product="hypothetical protein"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9W2"
                     /protein_id="SBW13567.1"
                     /translation="MAARKRSSSSRSSKRSSRRKSGSGSATPILALGAILALGAFSLW
                     STAQHKSPQAALSTLFQRPAPKPAPAATAKAENKPAPGKTADTKAPARDYAAAVGPVP
                     RPTAPVAPTPQKPVQTAAVAAPKPPRPSGSIVASVTPAAPHAMPPRGVNTPANSPSVI
                     YAKAKLTIHKNAWDRSPAIATIEKGREMRSYGKTGRWHRVVVPSTNIIGWVHEDQLIG
                     GRNKPDSATLITGSVAKKAPSPASAHGQSHILPPKAVGAKK"
     CDS             complement(388775..389479)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10374"
                     /product="short chain dehydrogenase/reductase family
                     oxidoreductase"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9U8"
                     /protein_id="SBW13568.1"
                     /translation="MTIQKVAIITAGGSGMGAASARRLAQDGFAVAILSSSGKGEALA
                     KELGGIGVTGSNQSNDDLQKLVDQALEKWGRIDVLVNSAGHGPRAPILEITDEDWHKG
                     MDSYFLNAVRPARLVVPAMQKQKSGVIINISTAWAFEPSAMFPTSAVFRAGLASFTKI
                     FADTYAAENIRMNNILPGWIDSLPATEERRESVPMQRYGKSEEIAATVSFLASDGAAY
                     ITGQNLRVDGGLTRSV"
     CDS             complement(389641..389796)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10375"
                     /product="hypothetical protein"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4LA03"
                     /protein_id="SBW13569.1"
                     /translation="MAIQTVSDELYRRHEREWAEFRNAVEASETNQKQQGQASGKTSC
                     DSKTGNQ"
     CDS             complement(390177..391850)
                     /codon_start=1
                     /transl_table=11
                     /gene="lldP"
                     /locus_tag="BR10RB9215_C10376"
                     /product="L-lactate permease"
                     /db_xref="GOA:A0A1M4LA13"
                     /db_xref="InterPro:IPR003804"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4LA13"
                     /protein_id="SBW13570.1"
                     /translation="MPWNQVYDPLGSMFWSTLLAALPIVVLLGGIGIFHIKAHIAAIL
                     GLITALLIAVIGFGMPADMAGATAVYGAAYGLLPIGWIILNVIFLYRLTEQTGQFNIL
                     RDSIAGITPDRRLQLLFIAFSFGAFFEGAAGFGTPVAVTAAMLMGLGFAPLPAAGLSL
                     IANTAPVAYGALGTPVIALSAVTGIDLLQLSGMIGHQLPFFSAIVPFWLIWAFAGRKG
                     MMEVWPALLVAGVSFAVPQYVVSNFHGPWLVDVIAAICSMAALAAFLRFWQPRRIWTS
                     TGEKGEETNAPVQPRHSHSTGAVFRAWLPWIVLSVFVFLWGTPQIRTWLDSLWIWKMQ
                     VPHLHNLVFKVPPVVAEAHSEAAIFTLNLLSATGTGILLSAVVAGFILGFNPLKLVKE
                     YFKTAYVVRFSLITISAMLALGYVTRYSGTDATLGLAFAQTGWVYPFFGAMLGWLGVA
                     LTGSDTASNVLFGGLQKITAEQLGLSPVLMAAANSSGGVMGKMIDAQSIVVASTATQW
                     YGHESKILRYVFFHSIALACLVGVLVLAQAYVPPFTSLVPAETLPLVAH"
     tRNA            392150..392225
                     /locus_tag="BR10RB9215_C10377"
                     /product="tRNA-Pro"
                     /anticodon=(pos:392183..392185,aa:Pro,seq:tgg)
     CDS             392280..392690
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10378"
                     /product="oxidoreductase, putative"
                     /db_xref="GOA:A0A1M4L9X1"
                     /db_xref="InterPro:IPR006885"
                     /db_xref="InterPro:IPR038532"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9X1"
                     /protein_id="SBW13571.1"
                     /translation="MRLYRVDTLNRVNYCHDRFVSFLRGKVRAEFKVLQMVARIYRPA
                     KTAMQSGKAKTDQWLLEYEPEKPRVVEPLMGYTSSGDMKSQIRLFFASQEEAVAYATR
                     NGIPYRLMEPHEPKRRKVSYSDNFRFDRPQPWTH"
     tRNA            392789..392864
                     /locus_tag="BR10RB9215_C10379"
                     /product="tRNA-Arg"
