LOCUS       HUMTRADD                1435 bp    mRNA    linear   HUM 26-APR-1996
DEFINITION  Homo sapiens TNF receptor-1 associated protein (TRADD) mRNA, 3' end
            of cds.
ACCESSION   L41690
VERSION     L41690.1
KEYWORDS    TNF receptor; TRADD gene; tumor necrosis factor receptor; tumor
            necrosis factor receptor 1; tumor necrosis factor receptor-1
            associated protein.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1435)
  AUTHORS   Hsu,H., Xiong,J. and Goeddel,D.V.
  TITLE     The TNF receptor 1-associated protein TRADD signals cell death and
            NF-kappa B activation
  JOURNAL   Cell 81 (4), 495-504 (1995)
   PUBMED   7758105
FEATURES             Location/Qualifiers
     source          1..1435
                     /db_xref="H-InvDB:HIT000193788"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     gene            1..1435
                     /gene="TRADD"
     CDS             <1..987
                     /gene="TRADD"
                     /standard_name="TNF receptor-1 associated protein"
                     /codon_start=1
                     /product="tumor necrosis factor receptor type 1 associated
                     protein"
                     /protein_id="AAA98482.1"
                     /db_xref="GI:808915"
                     /translation="LAGVGTQAPPRRPGGEMAAGQNGHEEWVGSAYLFVESSLDKVVL
                     SDAYAHPQQKVAVYRALQAALAESGGSPDVLQMLKIHRSDPQLIVQLRFCGRQPCGRF
                     LRAYREGALRAALQRSLAAALAQHSVPLQLELRAGAERLDALLADEERCLSCILAQQP
                     DRLRDEELAELEDALRNLKCGSGARGGDGEVASAPLQPPVPSLSEVKPPPPPPPAQTF
                     LFQGQPVVNRPLSLKDQQTFARSVGLKWRKVGRSLQRGCRALRDPALDSLAYEYEREG
                     LYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAEDLLGLTDPNGGLA"
BASE COUNT          245 a          437 c          494 g          259 t
ORIGIN      
        1 ctggcgggcg tgggaaccca ggccccgccg aggcggccag gaggtgagat ggcagctggg
       61 caaaatgggc acgaagagtg ggtgggcagc gcatacctgt ttgtggagtc ctcgctggac
      121 aaggtggtcc tgtcggatgc ctacgcgcac ccccagcaga aggtggcagt gtacagggct
      181 ctgcaggctg ccttggcaga gagcggcggg agcccggacg tgctgcagat gctgaagatc
      241 caccgcagcg acccgcagct gatcgtgcag ctgcgattct gcgggcggca gccctgtggc
      301 cgcttcctcc gcgcctaccg cgagggggcg ctgcgcgccg cgctgcagag gagcctggcg
      361 gccgcgctcg cccagcactc ggtgccgctg caactggagc tgcgcgccgg cgccgagcgg
      421 ctggacgctt tgctggcgga cgaggagcgc tgtttgagtt gcatcctagc ccagcagccc
      481 gaccggctcc gggatgaaga actggctgag ctggaggatg cgctgcgaaa tctgaagtgc
      541 ggctcggggg cccggggtgg cgacggggag gtcgcttcgg cccccttgca gcccccggtg
      601 ccctctctgt cggaggtgaa gccgccgccg ccgccgccac ctgcccagac ttttctgttc
      661 cagggtcagc ctgtagtgaa tcggccgctg agcctgaagg accaacagac gttcgcgcgc
      721 tctgtgggtc tcaaatggcg caaggtgggg cgctcactgc agcgaggctg ccgggcgctg
      781 cgggacccgg cgctggactc gctggcctac gagtacgagc gcgagggact gtacgagcag
      841 gccttccagc tgctgcggcg cttcgtgcag gccgagggcc gccgcgccac gctgcagcgc
      901 ctggtggagg cactcgagga gaacgagctc accagcctgg cagaggactt gctgggcctg
      961 accgatccca atggcggcct ggcctagacc aggggtgcag ccagcttttg gagaacctgg
     1021 atggccttag ggttccttct gcggctattg ctgaacccct gtccatccac gggaccctga
     1081 aactccactt ggcctatctg ctggacctgc tggggcagag ttgattgcct tccccaggag
     1141 ccagaccact gggggtgcat cattggggat tctgcctcag gtactttgat agagtgtggg
     1201 gtggggggga cttgctttgg agatcagcct caccttctcc catcccagaa gcggggctta
     1261 cagccagccc ttacagtttc actcatgaag caccttgatc tttggtgtcc tggacttcat
     1321 cctgggtgct gcagatactg cagtgaagta aaacaggaat caatcttgcc tgcccccagc
     1381 tcacactcag cgtgggaccc cgaatgttaa gcaatgataa taaagtataa cacgg
//