LOCUS       KZ451998             2622545 bp    DNA     linear   CON 06-DEC-2017
DEFINITION  Apostasia shenzhenica isolate ASH160606 ecotype Shenzhen unplaced
            genomic scaffold fragScaff_scaffold_115, whole genome shotgun
            sequence.
ACCESSION   KZ451998 PEFY01000000
VERSION     KZ451998.1
DBLINK      BioProject: PRJNA310678
            BioSample: SAMN04453324
KEYWORDS    WGS.
SOURCE      Apostasia shenzhenica
  ORGANISM  Apostasia shenzhenica
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliophyta; Liliopsida; Asparagales; Orchidaceae;
            Apostasioideae; Apostasia.
REFERENCE   1  (bases 1 to 2622545)
  AUTHORS   Zhang,G.Q., Liu,K.W., Li,Z., Lohaus,R., Hsiao,Y.Y., Niu,S.C.,
            Wang,J.Y., Lin,Y.C., Xu,Q., Chen,L.J., Yoshida,K., Fujiwara,S.,
            Wang,Z.W., Zhang,Y.Q., Mitsuda,N., Wang,M., Liu,G.H., Pecoraro,L.,
            Huang,H.X., Xiao,X.J., Lin,M., Wu,X.Y., Wu,W.L., Chen,Y.Y.,
            Chang,S.B., Sakamoto,S., Ohme-Takagi,M., Yagi,M., Zeng,S.J.,
            Shen,C.Y., Yeh,C.M., Luo,Y.B., Tsai,W.C., Van de Peer,Y. and
            Liu,Z.J.
  TITLE     The Apostasia genome and the evolution of orchids
  JOURNAL   Nature 549 (7672), 379-383 (2017)
   PUBMED   28902843
REFERENCE   2  (bases 1 to 2622545)
  AUTHORS   Liu,Z.-J.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-OCT-2017) Shenzhen Key Laboratory for Orchid
            Conservation and Utilization, The National Orchid Conservation
            Center of China, Wangtong Road, Shenzhen 518114, China
COMMENT     ##Genome-Assembly-Data-START##
            Assembly Method        :: AllPaths v. 49292; Pbjelly v. 14.1;
                                      fragscaff v. 140324
            Genome Representation  :: Full
            Expected Final Version :: Yes
            Genome Coverage        :: 455.49x
            Sequencing Technology  :: Illumina; PacBio
            ##Genome-Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..2622545
                     /organism="Apostasia shenzhenica"
                     /mol_type="genomic DNA"
                     /submitter_seqid="fragScaff_scaffold_115"
                     /isolate="ASH160606"
                     /db_xref="taxon:1088818"
                     /chromosome="Unknown"
                     /tissue_type="stem; leaf"
                     /ecotype="Shenzhen"
                     /country="China: Shenzhen"
     assembly_gap    2454..9486
                     /estimated_length=7033
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            11897..15137
                     /gene="AAK6"
                     /locus_tag="AXF42_Ash012298"
     mRNA            join(11897..12138,13943..14063,14907..15137)
                     /gene="AAK6"
                     /locus_tag="AXF42_Ash012298"
                     /product="Adenylate kinase isoenzyme 6 like"
     CDS             join(11897..12138,13943..14063,14907..15137)
                     /gene="AAK6"
                     /locus_tag="AXF42_Ash012298"
                     /EC_number="2.7.4.3"
                     /codon_start=1
                     /product="Adenylate kinase isoenzyme 6 like"
                     /protein_id="PKA53357.1"
                     /translation="MAGGGACDGASRRRPNILVTGTPGTGKTTTCSLLADATLFRHVN
                     VGELVKTKSLHDGWDEEFECHIINEELVRSLNLTDTCPQLAILNDTCFCALLINGIIK
                     SFTCSEVFPPISCINISMKVCDELEDLMEDGGIIVDYHGCDFFPEQWFDRVIVLQTDN
                     SILHDRLTSRYQTITFLLIRSLNLIIIALNNVNANYL"