                     /anticodon=(pos:392822..392824,aa:Arg,seq:tct)
     CDS             complement(393279..393914)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10380"
                     /product="putative membrane protein"
                     /db_xref="GOA:A0A1M4LA01"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4LA01"
                     /protein_id="SBW13572.1"
                     /translation="MDKSIEVLMQLPWTTLLTLSAGYAAYFIATVGHRTHHKPIDVTF
                     STLVFGFFTAFGYEFLRRKCGLQLWSASPIAFIGALAMGGGWALCGRPLMYWVLRKAR
                     ISHSDETPSALKAMFSQTDIDGTQLDVRLIDGTWLRCENLNEFRKEPNGPCVFGNEGD
                     ILMYVTHRKLPGDKKFEVNDCVIDDEFGSEITYLPRERIDRFDFRRKRKRK"
     CDS             complement(393985..394293)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10381"
                     /product="hypothetical protein"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4LA05"
                     /protein_id="SBW13573.1"
                     /translation="MTAVIGVLLDELRGLMSVEHDGTITWDELQALKNEHFGPDAIAI
                     EVYPPHSHVVNSLPMRHLWKLGSGEYWPDLSGQKMVGDLTLRDREILTRTELEFLTRN
                     "
     CDS             complement(394290..394886)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10382"
                     /product="hypothetical protein"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4LA46"
                     /protein_id="SBW13574.1"
                     /translation="MLSFNPFDWYWLSEDGRLFSSSSKILIESDDAEYVNWIDSGNNP
                     SRWPTDDSGVQTNRALQEVLAPYGIFFEIGSLKNALKQQVDRAAETERLKYITPGAGQ
                     AMTYQQKVDEARAFKAASNPKASDYPILSSEVGITAETIGGVADIVLAAFARWQQIGA
                     MIESVRLGAKRDIDAAEDEAAARAIIEAVVWPSAQVQA"
     CDS             complement(394879..396438)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10383"
                     /product="hypothetical protein"
                     /db_xref="InterPro:IPR011050"
                     /db_xref="InterPro:IPR021251"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9V3"
                     /protein_id="SBW13575.1"
                     /translation="MDRVNGTDWVDIGGGRRGFRSQNAAAGIPGTEVTDKILNDVQEE
                     ICAVIENSGFVLDSENQQQLWEALQSIAAPGFANRAAWLPVLSMTTTAPPNDAVLGDA
                     YIIPAGATGAWAGNQQKLAEWTGSAWRIVATKDGHGISLPDGRVFERLDGVYVEKLAL
                     DAQSGKWNYAIADGSANAIVAALTPSLNTYASAIGAEFHILIKSANTGPVTLNLGPGA
                     LPLKTWQGQDLGSGDLLAGTIATVICTGSTFVLGGIAYSEVPRTPISDPILYVRTDGN
                     DANDGSDNTANKAFATISAAIKYGVNKYYLLNRPLTIQLGNAGNYAPPGGVGGAREIK
                     IVGNTGSQNSVVLKGTGPSAGGGCLIYALPGTSLVLEGMRILNDGTINGNAGASGSAS
                     ISFKNCTFSTGVATGQPCVLSALGASASIGSGCMFDGYSAAALLANSGSILIAANVTV
                     NSTPAYTAGFAVAQANGSIAVAAGVSITGSATGYRYAASLCGVINTLGQGVNYFPGST
                     AGITLTGGQYA"
     CDS             complement(396440..397282)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10384"
                     /product="hypothetical protein"
                     /db_xref="InterPro:IPR018755"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9X8"
                     /protein_id="SBW13576.1"
                     /translation="MQKSRSNSAFWIKRLPRFQHGPKHIDASSCERNDRLGMAFSFPS
                     FAVVKSSTNRITFGISTKCTLEKDAFEVFVAAVGSSKHRLYPDCRMTGASPAVAAIAS
                     ADLKRAMLPAAAIKLAVNMAPIPGSVRMRAASGWRASNVSSPLSSRASFSLVRMISSA
                     SSLTRLAKVASPGTMVCLSLRDLEHFMCHFFAFVQMWHTIEIEEFWPSKAGVLRAGQA
                     LIAEGEQFTWRVKLQLISEWIFRAGVNTAGQPLGGFEISDIECELRRLKPAHTQLVFS
                     YQEN"
     CDS             complement(397282..397764)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10385"
                     /product="hypothetical protein"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9X5"
