LOCUS LC018335 717 bp DNA linear SYN 10-OCT-2015 DEFINITION Synthetic construct hgfp gene for green fluorescent protein, complete cds. ACCESSION LC018335 VERSION LC018335.1 KEYWORDS . SOURCE synthetic construct ORGANISM synthetic construct other sequences; artificial sequences. REFERENCE 1 (bases 1 to 717) AUTHORS Kobayashi,H. TITLE Direct Submission JOURNAL Submitted (07-JAN-2015) to the DDBJ/EMBL/GenBank databases. Contact:Hideki Kobayashi Agency for Marine-Earth Science and Technology, Institute of Biogeosciences; 2-15 Natsushima, Yokosuka, Kanagawa 237-0061, Japan URL :http://www.jamstec.go.jp/j/ REFERENCE 2 AUTHORS Kobayashi,H. TITLE Inducible Suppression of Global Translation by Overuse of Rare Codons JOURNAL Appl. Environ. Microbiol. 81, 2544-2553 (2015) REMARK DOI:10.1128/AEM.03708-14 COMMENT FEATURES Location/Qualifiers source 1..717 /db_xref="taxon:32630" /mol_type="other DNA" /note="derived from gfpmut3 with changing codon to optimum codons" /organism="synthetic construct" CDS 1..717 /codon_start=1 /gene="hgfp" /product="green fluorescent protein" /protein_id="BAQ25553.1" /transl_table=11 /translation="MSKGEELFTGVVPILVELDGDVNGQKFSVSGEGEGDATYGKLTL KFICTTGKLPVPWPTLVTTFGYGVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFYKD DGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKMEYNYNSHNVYIMADKPKNG IKVNFKIRHNIKDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHM ILLEFVTAAGITHGMDELYK" BASE COUNT 212 a 155 c 192 g 158 t ORIGIN 1 atgagcaaag gcgaagaact gtttaccggc gtggtgccga ttctggtgga actggatggc 61 gatgtgaacg gccagaaatt tagcgtgagc ggcgaaggcg aaggcgatgc gacctatggc 121 aaactgaccc tgaaatttat ttgcaccacc ggcaaactgc cggtgccgtg gccgaccctg 181 gtgaccacct ttggctatgg cgtgcagtgc tttgcgcgct atccggatca tatgaaacag 241 catgattttt ttaaaagcgc gatgccggaa ggctatgtgc aggaacgcac cattttttat 301 aaagatgatg gcaactataa aacccgcgcg gaagtgaaat ttgaaggcga taccctggtg 361 aaccgcattg aactgaaagg cattgatttt aaagaagatg gcaacattct gggccataaa 421 atggaatata actataacag ccataacgtg tatattatgg cggataaacc gaaaaacggc 481 attaaagtga actttaaaat tcgccataac attaaagatg gcagcgtgca gctggcggat 541 cattatcagc agaacacccc gattggcgat ggcccggtgc tgctgccgga taaccattat 601 ctgagcaccc agagcgcgct gagcaaagat ccgaacgaaa aacgcgatca tatgattctg 661 ctggaatttg tgaccgcggc gggcattacc catggcatgg atgaactgta taaataa //