LOCUS       LM654155                 402 bp    DNA     linear   BCT 17-APR-2015
DEFINITION  Mesorhizobium sp. CCANP78 partial truA gene for tRNA pseudouridine
            synthase, strain CCANP78.
ACCESSION   LM654155
VERSION     LM654155.1
KEYWORDS    .
SOURCE      Mesorhizobium sp. CCANP78
  ORGANISM  Mesorhizobium sp. CCANP78
            Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales;
            Phyllobacteriaceae; Mesorhizobium.
REFERENCE   1  (bases 1 to 402)
  AUTHORS   Leon-Barrios M.
  JOURNAL   Submitted (08-JUL-2014) to the INSDC. Microbiologia y Biologia
            Celular, Universidad de La laguna, Avda. Astrofisico Fco Sanchez
            s/n, 38071, SPAIN.
REFERENCE   2
  AUTHORS   Perez-Yepez J., Armas-Capote N., Velazquez E., Perez-Galdona R.,
            Rivas R., Leon-Barrios M.
  TITLE     Evaluation of seven housekeeping genes for multilocus sequence
            analysis of the genus Mesorhizobium: Resolving the taxonomic
            affiliation of the Cicer canariense rhizobia
  JOURNAL   Syst. Appl. Microbiol. 37(8), 553-559(2014).
   PUBMED   25467554
FEATURES             Location/Qualifiers
     source          1..402
                     /organism="Mesorhizobium sp. CCANP78"
                     /host="Cicer canariense"
                     /strain="CCANP78"
                     /mol_type="genomic DNA"
                     /isolation_source="host root nodule"
                     /db_xref="taxon:1307866"
     CDS             <1..>402
                     /transl_table=11
                     /gene="truA"
                     /product="tRNA pseudouridine synthase"
                     /db_xref="GOA:A0A0A1INU1"
                     /db_xref="InterPro:IPR001406"
                     /db_xref="InterPro:IPR020095"
                     /db_xref="InterPro:IPR020097"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:A0A0A1INU1"
                     /protein_id="CDX10319.1"
                     /translation="VDLIKAWPGDKVRDAVNAHLQAAKVRIAILKAAVVPDSFDARFS
                     AIGRHYLYRIVNRRAPAALDKGKIWWVPKQLDAAAMHEAAKVLLGRHDFTTFRSTQCQ
                     ATSPVRTLDRLDVSRAGDFIEIRASARSFLHN"
BASE COUNT           70 a          141 c          125 g           66 t
ORIGIN      
        1 gtcgacctga tcaaggcatg gcccggcgac aaggtgcgcg acgccgtcaa cgcgcatctg
       61 caggcggcca aggtgcgcat cgccatcctg aaggccgccg tcgtgccgga tagcttcgat
      121 gcgcgtttct cggcgatcgg ccgccattac ctctaccgca tcgtcaaccg ccgcgcgccg
      181 gcggcgctcg acaagggcaa gatctggtgg gtaccgaagc agctcgatgc ggctgccatg
      241 cacgaagcgg caaaggtgct gcttggccgg catgatttca ccaccttccg ctcgacccag
      301 tgccaggcca ccagcccggt ccgcacgctc gaccgactgg atgtcagccg ggcgggcgat
      361 ttcatcgaaa tccgcgcttc ggcgcggtca ttcctgcaca ac
//