                     /protein_id="SBW13577.1"
                     /translation="MIFVQKAVLKIRGIFCSKLQRGIWSASNQPNSTERTRFTWPKIS
                     HSGSMETNGSAAARDVLAEHRRQTDAEGFAPEHDDSHSRGEMLTAAWCYMQRHADKDM
                     FGDNYDINKLPPPARWPWSWLWWKPTNRHRDLVKAAALILAEIERLDRLSTPASEGAA
                     "
     CDS             397964..398212
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10386"
                     /product="hypothetical protein"
                     /db_xref="InterPro:IPR018753"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9W1"
                     /protein_id="SBW13578.1"
                     /translation="MAKKNAEYDPRNPKPVKSGKRRTKAVDIEVDEQDAPEVLPTAGD
                     NITSEAQTIAVGQLRAFIERIERLEEEKSTIGEDIKEV"
     CDS             398291..398533
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10387"
                     /product="hypothetical protein"
                     /db_xref="GOA:A0A1M4LA20"
                     /db_xref="InterPro:IPR002514"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4LA20"
                     /protein_id="SBW13579.1"
                     /translation="MVRERGVSVAKAARDLDVHENVLRKWVREYGSDPARAFPGPGQM
                     KPEQLEIERRRKEVAKLKAERDILKKAAAYFAKDVI"
     CDS             complement(399751..399873)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10388"
                     /product="hypothetical protein"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4LA25"
                     /protein_id="SBW13580.1"
                     /translation="MRMYFIVIFDPYVNKLKCSFGQRYCGDADVIPFHVFYEGF"
     CDS             complement(400101..402077)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10389"
                     /product="hypothetical protein"
                     /db_xref="InterPro:IPR001173"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9Y1"
                     /protein_id="SBW13581.1"
                     /translation="MSKITVLVPVYNAPKVVDFLLKSLRENTNRSLVDQIIIGNDNSD
                     TTTTTLIDDLIEGDELFQHIKREKNLGFLGNVNDIFRRATGEIVVLLNSDTILPAKWA
                     ERVAAAFESDPTIGLACPLTTNATNLVLKPAPGQHWSDVDRIISTIEPVYPNCAPVVG
                     FFLCIRTAFFNDADLLDPIYGNGYWEDTDLHFRSLKKGYRNIVIDNLFVFHSNHSPSF
                     SIENDLKLINDTNEKIFSKRWCKQYKSMVMTQDKLGVMSRHATPSTVQTRYTYTRELE
                     VLFVLPAVHANSGGISVVMNFVDELNQRGIAAAVYSYGHCDNLYVHTQLQNVPFMDKQ
                     DVLNQISKVRYVFATSHDSHEYAKAFANHYGAKFCCFVQGPEAAFAKGRHAVSISRQY
                     KDYDINVAVSGYLARYLQAFEANTIQIPLGPSKFAFYASERTKRNPKALAACVRIDDL
                     KGTGRLMANLVMAERAGFEIHLFGESNGWDIFKKAKSHGNLTSAQLAKLFSQVGYYLD
                     CSHMEGLGLLPLEAAFSGCIPIIAQELGLEGIVTNGENVIVLPSEFPGTNFYRKLLSD
                     HNEAIRENGVKIRDKISLESAVSSFIQQISLVRRTEQPIVLIPAQDQHLPSLVEERDY
                     YRSQLETIYKSKSWLLTKPVRFAGRVVRKLRQVL"
     CDS             complement(402115..404037)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10390"
                     /product="hypothetical protein"
                     /db_xref="GOA:A0A1M4LA09"
                     /db_xref="InterPro:IPR007833"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4LA09"
                     /protein_id="SBW13582.1"
                     /translation="MNDYKLLFLVEPYVIREDATTFKWIAEQYLKTARLNPQTCRVLC
                     NAPTAAAVTQNSLDESVIITPTNEEQYTFLQGTVPTWNDREVLKWREHMLGTASHNDQ
                     YQKMLYRVREDFPFDVVVFWGTSRIVSDFCRKTGVIPYFSELGPVRPPFGQTSCIDTL
                     GVNGDALPTRLSISDLYAVAAQAPTPYARQNEASYVLIPLQNADDANILVHGDETAYE
                     DFLSEAVQETLEHGLTPLVKSHPGSRIKAYTFMKEAHTIERLRSMGATILDASLSSEQ
                     TKSLLCNAHSVLTFNSSIGFEASQLGIPVHVNGKAAYKIRGIFPSLREIYRVDFDYIT
                     YMDSVSRLGEFMGKYLFSLDAAFSRKTFDFLTREKINGDKLPPTSIVKNRNLSASLNF
