LOCUS LM654155 402 bp DNA linear BCT 17-APR-2015 DEFINITION Mesorhizobium sp. CCANP78 partial truA gene for tRNA pseudouridine synthase, strain CCANP78. ACCESSION LM654155 VERSION LM654155.1 KEYWORDS . SOURCE Mesorhizobium sp. CCANP78 ORGANISM Mesorhizobium sp. CCANP78 Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Phyllobacteriaceae; Mesorhizobium. REFERENCE 1 (bases 1 to 402) AUTHORS Leon-Barrios M. JOURNAL Submitted (08-JUL-2014) to the INSDC. Microbiologia y Biologia Celular, Universidad de La laguna, Avda. Astrofisico Fco Sanchez s/n, 38071, SPAIN. REFERENCE 2 AUTHORS Perez-Yepez J., Armas-Capote N., Velazquez E., Perez-Galdona R., Rivas R., Leon-Barrios M. TITLE Evaluation of seven housekeeping genes for multilocus sequence analysis of the genus Mesorhizobium: Resolving the taxonomic affiliation of the Cicer canariense rhizobia JOURNAL Syst. Appl. Microbiol. 37(8), 553-559(2014). PUBMED 25467554 FEATURES Location/Qualifiers source 1..402 /organism="Mesorhizobium sp. CCANP78" /host="Cicer canariense" /strain="CCANP78" /mol_type="genomic DNA" /isolation_source="host root nodule" /db_xref="taxon:1307866" CDS <1..>402 /transl_table=11 /gene="truA" /product="tRNA pseudouridine synthase" /db_xref="GOA:A0A0A1INU1" /db_xref="InterPro:IPR001406" /db_xref="InterPro:IPR020095" /db_xref="InterPro:IPR020097" /db_xref="InterPro:IPR020103" /db_xref="UniProtKB/TrEMBL:A0A0A1INU1" /protein_id="CDX10319.1" /translation="VDLIKAWPGDKVRDAVNAHLQAAKVRIAILKAAVVPDSFDARFS AIGRHYLYRIVNRRAPAALDKGKIWWVPKQLDAAAMHEAAKVLLGRHDFTTFRSTQCQ ATSPVRTLDRLDVSRAGDFIEIRASARSFLHN" BASE COUNT 70 a 141 c 125 g 66 t ORIGIN 1 gtcgacctga tcaaggcatg gcccggcgac aaggtgcgcg acgccgtcaa cgcgcatctg 61 caggcggcca aggtgcgcat cgccatcctg aaggccgccg tcgtgccgga tagcttcgat 121 gcgcgtttct cggcgatcgg ccgccattac ctctaccgca tcgtcaaccg ccgcgcgccg 181 gcggcgctcg acaagggcaa gatctggtgg gtaccgaagc agctcgatgc ggctgccatg 241 cacgaagcgg caaaggtgct gcttggccgg catgatttca ccaccttccg ctcgacccag 301 tgccaggcca ccagcccggt ccgcacgctc gaccgactgg atgtcagccg ggcgggcgat 361 ttcatcgaaa tccgcgcttc ggcgcggtca ttcctgcaca ac //