     assembly_gap    20560..20569
                     /estimated_length=10
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     assembly_gap    25757..25815
                     /estimated_length=59
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            28190..30808
                     /locus_tag="AXF42_Ash012299"
     mRNA            28190..30808
                     /locus_tag="AXF42_Ash012299"
                     /product="Putative ribonuclease H protein"
     CDS             28190..30808
                     /locus_tag="AXF42_Ash012299"
                     /EC_number="3.1.27.-"
                     /note="GO_function: GO:0003723 - RNA binding [Evidence
                     IEA];
                     GO_function: GO:0003964 - RNA-directed DNA polymerase
                     activity [Evidence IEA];
                     GO_process: GO:0006278 - RNA-dependent DNA replication
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Putative ribonuclease H protein"
                     /protein_id="PKA53358.1"
                     /db_xref="InterPro:IPR000477"
                     /db_xref="InterPro:IPR005135"
                     /translation="MIKAIFWNCRGVKKSASRNHLQTLVREHSPVVICLLETRVQSFS
                     RREVDRLVGRQWDFHVEPSVDKSGGIIVCWLNHITRLQVLHSNKQVVVAQATVMGQHI
                     WHICAVYANKDYIKRRIIWDSISPLLDAETPAIVGGDFNCILSQEDKRGGKPFIPTEA
                     HNEFASFLTNNDLHDGWNGGQRYSWCNNQKGKARMWVRLDRVCFNSAALSALPGSVVT
                     HLTRIGSDHCPLLVQGRNLEFKPQGGILKFEDVWLDEEGSKEIVVREWHKPAHGSPPA
                     ILNHKFARTLRALKIWSREKFGDIHARAKDLESRIAELQLRESVGTGLNDSELDFLLQ
                     LVADYNTTLSRLETWWLQRAKVKWAKCGDRNSSFFHKAATCRRRTNHIHRLVGQDGEE
                     ITDKEGIQAALVDHFSSKWRPPIAPLSELSIPPPRATISQEDALRISSPVSNEEIVAA
                     INSLGNNKAPGIDGITGSFLKGYWSATSPDVLTVVHHFFSYGSMPKRWKDTLVVLIPK
                     VQGAELPSQFRPISLCTTIYKVIAKILINRVKNVLISLISQEQGAFVPGRGIADNCLL
                     AQEIMQKLASSESSTGYMSVKVDMEQAYDRMRWDFLQKILQHFGFPDNWSRWALACVE
                     APRFALMINGQKSNWIEATCGFRQGCPLSPYLFIFCSELLSLLINQHQNRDDLLGIRT
                     TAHGPLITHLLFADDILMFAPATCRAVRVLSSIFDTYCSWSGQKINKAKSSICFSKKM
                     KRSRKRMIANKWGFRTQAEGKYLGIPLISRRPVKADFYHIIESVRGRISLWGTRHLSL
                     AGRVTLINSVLTSIPIFSLSHTFVPDNVLAEIEKLVRRFLWSGNLTSNAAHLVAWEHV
                     TKPKNAGGLGIHRLEE"
     assembly_gap    31477..37869
                     /estimated_length=6393
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            complement(43677..96559)
                     /gene="IPMSB"
                     /locus_tag="AXF42_Ash012300"
     mRNA            complement(join(43677..43806,43893..44041,57161..57295,
                     57382..57465,60666..60740,60828..60861,67272..67372,
                     80344..80430,81996..82085,85258..85338,85419..85632,
                     95826..96559))
                     /gene="IPMSB"
                     /locus_tag="AXF42_Ash012300"
                     /product="2-isopropylmalate synthase B"
     CDS             complement(join(43677..43806,43893..44041,57161..57295,
                     57382..57465,60666..60740,60828..60861,67272..67372,
                     80344..80430,81996..82085,85258..85338,85419..85632,
                     95826..96559))
                     /gene="IPMSB"
                     /locus_tag="AXF42_Ash012300"
                     /EC_number="2.3.3.13"
                     /note="GO_function: GO:0003824 - catalytic activity