                     EQEPRKELELRAIINTTNRILIIFVASECSDILDNTFTTLYNHKDNSIIIDYFFIDKN
                     YNELISHKIMEHCNFHGYHYRKINRDSNLIEECKKISIECNSSFIAIYNININLDYLQ
                     LKSAKRLFEINYNISMAVSLIDEGNEAAEPLIINKNLLFIRAAFLQSTIASNMNIGSI
                     IEAYSSLHYEATKRGFKCAIISDRPSELTAQREKNNILKKRLSDILRSRSWRITAPLR
                     ATQRFGSLLYRLLTAL"
     CDS             complement(404103..404876)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10391"
                     /product="hypothetical protein"
                     /db_xref="GOA:A0A1M4LA14"
                     /db_xref="InterPro:IPR001584"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR036397"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4LA14"
                     /protein_id="SBW13583.1"
                     /translation="MSVALACRTFEVSETCYRYSARLNDENAQIADLLIGLTRAKKTW
                     GFFGLCFLYLRNVQGHHWNHKRVYRIYRELELNLRIKPRKRLKRDKADALTVPDAPNM
                     VWSMDFMADRLEDGRQFRLLNVLDDFNREGLGIQVDFSLPAERVIRSLNQIIEWRGKP
                     FAIRVDNGPKYVSGKLMEWAANQGIAFSHIQPGKPQQNAYVERYNRTVRNEWLDQYII
                     ESIEEAQEFATQWLWTYNNERLNMGIGGVTPAQKLKMAA"
     CDS             complement(404930..405193)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10392"
                     /product="hypothetical protein"
                     /db_xref="GOA:A0A1M4LA52"
                     /db_xref="InterPro:IPR002514"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4LA52"
                     /protein_id="SBW13584.1"
                     /translation="MKTSRFSEPQILAILRQAEGGVPVPELCREHGMSTASFYKWRSK
                     YGGMDASMISQMKALEDENRRLKKMYAEMSMQAEQLKEALGKK"
     CDS             complement(405228..406052)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10393"
                     /product="transposase"
                     /db_xref="GOA:A0A1M4L9W3"
                     /db_xref="InterPro:IPR001584"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR024967"
                     /db_xref="InterPro:IPR036397"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9W3"
                     /protein_id="SBW13585.1"
                     /translation="MNIHKNARLTPLRREEMAVAVLGGRLTKAQAARLYGVSLKIVSR
                     WTERFRISGRAAMTDRSSRPTRSPRQMGQDIVERILHLRRQRLPGKHIAIETGVSPAT
                     VSRILRRAKLSRMKDIDPIEPVIRYEYAEPGGLIHLDIKRLERVGHRITGNRTGQSNA
                     RGVGWEYVHVCIDDASRIAFTNIFPDEKAISAIAFLKAAVAYYACLGVTVTRVMTDNG
                     ACYIAKEFAKACKALDLKHIRTKPYTPKTNGKAERFIQTALREWPYNPPPNNGLQK"
     CDS             complement(406149..406397)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10394"
                     /product="lipoprotein, putative"
                     /db_xref="InterPro:IPR027367"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9Y8"
                     /protein_id="SBW13586.1"
                     /translation="MRKMALGLVALMALSGCTTTEKDVSIGTAGGAIIGGIAGGGRGA
                     LIGAGAGALGGLLVRELRSGKCEYRDRHGRIYVARCRR"
     CDS             complement(406500..406589)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10395"
                     /product="putative membrane protein"
                     /db_xref="GOA:A0A1M4L9Y0"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9Y0"
                     /protein_id="SBW13587.1"
                     /translation="MMTWVFIIQGVMAIGLAALAIAVILRYHR"
     CDS             complement(406642..407811)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10396"
                     /product="O-succinylhomoserine sulfhydrylase"
                     /db_xref="GOA:A0A1M4L9X2"
                     /db_xref="InterPro:IPR000277"
                     /db_xref="InterPro:IPR006233"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9X2"
