LOCUS       HUMLBR                  3714 bp    mRNA    linear   HUM 07-JAN-1995
DEFINITION  Human lamin B receptor (LBR) mRNA, complete cds.
ACCESSION   L25931
VERSION     L25931.1
KEYWORDS    integral membrane protein; nuclear envelope protein.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 3714)
  AUTHORS   Ye,Q. and Worman,H.J.
  TITLE     Primary structure analysis and lamin B and DNA binding of human
            LBR, an integral protein of the nuclear envelope inner membrane
  JOURNAL   J. Biol. Chem. 269 (15), 11306-11311 (1994)
   PUBMED   8157662
COMMENT     Original source text: Homo sapiens cDNA to mRNA.
FEATURES             Location/Qualifiers
     source          1..3714
                     /db_xref="H-InvDB:HIT000192651"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     gene            1..3714
                     /gene="LBR"
     5'UTR           1..75
                     /gene="LBR"
     CDS             76..1923
                     /gene="LBR"
                     /codon_start=1
                     /product="lamin B receptor"
                     /protein_id="AAA59494.1"
                     /db_xref="GI:438639"
                     /translation="MPSRKFADGEVVRGRWPGSSLYYEVEILSHDSTSQLYTVKYKDG
                     TELELKENDIKPLTSFRQRKGGSTSSSPSRRRGSRSRSRSRSPGRPPKSARRSASASH
                     QADIKEARREVEVKLTPLILKPFGNSISRYNGEPEHIERNDAPHKNTQEKFSLSQESS
                     YIATQYSLRPRREEVKLKEIDSKEEKYVAKELAVRTFEVTPIRAKDLEFGGVPGVFLI
                     MFGLPVFLFLLLLMCKQKDPSLLNFPPPLPALYELWETRVFGVYLLWFLIQVLFYLLP
                     IGKVVEGTPLIDGRRLKYRLNGFYPFILTSAVIGTSLFQGVEFHYVYSHFLQFALAAT
                     VFCVVLSVYLYMRSLKAPRNDLSPASSGNAVYDFFIGRELNPRIGTFDLKYFCELRPG
                     LIGWVVINLVMLLAEMKIQDRAVPSLAMILVNSFQLLYVVDALWNEEALLTTMDIIHD
                     GFGFMLAFGDLVWVPFIYSFQAFYLVSHPNEVSWPMASLIIVLKLCGYVIFRGANSQK
                     NAFRKNPSDPKLAHLKTIHTSSGKNLLVSGWWGFVRHPNYLGDLIMALAWSLPCGFNH
                     ILPYFYIIYFTMLLVHREARDEYHCKKKYGVAWEKYCQRVPYRIFPYIY"
     3'UTR           1924..3714
                     /gene="LBR"
BASE COUNT         1046 a          644 c          759 g         1265 t
ORIGIN      
        1 ccgggttgct gtgcgactat tctccgggag ccgttcgtgt caccgccgga acctggcgca
       61 ggttaattat agaaaatgcc aagtaggaaa tttgccgatg gtgaagtggt aagaggtcga
      121 tggcctggga gttcacttta ttatgaagta gaaattctga gccacgacag cacctcccag
      181 ctttacactg tgaagtataa agatggaaca gagcttgaat tgaaagagaa tgatattaag
      241 cctttaactt cctttaggca aaggaaaggt ggctcaactt ccagttcccc ttccagacgc
      301 cgagggagtc gatcaaggtc acgctcccga tcccctggtc gaccacctaa aagtgcccgc
      361 cgatctgctt ctgcttccca ccaggccgac attaaggaag caaggaggga agtggaagtt
      421 aaattgactc cgctgattct gaagccattt ggaaatagca tcagcagata taatggggag
      481 cctgagcata ttgagagaaa tgacgcacct cataaaaata cacaggaaaa attcagtttg
      541 tcacaagaaa gcagttacat agcaacacag tatagccttc gtccaagaag agaagaagtc
      601 aaattaaaag aaatagattc taaggaagaa aaatacgttg caaaagaact ggcagtgaga
      661 acctttgaag tgacccccat ccgggcaaag gacttggagt ttggaggagt acctggtgtg
      721 tttctcatca tgtttggcct gcctgtgttc ctcttcctgt tgctgttgat gtgtaaacag
      781 aaagatccca gtcttctgaa tttccctcct cctttgccag ctttgtatga gttatgggaa
      841 accagagtat ttggggtcta cctcctgtgg tttttgattc aagtcctgtt ctacctactg
      901 ccaattggaa aggttgtaga aggaacgcct cttattgatg gaagaagact caagtataga
      961 ttaaatggat tctatccttt tatcctgaca tctgcagtca tcggaacatc tctcttccag
