LOCUS       HUMMAC2A                2257 bp    mRNA    linear   HUM 26-JUL-1993
DEFINITION  Human Mac-2 binding protein mRNA, complete cds.
ACCESSION   L13210
VERSION     L13210.1
KEYWORDS    L3 antigen; Mac-2 antigen; Mac-2 binding protein; cysteine-rich
            domain; macrophage scavenger receptor; proteolytic cleavage.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2257)
  AUTHORS   Koths,K., Taylor,E., Halenbeck,R., Casipit,C. and Wang,A.
  TITLE     Cloning and characterization of a human Mac-2-binding protein, a
            new member of the superfamily defined by the macrophage scavenger
            receptor cysteine-rich domain
  JOURNAL   J. Biol. Chem. 268 (19), 14245-14249 (1993)
   PUBMED   8390986
COMMENT     Original source text: Homo sapiens cDNA to mRNA.
FEATURES             Location/Qualifiers
     source          1..2257
                     /db_xref="H-InvDB:HIT000192184"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /cell_line="THP-1"
     CDS             180..1937
                     /note="major proteolytic cleavage site at bp 1484-1485;
                     cysteine-rich domain, similar to human scavenger receptor
                     cysteine-rich domain, at bp 234-554"
                     /codon_start=1
                     /product="Mac-2 binding protein"
                     /protein_id="AAA36193.1"
                     /db_xref="GI:307153"
                     /translation="MTPPRLFWVWLLVAGTQGVNDGDMRLADGGATNQGRVEIFYRGQ
                     WGTVCDNLWDLTDASVVCRALGFENATQALGRAAFGQGSGPIMLDEVQCTGTEASLAD
                     CKSLGWLKSNCRHERDAGVVCTNETRSTHTLDLSRELSEALGQIFDSQRGCDLSISVN
                     VQGEDALGFCGHTVILTANLEAQALWKEPGSNVTMSVDAECVPMVRDLLRYFYSRRID
                     ITLSSVKCFHKLASAYGARQLQGYCASLFAILLPQDPSFQMPLDLYAYAVATGDALLE
                     KLCLQFLAWNFEALTQAEAWPSVPTDLLQLLLPRSDLAVPSELALLKAVDTWSWGERA
                     SHEEVEGLVEKIRFPMMLPEELFELQFNLSLYWSHEALFQKKTLQALEFHTVPFQLLA
                     RYKGLNLTEDTYKPRIYTSPTWSAFVTDSSWSARKSQLVYQSRRGPLVKYSSDYFQAP
                     SDYRYYPYQSFQTPQHPSFLFQDKRVSWSLVYLPTIQSCWNYGFSCSSDELPVLGLTK
                     SGGSDRTIAYENKALMLCEGLFVADVTDFEGWKAAIPSALDTNSSKSTSSFPCPAGHF
                     NGFRTVIRPFYLTNSSGVD"
     sig_peptide     180..233
                     /experiment="experimental evidence, no additional details
                     recorded"
     mat_peptide     234..1934
                     /product="Mac-2 binding protein"
                     /experiment="experimental evidence, no additional details
                     recorded"
     regulatory      2235..2240
                     /regulatory_class="polyA_signal_sequence"
                     /note="putative"
     polyA_site      2257
BASE COUNT          437 a          738 c          636 g          446 t
ORIGIN      
        1 aatcgaaagt agactctttt ctgaagcatt tcctgggatc agcctgacca cgctccatac
       61 tgggagaggc ttctgggtca aaggaccagt ctgcagaggg atcctgtggc tggaagcgag
      121 gaggctccac acggccgttg cagctaccgc agccaggatc tgggcatcca ggcacggcca
      181 tgacccctcc gaggctcttc tgggtgtggc tgctggttgc aggaacccaa ggcgtgaatg
      241 atggtgacat gcggctggcc gatgggggcg ccaccaacca gggccgcgtg gagatcttct
      301 acagaggcca gtggggcact gtgtgtgaca acctgtggga cctgactgat gccagcgtcg
      361 tctgccgggc cctgggcttc gagaacgcca cccaggctct gggcagagct gccttcgggc
      421 aaggatcagg ccccatcatg ctggacgagg tccagtgcac gggaaccgag gcctcactgg
      481 ccgactgcaa gtccctgggc tggctgaaga gcaactgcag gcacgagaga gacgctggtg
      541 tggtctgcac caatgaaacc aggagcaccc acaccctgga cctctccagg gagctctcgg
      601 aggcccttgg ccagatcttt gacagccagc ggggctgcga cctgtccatc agcgtgaatg
      661 tgcagggcga ggacgccctg ggcttctgtg gccacacggt catcctgact gccaacctgg
      721 aggcccaggc cctgtggaag gagccgggca gcaatgtcac catgagtgtg gatgctgagt
      781 gtgtgcccat ggtcagggac cttctcaggt acttctactc ccgaaggatt gacatcaccc
      841 tgtcgtcagt caagtgcttc cacaagctgg cctctgccta tggggccagg cagctgcagg
      901 gctactgcgc aagcctcttt gccatcctcc tcccccagga cccctcgttc cagatgcccc
      961 tggacctgta tgcctatgca gtggccacag gggacgccct gctggagaag ctctgcctac
     1021 agttcctggc ctggaacttc gaggccttga cgcaggccga ggcctggccc agtgtcccca
     1081 cagacctgct ccaactgctg ctgcccagga gcgacctggc ggtgcccagc gagctggccc
     1141 tactgaaggc cgtggacacc tggagctggg gggagcgtgc ctcccatgag gaggtggagg
     1201 gcttggtgga gaagatccgc ttccccatga tgctccctga ggagctcttt gagctgcagt
     1261 tcaacctgtc cctgtactgg agccacgagg ccctgttcca gaagaagact ctgcaggccc
     1321 tggaattcca cactgtgccc ttccagttgc tggcccggta caaaggcctg aacctcaccg
     1381 aggataccta caagccccgg atttacacct cgcccacctg gagtgccttt gtgacagaca
     1441 gttcctggag tgcacggaag tcacaactgg tctatcagtc cagacggggg cctttggtca
     1501 aatattcttc tgattacttc caagccccct ctgactacag atactacccc taccagtcct
     1561 tccagactcc acaacacccc agcttcctct tccaggacaa gagggtgtcc tggtccctgg
     1621 tctacctccc caccatccag agctgctgga actacggctt ctcctgctcc tcggacgagc
     1681 tccctgtcct gggcctcacc aagtctggcg gctcagatcg caccattgcc tacgaaaaca
     1741 aagccctgat gctctgcgaa gggctcttcg tggcagacgt caccgatttc gagggctgga
     1801 aggctgcgat tcccagtgcc ctggacacca acagctcgaa gagcacctcc tccttcccct
     1861 gcccggcagg gcacttcaac ggcttccgca cggtcatccg ccccttctac ctgaccaact
     1921 cctcaggtgt ggactagacg gcgtggccca agggtggtga gaaccggaga accccaggac
     1981 gccctcactg caggctcccc tcctcggctt ccttcctctc tgcaatgacc ttcaacaacc
     2041 ggccaccaga tgtcgcccta ctcacctgag cgctcagctt caagaaatta ctggaaggct
     2101 tccactaggg tccaccagga gttctcccac cacctcacca gtttccaggt ggtaagcacc
     2161 aggacgccct cgaggttgct ctgggatccc cccacagccc ctggtcagtc tgcccttgtc
     2221 actggtctga ggtcattaaa attacattga ggttcct
//