                     /protein_id="SBW13588.1"
                     /translation="MAKQQLKTEKLGINTRLAHDGYCPGDYHGFINPPVVRASTVLFP
                     DAETMATESQKYTYGTRGTPISEALCKATDALEGSAGTVCVPSGLAAVTVPLLGFLSP
                     GDHALLVDSIYYPTRHFANTILKRMGVDVEYYDPQIGADIAKLMRPNTRVVFTESPAS
                     NTFEIQDIPAIAEAAHKGNAIVMMDNTWATPLYFRALDFGVDISIHASTKYPSGHSDI
                     LFGTISANEKCWPQLLETHGTMGLCAGPDDTYQILRGLRTMGIRLEHHRKSALEIARW
                     LENHPMVERVLHPALESHPGHEIWKRDFSGSSGIFSFVLAKGGHAQASAFLNALEIFG
                     LGYSWGGYQSLALEVQLGDRTVSKNDYAGPVIRLQIGLEDVPDLIADLERGFAAI"
     CDS             408180..408947
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10397"
                     /product="PAP2 family protein"
                     /db_xref="GOA:A0A1M4LA31"
                     /db_xref="InterPro:IPR000326"
                     /db_xref="InterPro:IPR036938"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4LA31"
                     /protein_id="SBW13589.1"
                     /translation="MTAPNAENILLNPIRAACELVRALVRPAYKGAPSSWTMEMTAIV
                     ALLPFILLVLHLWDADLSRAASHSTSLFMEILRASTDAIRTVIWLPIALAVWLVTALL
                     LSPSFQGGARRWLVRLHGWATLVAASIVVGSIPVELGKLVVGRARPLLIDEVGAASFS
                     PFNGQYLYESFPSGHSMMAGIMLVSLWIFLPRLRIVTVAICLLFCISRVAAGVHYPTD
                     VVAGFTIGFVSAWWVARYMATRNIIFSLDDESVMPRI"
     CDS             409403..410434
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10398"
                     /product="amino acid ABC transporter substrate-binding
                     protein"
                     /db_xref="InterPro:IPR001638"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4LA35"
                     /protein_id="SBW13590.1"
                     /translation="MKKTLMTGVLGAAALFGIASGASADTLSDVKAKGFLQCGVNTGL
                     LGFASPNDKGEWSGFDVDYCRAVASAIFGDPTKVKFTPLNAKERFTALQSGEVDVLIR
                     NTTWTISRDTSLGLDFAGINYYDGQGFMINSKKLAGINSALQLSGASICVQAGTTTEL
                     NMADYFRANKMEYNPVVFEKIEEANAAYDSGRCDAYTTDQSSLYGVRLALANPDDHVI
                     LPEIISKEPFGLTVRQGDARWADVVRWTHNALLNAEEYGITQANVEEMKKSDNPDIKR
                     LLGAEADTKIGTDLGLDKDWVVKIIKGVGNYGEIFERNIGSGSPLKIARGLNAQWNKG
                     GLQYGIPVR"
     CDS             410730..411923
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10399"
                     /product="amino acid ABC transporter, permease protein"
                     /db_xref="GOA:A0A1M4L9Z1"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="InterPro:IPR010065"
                     /db_xref="InterPro:IPR035906"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9Z1"
                     /protein_id="SBW13591.1"
                     /translation="MASYFGTERRQGSGGTSLLYDPRARGIFYQVVVFGAVIAGIYWI
                     VGNTITNLQRANIASGFGFLYGRAGFDISQTLIQYNSDSTYGRAFLVGLVNTLYVAAL
                     GVVTASIIGFLVGIGRLSHNWLIRNICTVYVEVFRNIPPLLVIFFWYFGVLSVLPPVR
                     QSYSMPLSTYINNRGFFMPSPVWGEGAWTLPVALLIGILASFAVARWAKRRQMATGQP
                     FHTIRVSAALIIGLPILALIATGFPVSFDVPKLGTFNLTGGAQIKPEFLALFLALSFY
                     TASFIAETVRAGVLGVSKGQTEAAYAVGLRSGQTMRLIIVPQALRIIIPPLSSQYLNL
                     IKNSSLAIAIGYPDLVAVGGTILNQTGQAVEVVAIWMVIYLGISLIVSGLMNWFNAKM
                     ALVER"
     CDS             411926..413083
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10400"
                     /product="amino acid ABC transporter, permease protein"
                     /db_xref="GOA:A0A1M4LA17"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="InterPro:IPR010065"
                     /db_xref="InterPro:IPR035906"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4LA17"
                     /protein_id="SBW13592.1"
                     /translation="MENADLQYVRTQMVDGEAPPRSVQGISHWLRVNLFATPVDAALT