                     [Evidence IEA];
                     GO_function: GO:0003852 - 2-isopropylmalate synthase
                     activity [Evidence IEA];
                     GO_process: GO:0009098 - leucine biosynthetic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="2-isopropylmalate synthase B"
                     /protein_id="PKA53359.1"
                     /db_xref="InterPro:IPR000891"
                     /db_xref="InterPro:IPR013709"
                     /translation="MPMPTAICFASATPNLVVSAAASDPNYGISRVPSLLTKSLSSSS
                     SVLLHHHRRNVTRSSVGSFLAAVPGARPFAARCSLVSRPEYVPNHIPDPGYVRIFDTT
                     LRDGEQSPGATMTSNEKLAVARQLSRLGVDIIEAGFPASSPDDLEAVRSIAMEIGNKP
                     VEGGHLPVICGLSRCNKKDIDTAWEAVRHARRPRVHTFIATSEIHMQHKLRKTREEVV
                     RIAREMVAYAGSLGCKDIEFSPEDAGRSDREFLYLILEEVIKAGATTLNIPDTVGYTV
                     PDEFGQLISDIKSNTRGIENVIISTHCQNDLGLATANTLAGACAGARQLEVTVNGIGE
                     RAGNASLEEVVMAIRCRSQSMGGLYTGINTKHITVASRMVVECSGLLIQPHKAIVGAN
                     AFAHESGIHQDGMLKFKGTYEIMSPDDVGLTRSNESGIVLGKLSGRHALKSKLIELGY
                     DVSGKELDDIFKRFKEIAEKKKRVSDDDIEALVSSEIFQPKVIWSLGDLQVTSGTLGL
                     STATVKLTDSEGVEKVACSVGTGPVDAAYKAVDSIVQVPVTLMEYSLNSVTEGIDAVA
                     TTRVLIKGDENGHKPTHALTGETLDRNFSGSGADMDVVVSSVRAYINALNKILSFREK
                     SLKEVPNSQAVIV"
     gene            complement(113144..114214)
                     /locus_tag="AXF42_Ash012301"
     mRNA            complement(113144..114214)
                     /locus_tag="AXF42_Ash012301"
                     /product="putative sugar phosphate/phosphate translocator"
     CDS             complement(113144..114214)
                     /locus_tag="AXF42_Ash012301"
                     /codon_start=1
                     /product="putative sugar phosphate/phosphate translocator"
                     /protein_id="PKA53360.1"
                     /db_xref="InterPro:IPR004853"
                     /translation="MGREGSSAAGVSDSVVKKVILSYFYVSVWIFLSFTVIVYNKYIL
                     DPKMYNWPFPISLTMIHMGFCSSLAVLLVRGLRLVELPTSPTMTREFYLSSVVPIGAL
                     YAFSLWFSNSAYIYLSVSFIQMLKALMPVAVYSISILFSKETFRTSTMANMISISLGV
                     AIAAYGEAHFNAWGVFLQLGAVAFEATRLVLIQVLLSSKGITLNPITTLYYVAPCCLV
                     FLALPWALVELPTLRSTSSFHLDFLIFGTNSSCAFALNLAVFLLVGKTSALTMNVAGI
                     VKDWLLIAFSWSVIRDRVTTINLFGYGIAFLGVAYYNHIKLHALKAKEAQKKTAPNDE
                     EARSLIELGNSEEMGRKNDSQA"
     gene            complement(116924..166029)
                     /locus_tag="AXF42_Ash012302"
     mRNA            complement(join(116924..116989,125484..125600,
                     131549..131653,144264..144356,144804..144998,
                     145071..145158,145228..145277,158046..158104,
                     158179..158398,158463..158543,165610..165687,
                     165777..165872,165964..166029))
                     /locus_tag="AXF42_Ash012302"
                     /product="putative mannose-1-phosphate guanylyltransferase
                     2"
     CDS             complement(join(116924..116989,125484..125600,
                     131549..131653,144264..144356,144804..144998,
                     145071..145158,145228..145277,158046..158104,
                     158179..158398,158463..158543,165610..165687,
                     165777..165872,165964..166029))
                     /locus_tag="AXF42_Ash012302"
