LOCUS       AH002937                2535 bp    DNA     linear   HUM 24-JAN-2017
DEFINITION  Homo sapiens phosphoglycerate kinase (PGK1) gene, complete cds.
ACCESSION   AH002937 J00288 L00159 L00160
VERSION     AH002937.2
KEYWORDS    phosphoglycerate kinase.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 453 to 2535)
  AUTHORS   Michelson,A.M., Markham,A.F. and Orkin,S.H.
  TITLE     Isolation and DNA sequence of a full-length cDNA clone for human X
            chromosome-encoded phosphoglycerate kinase
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 80 (2), 472-476 (1983)
   PUBMED   6188151
REFERENCE   2  (bases 1448 to 1567)
  AUTHORS   Singer-Sam,J., Simmer,R.L., Keith,D.H., Shively,L., Teplitz,M.,
            Itakura,K., Gartler,S.M. and Riggs,A.D.
  TITLE     Isolation of a cDNA clone for human X-linked 3-phosphoglycerate
            kinase by use of a mixture of synthetic oligodeoxyribonucleotides
            as a detection probe
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 80 (3), 802-806 (1983)
   PUBMED   6572369
REFERENCE   3  (bases 1 to 2535)
  AUTHORS   Singer-Sam,J., Keith,D.H., Tani,K., Simmer,R.L., Shively,L.,
            Lindsay,S., Yoshida,A. and Riggs,A.D.
  TITLE     Sequence of the promoter region of the gene for human X-linked
            3-phosphoglycerate kinase]
  JOURNAL   Gene 32 (3), 409-417 (1984)
   PUBMED   6099325
COMMENT     On or before Jan 24, 2017 this sequence version replaced gi:189903,
            gi:189904, gi:561958.
FEATURES             Location/Qualifiers
     source          1..2535
                     /organism="Homo sapiens"
                     /mol_type="unassigned DNA"
                     /db_xref="taxon:9606"
                     /map="Xq13.3"
     source          1..812
                     /organism="Homo sapiens"
                     /mol_type="unassigned DNA"
                     /db_xref="taxon:9606"
                     /map="Xq13.3"
                     /clone="lambda-PGK-TY1"
     source          913..2535
                     /organism="Homo sapiens"
                     /mol_type="unassigned DNA"
                     /db_xref="taxon:9606"
                     /chromosome="X"
                     /map="Xq13.3"
                     /clone="pGK824; pHPGK-72"
                     /cell_line="LS174T"
                     /tissue_type="adenocarcinoma; liver"
                     /dev_stage="fetus"
     gene            437..2101
                     /gene="PGK1"
     mRNA            join(437..596,913..>2101)
                     /gene="PGK1"
                     /product="phosphoglycerate kinase"
     exon            437..596
                     /gene="PGK1"
                     /note="phosphoglycerate kinase; G00-120-282"
                     /number=1
     misc_feature    438
                     /gene="PGK1"
                     /note="alternative mRNA start"
     misc_feature    446
                     /gene="PGK1"
                     /note="alternative mRNA start"
     CDS             join(532..596,913..2101)
                     /gene="PGK1"
                     /EC_number="2.7.2.3"
                     /note="role in glycolysis"
                     /codon_start=1
                     /product="phosphoglycerate kinase"
                     /protein_id="AAA60078.1"
                     /translation="MSLSNKLTLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAV
                     PSIKFCLDNGAKSVVLMSHLGRPDGVPMPDKYSLEPVAVELKSLLGKDVLFLKDCVGP
                     EVEKACANPAAGSVILLENLRFHVEEEGKGKDASGNKVKAEPAKIEAFRASLSKLGDV
                     YVNDAFGTAHRAHSSMVGVNLPQKAGGFLMKKELNYFAKALESPERPFLAILGGAKVA
                     DKIQLINNMLDKVNEMIIGGGMAFTFLKVLNNMEIGTSLFDEEGAKIVKDLMSKAEKN