                     IFGLVLVVWFVPPIIEWLFINAAWTGTSRTACLTAAQGGAQPDGWSGACWAFVNAKYE
                     QFLYGRYPISERWRVDLTALIFAALLVPLLIPKVPKKGLNAILFFLVFPVVAFFLLVG
                     GWFGLPYVETPLWGGLLVTLVLSFVGIAVSLPLGIVLALGRRSKLPVIKTFSIIFIEM
                     VRGVPLVTVLFMASVMLPLFLPPGVTFDKLLRALIGVALFASAYMAEVVRGGLQAIPR
                     GQYEGADALGLSYWQKTGLVVLPQALKLVIPGIVNTFIGLFKDTSLVYIIGMFDLLGI
                     VRQNFSDANWASPQTPATGLIFAGFVFWIFCFAMSRYSIFMERRLDTGHKR"
     CDS             413098..413913
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10401"
                     /product="amino acid ABC transporter ATP-binding protein"
                     /db_xref="GOA:A0A1M4LA24"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR030679"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4LA24"
                     /protein_id="SBW13593.1"
                     /translation="MEMSAQSALQQSGIGIEVDRSKMQVSKTEVAIEITNMHKWYGEF
                     HVLRDINLKVMRGERIVVAGPSGSGKSTMIRCINRLEEHQKGKIVVDGIELTNDLKKI
                     DEVRREVGMVFQHFNLFPHLTILENCTLAPIWVRKMPKKQAEEIAMHYLERVKIPEQA
                     NKYPGQLSGGQQQRVAIARALCMNPKVMLFDEPTSALDPEMVKEVLDTMVSLAAEGMT
                     MICVTHEMGFARQVANRVIFMDQGQIVEQNSPDEFFDNPQHERTKLFLSQILH"
     CDS             complement(413961..415148)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10402"
                     /product="monooxygenase FAD-binding protein"
                     /db_xref="GOA:A0A1M4LA61"
                     /db_xref="InterPro:IPR002938"
                     /db_xref="InterPro:IPR036188"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4LA61"
                     /protein_id="SBW13594.1"
                     /translation="MIAGAGVAGLSAALELAARGWRVQIVEKAQELSEVGAGLQLAPN
                     AMRHLERLGVADRLSGKGVTPKALYLMDGRAARPLLAMQLGDTARNRWHHPYIVCHRA
                     DLQSALLDACRNTPGIEINLGAEMTDQRMTGNSITATIKRENSVETVEAAYLVACDGV
                     WSMQRAKVGYSKARFSGHIAWRTTLAADALPASFLGAMPEHKAVSAWLGNKAHFIAYP
                     VKGGDFFNFVAITGGENPGEVWSKTGDHAHLQSIYADWSKPVHDILAATRDWTYWPLF
                     EMADAQFVGPGRTIFLGDASHAVTPFAAQGAAMAIEDAAALAQALDSDDQAAGLKRFD
                     SVRKERIAAVAKRGQLNRFAYHATGIFALGRNILFAVRSPETFLKDLDWLYGYDAALA
                     VRN"
     CDS             complement(415196..415450)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10403"
                     /product="hypothetical protein"
                     /db_xref="InterPro:IPR019401"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9X0"
                     /protein_id="SBW13595.1"
                     /translation="MSDHIIPHFQNDAGHNAIEIGVKEFMCVGANPPFDHPHVYLDMG
                     DESEIVCPYCSTLYRYNAKLHADETIPAGCVYEAPADKAA"
     CDS             415736..417976
                     /codon_start=1
                     /transl_table=11
                     /gene="ppk"
                     /locus_tag="BR10RB9215_C10404"
                     /product="polyphosphate kinase"
                     /EC_number="2.7.4.1"
                     /db_xref="GOA:A0A1M4L9Z6"
                     /db_xref="InterPro:IPR003414"
                     /db_xref="InterPro:IPR024953"
                     /db_xref="InterPro:IPR025198"
                     /db_xref="InterPro:IPR025200"
                     /db_xref="InterPro:IPR036830"
                     /db_xref="InterPro:IPR036832"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9Z6"
                     /protein_id="SBW13596.1"
                     /translation="MTVELPPSSPYSGFAPGDLAQADIHEALNGGLMQSADRFVNREF
                     SWLQFNRRVLEEAANIRQPLLERLRFLSISAANLDEFFMVRIAGLAGQVRAGIALRSP
                     DGRTPQEQLDFVLEEVGRLQAEQQQCLRTLRKELEKENIEIVRPPALSKHEKEWLENH