     1021 ggcgtagagt ttcattacgt gtacagtcat tttcttcagt ttgcacttgc ggccactgtt
     1081 ttttgtgtgg tcttgagtgt gtatctctac atgcgctctt tgaaagcgcc ccggaatgac
     1141 ctgtcgcctg ccagctctgg aaatgctgtc tatgatttct tcattggccg tgaattaaac
     1201 cctcgaattg gtacttttga tctcaaatac ttttgtgaat tgcgccccgg attgattgga
     1261 tgggtggtta ttaacttggt gatgcttttg gctgaaatga aaatacagga ccgcgctgtt
     1321 ccatccttgg ccatgatttt agttaatagt ttccagcttc tctatgtggt ggatgctctc
     1381 tggaatgagg aagcgttgtt gacgaccatg gacatcatcc acgatggatt tggattcatg
     1441 ctggcttttg gagacttggt gtgggttccc tttatttaca gcttccaagc cttttattta
     1501 gtcagtcatc caaatgaagt gtcttggcca atggcttctc taattattgt tctgaaactt
     1561 tgtggttatg taatcttccg aggtgcaaat tctcagaaaa atgcattccg gaaaaatccc
     1621 agtgatccaa agcttgcaca tttaaaaacc attcatactt caagtggaaa aaatcttcta
     1681 gtttctggat ggtggggctt tgttcgccac cccaattact tgggtgatct catcatggcc
     1741 ttggcgtggt ccctcccatg tggttttaac cacattctgc cttatttcta cataatttat
     1801 ttcaccatgt tgcttgtcca ccgagaagct cgtgacgagt accactgtaa gaagaaatac
     1861 ggcgtggctt gggaaaagta ctgtcagcgt gtgccctacc gtatatttcc atacatctac
     1921 taatgctctt ctggcttttc tacaaaatac tcctgcaatt ccagctgcca tttgcaaaaa
     1981 caggaaaaaa atccgaaact ttcttttgtt gcactgacag ggtctgtact tttttttttc
     2041 tttttgagtc aggactatgg agccgagtag ttgatctttt aatatagccg tgtttacttg
     2101 tattaactta cagttaacat aggaaaaata caagtaagga tgtgagaatt tgcattttaa
     2161 tgggaaattt tcaaccctta atctgaaaac agaagacagt cttaatataa atgtactgtg
     2221 aagaatgcta ttgatgttta tggtttctga ttacttttca aattttgatg tttttttgcc
     2281 agttggcttt tcttaaatga aaacactgtt ccatttaaag tacatttatg ttttattcag
     2341 taagagaata gaattttcat ttgtttttct ttaaatcctt tactaattat ataatttgaa
     2401 agcaaaaaga agggcctata ttaaatgctg aaagtgaaaa gtgatgacat tattagcaga
     2461 cactgcttaa aggagaccat ttgtagcagt tggcttaacc tcaacttcta aaactacatt
     2521 gaaaatgtaa atacatagct tagttttttg taatatatgg tgacttcaga tttttttgta
     2581 cagtattttg aatgtgagat gattgtcagg actaactgtc tttttaacaa aacattttca
     2641 gtattttaaa taaaattttg taaagtaatg tgaattaaaa attttggaac aattagaatt
     2701 cattcactat tgtatagaag atgctgttaa aacataggaa gggtattttt cttgatccaa
     2761 agtttgtgaa tttggctttg ctacctcaat tgcaggtgtt tgtttgcctt tataaactgt
     2821 tgcaaataga aaaaaaatag aataagtata tatttttgga gtaacatcaa tatttaaaca
     2881 tttttacaca gatcggtgtt tgaaaatttg ccatttcagg ctaatatttt tatatatttt
     2941 tgacttttta aaagttcatc agtgtttttg ctactgttaa gcttatgcag tttatactgt
     3001 attttttatg tatcctttat atttaccaaa cctgactccc tgtaaaggag tgctgtctta
     3061 aaaacaactg aaggggttaa agtcgtttct tttagtttaa tagatgtgca taaggtagct
     3121 ttagcaatta aattctagtg aagttgatat agtctcattt ttaattgtcc tgtaatggaa
     3181 cagtagcaaa ttcactaaac ttttgtgttc agagttaaat tgttctcagt actttcaatg
     3241 taggggaatg taataaacat agtgtgtatg tttgggtttt aattacacat tttatatatg
     3301 agccatttag atatgcagtg ttaattctat actgcatttg aagtgtatgt aacttagctt
     3361 atgttaatgc agtcatgaag ttggtttgct ccagcatccg gtagtcttta aacattcttt
     3421 tagtgaaatt gtcattgttt tatcagtgct aatgtgtgca agcagttttt ttattttgct
     3481 tttctcctgg catcagaaag tggtggcgtt ttctgtactg gattgcacca aggaagcttt
     3541 tggggaggaa ggaaggacat taaattcttt ccctggtaat gaaaagagcc ctttatcaat
     3601 acagtgctgc aatttctgga tatcagctac actttgtttt taagtttgtt tttgacatgt
     3661 ttatttggca aattttataa tgaagtttta agttgaaaat aaaatgtagc aaca
//