LOCUS RATPSEUDO 1447 bp DNA linear ROD 12-APR-1996 DEFINITION Rattus norvegicus p53 (PG-III) pseudogene, partial ORF. ACCESSION L12046 VERSION L12046.1 KEYWORDS tumor suppressor. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 1447) AUTHORS Weghorst,C.M., Buzard,G.S., Calvert,R.J., Hulla,J.E. and Rice,J.M. TITLE Cloning and sequence of a processed p53 pseudogene from rat: a potential source of false 'mutations' in PCR fragments of tumor DNA JOURNAL Gene 166 (2), 317-322 (1995) PUBMED 8543183 FEATURES Location/Qualifiers source 1..1447 /organism="Rattus norvegicus" /mol_type="genomic DNA" /strain="Fischer 344" /db_xref="taxon:10116" /sex="male" /tissue_type="liver" exon 1..75 /note="this region of the pseudogene corresponds to exon 2 of the rat p53 cDNA; putative" regulatory 2..4 /regulatory_class="other" /note="this site within the pseudogene corresponds to the ATG translation start site of the rat p53 cDNA; putative" exon 76..97 /note="this region of the pseudogene corresponds to exon 3 of the rat p53 cDNA; putative" exon 98..315 /note="this region of the pseudogene corresponds to exon 4 of the rat p53 cDNA; putative" gene 168..542 /gene="p53 PG-III" CDS <168..>542 /gene="p53 PG-III" /note="tumor suppressor; this region of the pseudogene is a potential open reading frame; putative" /codon_start=1 /protein_id="AAA96797.1" /translation="KVQRKPSKCQLLPHRNLELRPLSLLKNLSQLWLSSGLPAVSDNQ VCYVHVLPSPKLAILPAGEDMPCAVMGQLHTSNWHLCACHGIYKKSQHMTEVMRRCSH HERCSDGDDQTPPPYPTPSILSG" exon 316..498 /gene="p53 PG-III" /note="this region of the pseudogene corresponds to exon 5 of the rat p53 cDNA; putative" exon 499..746 /note="this region of the pseudogene corresponds to exon 6 of the rat p53 cDNA; putative" exon 747..882 /note="this region of the pseudogene corresponds to exon 7 of the rat p53 cDNA; putative" exon 883..937 /note="this region of the pseudogene corresponds to exon 8 of the rat p53 cDNA; putative" exon 938..1031 /note="this region of the pseudogene corresponds to exon 9 of the rat p53 cDNA; putative" exon 1032..1447 /note="this region of the pseudogene corresponds to exon 10 of the rat p53 cDNA; putative" regulatory 1107..1109 /regulatory_class="other" /note="this site within the pseudogene corresponds to the translation stop site of the rat p53 cDNA; putative" BASE COUNT 366 a 388 c 336 g 357 t ORIGIN 1 catggagtat tcacagtagg atatcagcat caagctccct ctgagtcagg agacattttc 61 aggctaatga aaactacttc ctccagaaga tatttggtcc agcaccatgg tgtcacctaa 121 ttccttggaa gtcctgttcc agtcccagga tgttgcagag ttgttagaag gtccagagga 181 agccctctaa gtgccagctc ctgccccaca ggaacctgga actgaggcct ctgtcccttc 241 tcaaaaactt aagtcaacta tggctttcat ctgggcttcc tgcagtcagt gacaaccaag 301 tctgctatgt gcacgtactt ccatccccga aattagctat tctgccagct ggtgaagaca 361 tgccctgtgc agttatgggt cagcttcaca cctccaactg gcacctgtgc gcgtgccatg 421 gcatctacaa gaagtcacaa cacatgactg aggtcatgag acgctgctcc caccatgagc 481 gttgctctga tggtgatgac cagactccac ccccctaccc cacccccagc atcttatctg 541 ggtagaagga aatttgtata ctgagtatct ggatgacagg cagactgttc agcacagtgt 601 ggtggtactg tatgatctac ctgagctcgg ccccgactat accactatct actacaagta 661 catgtgtaat agctcctgat tgggggagtt gggtggggca tgaaccgccg gcccatcctg 721 accttcatca cattggaaaa ctccagtggg aaccttctgg gacaggacag ctttgaggtt 781 cgtgcttgtg atgtcctgga aaagagagtc gaacagagga aaaaaaattc tgcaaaaagg 841 aagaacattg ccccaacctg cccccaggga gtgctaagag aacactgtcc accagaacaa 901 gcaaaaatca cttgatggag aatgtttcac ccttaagttc catgggcatg tgcacttcga 961 gatgttctga gagctgaatt aaaggatgac catgctgcag aagagtcaag agacagcagg 1021 gctcactcca gctacctgaa cagcaagagg ggccagtcta tttcctgcca ttaaaaaaaa 1081 tcaagaaagt ggggcctgac tcagactggc aaccttgcat actgtcccca ccaccaacct 1141 ccccctctcc tttcttggca ttttatgtct atagggtttg ttatgaggct gtgttggtcc 1201 cttccactgc ctttttagcc ttgaagatag ggttcagccc tatctggttc ctggcatagg 1261 ttggggcatg ggttggtagt tgccaagtct ctgccggccc agccaaattc tgtccagcca 1321 gttgttggac catggcaccg aaaatgaaat ttcaccctac cccacaccct gtaagattct 1381 atcttgagct ctcatgggat ctctatctgc caggacccat tgtcctccac tctgcaaaac 1441 cagtctg //