                     FLETIFPVLTPLSIDPAHPFPFIPNLGFSIALQLARRADNHPMTALLRIPVALKRFIQ
                     LPTDQNNIYRFITIEDAVSLFIGRLFPGYEVRGAGTFRIIRDSDIEVEEEAEDLVRLF
                     ETALKRRRRGQVIRIEFDGEIPEALRIFVAMELGVSENRISVHEGLLALNMISEVVSI
                     PREDLKFVSYNPRFPERIREHGGDCLAAIREKDIVVHHPYESFDVVVQFLRQAAADPD
                     VLAIKQTLYRTSNDSPIVRALVDAAEAGKSVTALVELKARFDEEANIRWARDLERAGV
                     QVVFGFIELKTHAKMSLVVRREDQKLRSYVHLGTGNYHPITARIYTDLSFFTSDAEIA
                     RDVAHIFNFITGYAQPAEEMKIAISPFTLRARILKHIEDEVAHAKAGKPAAIWMKMNS
                     LVDPQIIDALYMASQAGVQIDLVVRGICCLRPGVPGLSDNIRAKSIVGRFLEHSRIFC
                     FGNGHDLPSGKAIVYIGSADMMPRNLDRRVETLVPITNATVHQQILSQIMFANIIDNQ
                     QSYQLLADGTSRRIEKEAGEEAFNAQEYFMTNPSLSGRGKSLKSSAPRLIAHRKRAQA
                     ERKTTA"
     CDS             417973..419511
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10405"
                     /product="Ppx/GppA phosphatase"
                     /db_xref="GOA:A0A1M4L9Z2"
                     /db_xref="InterPro:IPR003695"
                     /db_xref="InterPro:IPR022371"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9Z2"
                     /protein_id="SBW13597.1"
                     /translation="MSPAFAQGRLKGLKPVAVIDIGSNSIRVVIYEGIVRSPTVLFNE
                     KILCGLGKGLAKTGKLNEKSVEAALRALKRFRALAEQAGAVSIHALATAAAREAKNGP
                     DFIAQAEAILGRHIEVLSGKEEAYYSALGIISGFYKPKGVTGDLGGGSLELVAVDDHE
                     VGEGITLPLGGLRLQDMSDGRLPEAVKIARTQLAKAVMLQAHEGQAFYAVGGTWRNLA
                     KLHMTARNYPLHVMHGYEMDAAEAQSFLKRVAKGNLDTMRGIEAVSKNRRQLLSYGAT
                     VLLETLRCMKPSKIIFSALGVREGYLYSLLPKNEQRLDPLLASAEELSILRSRSPRHA
                     RELTIWTGLSLSVLGYDETPDEARYREAACLVADISWRAHPDYRGSQALNIIAHGSFG
                     GIDHAGRSFMALANYYRHEGLIEDEIAPEMVQLSTPRLRERAKLLGALLRVVYLLSAS
                     MPGVIPRLVWREDEEGIALVVPGDLADLISDRPEGRLQQLSKLTGKNIYFAVGDGAIE
                     EMRE"
     CDS             complement(419595..420752)
                     /codon_start=1
                     /transl_table=11
                     /gene="rnd"
                     /locus_tag="BR10RB9215_C10406"
                     /product="ribonuclease D"
                     /EC_number="3.1.26.3"
                     /db_xref="GOA:A0A1M4L9Y6"
                     /db_xref="InterPro:IPR002121"
                     /db_xref="InterPro:IPR002562"
                     /db_xref="InterPro:IPR006292"
                     /db_xref="InterPro:IPR010997"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR036397"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9Y6"
                     /protein_id="SBW13598.1"
                     /translation="MQLITTTEALEEAVSALAKSDFVTVDTEFIRETTFWPELCLIQM
                     ASPDHTALVDALAPGLDLAPFFRLMADEKIVKVFHAARQDIEIVFHLGNLIPSPVFDT
                     QVAAMVCGFGDAISYDQLVQKVTGKHLDKSSRFTDWRRRPLSDKQLDYALADVTYLRD
                     IYLYLKEELQKEGRSEWVNEEMAVLTARQTYDLHPDDAWRRVKARVRKPLELAIVQAV
                     AAWREREARERNVPRGRIIKDDTIAEIAQQQPRDAEALGRLRSIPKGWERSAQAAGLV
                     TAIQSALAIAKEDLPKLPKPSHSPEGSAAAADILKVLLKLVTEEHGVAAKIVANSDDI
                     EKIAAEGDKANVPALHGWRREVFGQKALDLIDGKISIKFENRRIRAVELGD"
     CDS             420979..422766
                     /codon_start=1
                     /transl_table=11
                     /gene="aspS"
                     /locus_tag="BR10RB9215_C10407"
                     /product="aspartyl-tRNA synthetase"
                     /EC_number="6.1.1.12"
                     /db_xref="GOA:A0A1M4LA41"
                     /db_xref="InterPro:IPR002312"
                     /db_xref="InterPro:IPR004115"