                     GVKITLPVDFVTADKFDENAKTGQATVASGIPAGWMGLDCGPESSKKYAEAVTRAKQI
                     VWNGPVGVFEWEAFARGTKALMDEVVKATSRGCITIIGGGDTATCCAKWNTEDKVSHV
                     STGGGASLELLEGKVLPGVDALSNI"
     intron          597..>812
                     /gene="PGK1"
                     /number=A
     gap             813..912
                     /estimated_length=unknown
BASE COUNT          549 a          598 c          683 g          605 t
ORIGIN      
        1 gaattccggg gttggggttg cgccttttcc aaggcagccc tgggtttgcg cagggacgcg
       61 gctgctctgg gcgtggttcc gggaaacgca gcggcgccga ccctgggtct cgcacattct
      121 tcacgtccgt tcgcagcgtc acccggatct tcgccgctac ccttgtgggc cccccggcga
      181 cgcttcctcg tccgccccta agtcgggaag gttccttgcg gttcgcggcg tgccggacgt
      241 gacaaacgga agccgcacgt ctcactagta ccctcgcaga cggacagcgc cagggagcaa
      301 tggcagcgcg ccgaccgcga tgggctgtgg ccaatagcgg ctgctcagca gggcgcgccg
      361 agagcagcgg ccgggaaggg gcggtgcggg aggcggggtg tggggcggta gtgtgggccc
      421 tgttcctgcc cgcgcggtgt tccgcattct gcaagcctcc ggagcgcacg tcggcagtcg
      481 gctccctcgt tgaccgaatc accgacctct ctccccagct gtatttccaa aatgtcgctt
      541 tctaacaagc tgacgctgga caagctggac gttaaaggga agcgggtcgt tatgaggtaa
      601 ttctgcacgt ttgcccgcgt gctctctgtg ctctgtcgca aacctctttg gccggagccg
      661 acttgttctc tcgtctgctc taagttcttt tagcttttgg ctggccccag gggtcctagg
      721 cttggagggc aggctgctca cgggtttggt ggtttctagc cgcattttcc ccagcccaga
      781 aagcacccga agtcaccttc ggggatggat ccnnnnnnnn nnnnnnnnnn nnnnnnnnnn
      841 nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
      901 nnnnnnnnnn nnagtcgact tcaatgttcc tatgaagaac aaccagataa caaacaacca
      961 gaggattaag gctgctgtcc caagcatcaa attctgcttg gacaatggag ccaagtcggt
     1021 agtccttatg agccacctag gccggcctga tggtgtgccc atgcctgaca agtactcctt
     1081 agagccagtt gctgtagaac tcaaatctct gctgggcaag gatgttctgt tcttgaagga
     1141 ctgtgtaggc ccagaagtgg agaaagcctg tgccaaccca gctgctgggt ctgtcatcct
     1201 gctggagaac ctccgctttc atgtggagga agaagggaag ggaaaagatg cttctgggaa
     1261 caaggttaaa gccgagccag ccaaaataga agctttccga gcttcacttt ccaagctagg
     1321 ggatgtctat gtcaatgatg cttttggcac tgctcacaga gcccacagct ccatggtagg
     1381 agtcaatctg ccacagaagg ctggtgggtt tttgatgaag aaggagctga actactttgc
     1441 aaaggccttg gagagcccag agcgaccctt cctggccatc ctgggcggag ctaaagttgc
     1501 agacaagatc cagctcatca ataatatgct ggacaaagtc aatgagatga ttattggtgg
     1561 tggaatggct tttaccttcc ttaaggtgct caacaacatg gagattggca cttctctgtt
     1621 tgatgaagag ggagccaaga ttgtcaaaga cctaatgtcc aaagctgaga agaatggtgt
     1681 gaagattacc ttgcctgttg actttgtcac tgctgacaag tttgatgaga atgccaagac
     1741 tggccaagcc actgtggctt ctggcatacc tgctggctgg atgggcttgg actgtggtcc
     1801 tgaaagcagc aagaagtatg ctgaggctgt cactcgggct aagcagattg tgtggaatgg
     1861 tcctgtgggg gtatttgaat gggaagcttt tgcccgggga accaaagctc tcatggatga
     1921 ggtggtgaaa gccacttcta ggggctgcat caccatcata ggtggtggag acactgccac
     1981 ttgctgtgcc aaatggaaca cggaggataa agtcagccat gtgagcactg ggggtggtgc
     2041 cagtttggag ctcctggaag gtaaagtcct tcctggggtg gatgctctca gcaatattta
     2101 gtactttcct gccttttagt tcctgtgcac agcccctaag tcaacttagc attttctgca
     2161 tctccacttg gcattagcta aaaccttcca tgtcaagatt cagctagtgg ccaagagatg
     2221 cagtgccagg aacccttaaa cagttgcaca gcatctcagc tcatcttcac tgcaccctgg
     2281 atttgcatac attcttcaag atcccatttg aattttttag tgactaaacc attgtgcatt
     2341 ctagagtgca tatatttata ttttgcctgt taaaaagaaa gtgagcagtg ttagcttagt
     2401 tctcttttga tgtaggttat tatgattagc tttgtcactg tttcactact cagcatggaa
     2461 acaagatgaa attccatttg taggtagtga gacaaaattg atgatccatt aagtaaacaa
     2521 taaaagtgtc cattg
//