LOCUS       RATPSEUDO               1447 bp    DNA     linear   ROD 12-APR-1996
DEFINITION  Rattus norvegicus p53 (PG-III) pseudogene, partial ORF.
ACCESSION   L12046
VERSION     L12046.1
KEYWORDS    tumor suppressor.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 1447)
  AUTHORS   Weghorst,C.M., Buzard,G.S., Calvert,R.J., Hulla,J.E. and Rice,J.M.
  TITLE     Cloning and sequence of a processed p53 pseudogene from rat: a
            potential source of false 'mutations' in PCR fragments of tumor DNA
  JOURNAL   Gene 166 (2), 317-322 (1995)
   PUBMED   8543183
FEATURES             Location/Qualifiers
     source          1..1447
                     /organism="Rattus norvegicus"
                     /mol_type="genomic DNA"
                     /strain="Fischer 344"
                     /db_xref="taxon:10116"
                     /sex="male"
                     /tissue_type="liver"
     exon            1..75
                     /note="this region of the pseudogene corresponds to exon 2
                     of the rat p53 cDNA; putative"
     regulatory      2..4
                     /regulatory_class="other"
                     /note="this site within the pseudogene corresponds to the
                     ATG translation start site of the rat p53 cDNA; putative"
     exon            76..97
                     /note="this region of the pseudogene corresponds to exon 3
                     of the rat p53 cDNA; putative"
     exon            98..315
                     /note="this region of the pseudogene corresponds to exon 4
                     of the rat p53 cDNA; putative"
     gene            168..542
                     /gene="p53 PG-III"
     CDS             <168..>542
                     /gene="p53 PG-III"
                     /note="tumor suppressor; this region of the pseudogene is
                     a potential open reading frame; putative"
                     /codon_start=1
                     /protein_id="AAA96797.1"
                     /translation="KVQRKPSKCQLLPHRNLELRPLSLLKNLSQLWLSSGLPAVSDNQ
                     VCYVHVLPSPKLAILPAGEDMPCAVMGQLHTSNWHLCACHGIYKKSQHMTEVMRRCSH
                     HERCSDGDDQTPPPYPTPSILSG"
     exon            316..498
                     /gene="p53 PG-III"
                     /note="this region of the pseudogene corresponds to exon 5
                     of the rat p53 cDNA; putative"
     exon            499..746
                     /note="this region of the pseudogene corresponds to exon 6
                     of the rat p53 cDNA; putative"
     exon            747..882
                     /note="this region of the pseudogene corresponds to exon 7
                     of the rat p53 cDNA; putative"
     exon            883..937
                     /note="this region of the pseudogene corresponds to exon 8
                     of the rat p53 cDNA; putative"
     exon            938..1031
                     /note="this region of the pseudogene corresponds to exon 9
                     of the rat p53 cDNA; putative"
     exon            1032..1447
                     /note="this region of the pseudogene corresponds to exon
                     10 of the rat p53 cDNA; putative"
     regulatory      1107..1109
                     /regulatory_class="other"
                     /note="this site within the pseudogene corresponds to the
                     translation stop site of the rat p53 cDNA; putative"
BASE COUNT          366 a          388 c          336 g          357 t
ORIGIN      
        1 catggagtat tcacagtagg atatcagcat caagctccct ctgagtcagg agacattttc
       61 aggctaatga aaactacttc ctccagaaga tatttggtcc agcaccatgg tgtcacctaa
      121 ttccttggaa gtcctgttcc agtcccagga tgttgcagag ttgttagaag gtccagagga
      181 agccctctaa gtgccagctc ctgccccaca ggaacctgga actgaggcct ctgtcccttc
      241 tcaaaaactt aagtcaacta tggctttcat ctgggcttcc tgcagtcagt gacaaccaag
      301 tctgctatgt gcacgtactt ccatccccga aattagctat tctgccagct ggtgaagaca
      361 tgccctgtgc agttatgggt cagcttcaca cctccaactg gcacctgtgc gcgtgccatg
      421 gcatctacaa gaagtcacaa cacatgactg aggtcatgag acgctgctcc caccatgagc
      481 gttgctctga tggtgatgac cagactccac ccccctaccc cacccccagc atcttatctg
      541 ggtagaagga aatttgtata ctgagtatct ggatgacagg cagactgttc agcacagtgt
      601 ggtggtactg tatgatctac ctgagctcgg ccccgactat accactatct actacaagta
      661 catgtgtaat agctcctgat tgggggagtt gggtggggca tgaaccgccg gcccatcctg
      721 accttcatca cattggaaaa ctccagtggg aaccttctgg gacaggacag ctttgaggtt
      781 cgtgcttgtg atgtcctgga aaagagagtc gaacagagga aaaaaaattc tgcaaaaagg
      841 aagaacattg ccccaacctg cccccaggga gtgctaagag aacactgtcc accagaacaa
      901 gcaaaaatca cttgatggag aatgtttcac ccttaagttc catgggcatg tgcacttcga
      961 gatgttctga gagctgaatt aaaggatgac catgctgcag aagagtcaag agacagcagg
     1021 gctcactcca gctacctgaa cagcaagagg ggccagtcta tttcctgcca ttaaaaaaaa
     1081 tcaagaaagt ggggcctgac tcagactggc aaccttgcat actgtcccca ccaccaacct
     1141 ccccctctcc tttcttggca ttttatgtct atagggtttg ttatgaggct gtgttggtcc
     1201 cttccactgc ctttttagcc ttgaagatag ggttcagccc tatctggttc ctggcatagg
     1261 ttggggcatg ggttggtagt tgccaagtct ctgccggccc agccaaattc tgtccagcca
     1321 gttgttggac catggcaccg aaaatgaaat ttcaccctac cccacaccct gtaagattct
     1381 atcttgagct ctcatgggat ctctatctgc caggacccat tgtcctccac tctgcaaaac
     1441 cagtctg
//