LOCUS       HUMKRT6E                1986 bp    mRNA    linear   HUM 26-JUL-1995
DEFINITION  Homo sapiens keratin 6 isoform K6e (KRT6E) mRNA, complete cds.
ACCESSION   L42611
VERSION     L42611.1
KEYWORDS    isoform; keratin; keratin K6; keratin type II.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1986)
  AUTHORS   Takahashi,K., Paladini,R.D. and Coulombe,P.A.
  TITLE     Cloning and characterization of multiple human genes and cDNAs
            encoding highly related type II keratin 6 isoforms
  JOURNAL   J. Biol. Chem. 270 (31), 18581-18592 (1995)
   PUBMED   7543104
COMMENT     Original source text: Homo sapiens cDNA to mRNA.
FEATURES             Location/Qualifiers
     source          1..1986
                     /db_xref="H-InvDB:HIT000193818"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     gene            1..1986
                     /gene="KRT6E"
     5'UTR           1..40
                     /gene="KRT6E"
     CDS             41..1735
                     /gene="KRT6E"
                     /standard_name="type II keratin isoform K6e"
                     /codon_start=1
                     /product="keratin type II"
                     /protein_id="AAC41770.1"
                     /db_xref="GI:908803"
                     /translation="MASTSTTIRSHSSSRRGFSANSARLPGVSRSGFSSISVSRSRGS
                     GGLGGACGGAGFGSRSLYGLGGSKRISIGGGSCAISGGYGSRARGSYGFGGAGSGFGF
                     GGGAGIGFDLGGGAGLAGGFGGPGFPVCPPGGIQEVTVNQSLLTPLNLQIDPAIQRVR
                     AEEREQIKTLNNKFASFIDKVRFLEQQNKVLDTKWTLLQEQGTKTVRQNLEPLFEQYI
                     NNLRRQLDNIVGERGRLDSELRNMQDLVEDLKNKYEDEINKRTAAENEFVTLKKDVDA
                     AYMNKVELQAKADTLTDEINFLRALYDAELSQMQTHISDTSVVLSMDNNRNLDLDSII
                     AEVKAQYEEIAQRSRAEAESWYQTKYEELQVTAGRHGDDLRNTKQEIAEINRMIQRLR
                     SEIDHVKKQCASLQAAIADAEQRGEMALKDAKNKLEGLEDALQKAKQDLARLLKEYQE
                     LMNVKLALDVEIATYRKLLEGEECRLNGEGIGQVNVSVVQSTISSGYGGASGVGSGLG
                     LGGGSSYSYGSGLGIGGGFSSSSGRAIGGGLSSVGGGSSTIKYTTTSSSSRKSYKH"
     3'UTR           1736..1986
                     /gene="KRT6E"
BASE COUNT          442 a          552 c          602 g          390 t
ORIGIN      
        1 cgcgccaacg ctcgccacag ccctctcatc tcctggaacc atggccagca catccaccac
       61 catcaggagc cacagcagca gccgccgggg tttcagtgcc aactcagcca ggctccctgg
      121 ggtcagccgc tctggcttca gcagcatctc cgtgtcccgc tccaggggca gtggtggcct
      181 gggtggtgca tgtggaggag ctggctttgg cagccgcagc ttatatggcc tggggggatc
      241 caagaggatc tccattggag ggggcagctg tgccatcagt ggcggctatg gcagcagagc
      301 cagaggcagc tatggctttg gtggcgccgg gagtggattt ggtttcggtg gtggagccgg
      361 cattggcttt gatctgggtg gtggagccgg ccttgctggt ggctttgggg gccctggctt
      421 ccctgtgtgc ccccctggag gcatccaaga ggtcactgtc aaccagagtc tcctgactcc
      481 cctcaacctg caaattgacc ccgccatcca gcgggtgcgg gccgaggagc gtgagcagat
      541 caagaccctc aacaacaagt ttgcctcctt catcgacaag gtgcggttcc tagagcagca
      601 gaacaaggtt ctggacacca agtggaccct gctgcaggag cagggcacca agactgtgag
      661 gcagaacctg gagccgttgt tcgagcagta catcaacaac ctcaggaggc agctggacaa
      721 catcgtgggg gaacggggcc gcctggactc ggagctgaga aacatgcagg acctggtgga
      781 ggacctcaag aacaaatatg aggatgaaat caacaagcgc acagcagcag agaatgaatt
      841 tgtgactctg aagaaggatg tggatgctgc ctacatgaac aaggttgaac tgcaagccaa
      901 ggcagacact ctcacagatg agatcaactt cctgagagcc ttgtatgatg cagagctgtc
      961 ccagatgcag acccacatct cagacacatc cgtggtgcta tccatggaca acaaccgcaa
     1021 cctggacctg gacagcatca tcgctgaggt caaggcccaa tacgaggaga ttgctcagag
     1081 gagccgggct gaggctgagt cctggtacca gaccaagtac gaggagctgc aggtcacagc
     1141 aggcagacat ggggacgacc tgcgcaacac caagcaggag attgctgaga tcaaccgcat
     1201 gatccagagg ctgagatctg agatcgacca tgtcaagaag cagtgtgcca gcctgcaggc
     1261 tgccattgct gatgctgagc agcgtgggga gatggccctc aaggatgcta agaacaagct
     1321 ggaagggctg gaggatgccc tgcagaaggc caagcaggac ctggcccggc tgctgaagga
     1381 gtaccaggag ctgatgaatg tcaagctggc cctggacgtg gagatcgcca cctaccgcaa
     1441 gctgctggag ggcgaggagt gcaggctgaa tggcgaaggc attggacaag tcaacgtctc
     1501 tgtagtacag tccaccatct ccagtggcta tggcggtgcc agtggtgtcg gcagtggctt
     1561 aggcctgggt ggaggaagca gctactccta tggcagtggt cttggcattg gaggtggctt
     1621 cagttccagc agtggcagag ccattggggg tggcctcagc tctgttggag gcggcagttc
     1681 caccatcaag tacaccacca cctcctcctc cagcaggaag agctacaagc actaaagtgc
     1741 tgcctccagc tctcggtccc acagtcctca ggcccttctc tggctgcaga gccgtcttct
     1801 caggttgcct gtcgtctcct ggcctctagt cttccctgct ctccgaggta gagctgggta
     1861 tggatgctta gtgccctcac ttctctctgt ctatacctgc cccatctgag cacccattgc
     1921 tcaccatcag atcaaccttt gattttacat cataatgtat tcaccactgg agcttcactt
     1981 tgttac
//