                     /db_xref="InterPro:IPR004364"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="InterPro:IPR004524"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR029351"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4LA41"
                     /protein_id="SBW13599.1"
                     /translation="MHRYRSHTCAALRKTDVGSNVRLSGWVHRVRDHGGILFIDLRDH
                     YGITQIVADPDSPAFKVAETVRGEWVIRVDGEVKARADDAVNTNLPTGEVEIFATEIE
                     VLSPAKELPLPVFGEPDYPEDIRLKYRFLDLRRETLHKNIMSRTKIIAAMRRRMTEIG
                     FNEFSTPILTASSPEGARDFLVPSRIHPGKFYALPQAPQQYKQLLMVAGFDRYFQIAP
                     CFRDEDPRADRLPGEFYQLDLEMSFVTQEEVWETMEPVMRGIFEEFAEGKPVTKVFRR
                     IAYDDAIRTYGSDKPDLRNPIEMQAVTDHFAGSGFKVFANMIANDAKVEVWAIPAKTG
                     GSRAFCDRMNSWAQSEGQPGLGYIFWRKEGDKLEGAGPIAKNIGEERTEAIRKQMGLE
                     DGDACFFVAGLPSKFYKFAGDARTRAGEELNLVDRDRFELAWIIDFPFYEWDEDNKKL
                     DFAHNPFSMPQGGMDALENMDPLEIKAYQYDLVCNGFEIASGSIRNQLPEVMVKAFEK
                     VGLSQQDVEERFGGLYRAFQYGAPPHGGMAAGIDRVIMLLVGAKNLREISLFPMNQQA
                     LDLLMGAPSEVSPAQLRDLHVRLAPVQKS"
     CDS             complement(422868..424064)
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10408"
                     /product="hypothetical protein"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4LA44"
                     /protein_id="SBW13600.1"
                     /translation="MQLFVSIRPAARILVASTALSLVFGSAAMAADANAVANRIKALY
                     AKQGGELSFSGVKANGADIILEGASLKLPTVSEDETVLGDVTLQNVEDTPDGSYTIKQ
                     ITVPDLVFNGKEEKNGRAEIKGLSMQNVFIPSETTKGPLDSMVLYDKTKIDEVHFGAP
                     GKNGTTLKGIDVSLDTSNKTEKIGYIWNIQNIDVTFEKGGKNPLAPFGMNTLDASLNS
                     KGSWSPKTGDASLDQLEIKAPELGTIDITGNLGGYDLAFMEAVHKTQEAMSKADADKD
                     ASGRAVLVLAEQLNLKNLTIRFDNDTLTQKLLDYFAKQQGTDAKTLAEQVKMMVPLLA
                     TQLKNPEFTQQLKTAADKYFTDPKSLTISASPDQPVTFASIFATASLDPTKIIQLLKI
                     SVDADN"
     CDS             424401..426713
                     /codon_start=1
                     /transl_table=11
                     /locus_tag="BR10RB9215_C10409"
                     /product="DNA gyrase, A subunit"
                     /db_xref="GOA:A0A1M4L9Z9"
                     /db_xref="InterPro:IPR002205"
                     /db_xref="InterPro:IPR005742"
                     /db_xref="InterPro:IPR006691"
                     /db_xref="InterPro:IPR013757"
                     /db_xref="InterPro:IPR013758"
                     /db_xref="InterPro:IPR013760"
                     /db_xref="InterPro:IPR035516"
                     /db_xref="UniProtKB/TrEMBL:A0A1M4L9Z9"
                     /protein_id="SBW13601.1"
                     /translation="MGKSLIPPGDGEEHIERVDLKSALEERYLAYALSTIMHRALPDV
                     RDGLKPVHRRIMHAMRLLRLNPDQAYAKCARIVGDVMGKFHPHGDASIYDALVRLAQD
                     FAVRYPLVDGQGNFGNIDGDNAAAMRYTEARMTEVATLLLEGINENAIDFRPTYNEED
                     EEPIVLPGAFPNLLANGSAGIAVGMATNIPPHNVAELCSSALYLINHPDAPVEELVTS
                     PEQWAEIEQESKTDPAALLKCKVRGPDFPTGGILVEEHGNILEAYRTGRGAFRVRARW
                     HKEEGNRGTWVIVVTEIPYQVQKSRLIEKIAELLLAKKLPLLDDIRDESAEDIRIVLE
                     PKNRTVDPELLMESLFKLTELESRVSLNMNVLSHGKVPNVLSLGAVLREWLEHRKEVL
                     VRRSQFRLAEIERRLEILGGFLIAYLNLDEVIRIIREEDEPKQELMRAFELTDVQAES
                     ILNMRLRSLRKLEEFEIRKEFDDLTAEKTDLEGLLASGTRQWKKISAEIKAVREKFGP
                     TTRLGKRRTTFAHAPMHDLEDIHQAMIEREPVTIVVSEKGWLRAMKGHLADFSTLSFK
                     EGDKLKLAFHAETTDKLLFFTTGGKFFTIGANTLPGGRGHGEPIRILVDMENDQDILT
                     AFVHDPSAKLLLVSHEGNGFIVPESEAVANTRKGKQVMNVKAPDEAKLCQRVSGDHIA
                     VVGENRKMLVFPLSDIPEMTRGKGVRLQKYKDGGVCDVRTFAIADGLSWQDSADRTFN
                     RSKEELVEWIGARASAGRLVPKGFPRSGKF"
     CDS             complement(426892..427641)
                     /