LOCUS       LC438388                 750 bp    RNA     linear   VRL 18-MAY-2019
DEFINITION  Rotavirus A RVA/Human-tc/JPN/KU/1974/G1P[8] NSP4 gene for
            non-structural protein NSP4, complete cds.
ACCESSION   LC438388
VERSION     LC438388.1
KEYWORDS    .
SOURCE      Rotavirus A
  ORGANISM  Rotavirus A
            Viruses; Riboviria; Orthornavirae; Duplornaviricota;
            Resentoviricetes; Reovirales; Sedoreoviridae; Rotavirus.
REFERENCE   1  (bases 1 to 750)
  AUTHORS   Komoto,S., Fukuda,S. and Taniguchi,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-DEC-2018) to the DDBJ/EMBL/GenBank databases.
            Contact:Satoshi Komoto
            Fujita Health University School of Medicine, Department of
            Virology and Parasitology; 1-98 Dengakugakubo, Kutsukake-cho,
            Toyoake, Aichi 470-1192, Japan
            URL    :http://www.fujita-hu.ac.jp/~virology/index.htm
REFERENCE   2  
  AUTHORS   Komoto,S., Fukuda,S., Kugita,M., Hatazawa,R., Koyama,C.,
            Katayama,K., Murata,T. and Taniguchi,K.
  TITLE     Generation of Infectious Recombinant Human Rotaviruses from Just
            11 Cloned cDNAs Encoding the Rotavirus Genome
  JOURNAL   J. Virol. 93, e02207-18 (2019)
  REMARK    DOI:10.1128/JVI.02207-18
COMMENT     
FEATURES             Location/Qualifiers
     source          1..750
                     /collection_date="1974"
                     /country="Japan"
                     /db_xref="taxon:28875"
                     /host="Homo sapiens"
                     /isolation_source="stool"
                     /mol_type="genomic RNA"
                     /note="genotypes: G1-P[8]-I1-R1-C1-M1-A1-N1-T1-E1-H1"
                     /organism="Rotavirus A"
                     /segment="10"
                     /strain="RVA/Human-tc/JPN/KU/1974/G1P[8]"
     CDS             42..569
                     /codon_start=1
                     /gene="NSP4"
                     /product="non-structural protein NSP4"
                     /protein_id="BBH55856.1"
                     /transl_table=1
                     /translation="MDKLADLNYTLSVITLMNDTLHSIIQDPGMAYFTYIASVLTVLF
                     TLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRI
                     VKEMRRQLEMIDKLTTREIEQVELLKSIHDNLITRSVDVIDMSKEFNQKNIKTLDEWE
                     SGRNPYEPSEVTASM"
BASE COUNT          248 a          131 c          164 g          207 t
ORIGIN      
        1 ggcttttaaa agttctgttc cgagagagcg cgtgcggaaa aatggataag cttgccgacc
       61 tcaactacac attgagtgta atcactctaa tgaatgacac attgcattct ataattcagg
      121 atcctggaat ggcgtatttt acatatattg catctgttct aacagttttg ttcacattac
      181 ataaagcttc aattccaacc atgaaaatag cattgaaaac atcaaaatgt tcatataaag
      241 tgattaaata ttgtatagtc acgatcatta atactctttt aaaattggct ggatataaag
      301 agcaggttac tactaaagac gaaattgagc aacagatgga tagaattgtt aaagagatga
      361 gacgtcagct ggagatgatt gataaactaa ctactcgtga aattgaacag gttgaattgc
      421 ttaaaagtat acatgacaac ttgataacta gatcagttga cgttatagat atgtcgaagg
      481 agttcaatca gaaaaacatc aaaacgctag atgaatggga gagtggaagg aatccatatg
      541 aaccgtcaga ggtgactgca tccatgtgag aggttgagtt accgttgtct gtcttcggaa
      601 gcggcggaac tcttcaccgc aagccccatt ggacctgatg attgactgag aagccacagt
      661 caatcatatc gcgtgtggct cagccttaat cccgtttaac caatccagcg agtgttggac
      721 gttaatggaa ggaatggtct tagtgtgacc
//