                     /note="GO_function: GO:0016779 - nucleotidyltransferase
                     activity [Evidence IEA];
                     GO_process: GO:0009058 - biosynthetic process [Evidence
                     IEA]"
                     /codon_start=1
                     /product="putative mannose-1-phosphate guanylyltransferase
                     2"
                     /protein_id="PKA53361.1"
                     /db_xref="InterPro:IPR001451"
                     /db_xref="InterPro:IPR005835"
                     /translation="MDFQVVVLAGGSSKKLAPLVSKEIPKPLVPVANRPVLSYVLELL
                     EASNLKDLIVVVEGEDTALRVGGWISSAYVDRLHVEVAAVPEDSGTADALRAVVHHLT
                     AQDILVVSGDLVSDVPPGAVAATHRRLDAAVTALLCCTPVSVPSEAGSSGGKDKARKP
                     SRVNIVGLDHTRQYLLHVAAGGEVEKDIKVQKSILQSNGQIEIRADLMDAHMYAFKRA
                     ILQEVLDKKEIYHNIRHEIFPYLVRTQLKSEVLNNGISKGEERHSGITYLQNTLDPTC
                     AVLDRTHACCAYIANKSKYCSRLNSIQAFFDINRDVVGEAAHLSGYSFSTQNNFVHVS
                     AELGSKTTVGPHCVLDEGSKLGDKCSVKRSVIGRHCRIGSNVKIVNSVVMNHVTIEDG
                     CLIQGSVICNNVQLQERVVLKDCQVGAGYVITTGSEYKNESLAKK"
     assembly_gap    172447..177481
                     /estimated_length=5035
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            complement(183322..219744)
                     /locus_tag="AXF42_Ash012303"
     mRNA            complement(join(183322..183461,184231..184390,
                     184485..184631,184811..184882,185087..185314,
                     189131..189188,202270..202515,210298..210362,
                     219535..219744))
                     /locus_tag="AXF42_Ash012303"
                     /product="hypothetical protein"
     CDS             complement(join(183322..183461,184231..184390,
                     184485..184631,184811..184882,185087..185314,
                     189131..189188,202270..202515,210298..210362,
                     219535..219744))
                     /locus_tag="AXF42_Ash012303"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKA53362.1"
                     /db_xref="InterPro:IPR024822"
                     /translation="MTISGHQMMEAGAMLRIRVVFDDPELLNNFQRSMELRRCWLLLK
                     PGIATFADLASHLRKTFGFHASLVLSIDEFVLPPFESTSIIKDKDIIRVKQKDAKVKD
                     VCKICDGQNLTQDPQTVMALGFIVNNNTTTEDKSQKKSQKKSQGNDKNVDVNLDYCFE
                     DVHVGKPSSRIWMRGQFVGLNQIHSCELRTACNELVSASKKMGRYHHKKMTCEERNNG
                     TDIHKIPGRLRIANCAWLDQKSDGHSLGKRAKPIKHFINFATLFPLTRSPVKGDILAY
                     RLVEPSSKIYLELSSPQVGKVSVFDHISSKIILVPVPEVEVFLQDKSKKTISRQAASG
                     CKDDSLLEILFSKLFDVRLLKSCDSRELACLSEGNPDPTRKDIRGAPLAKYNWNVSDA
                     YPSGKDHGSTNNCSLKKRKTTALCSSHPSPAESLFWQTFLSKRHSGKGC"
     assembly_gap    227999..233190
                     /estimated_length=5192
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     assembly_gap    236552..241051
                     /estimated_length=4500
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     assembly_gap    244367..244391
                     /estimated_length=25
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            254526..278956
                     /locus_tag="AXF42_Ash012304"
     mRNA            join(254526..255281,262416..262642,263135..263326,
                     263458..263614,278711..278956)
                     /locus_tag="AXF42_Ash012304"
                     /product="hypothetical protein"
     CDS             join(254526..255281,262416..262642,263135..263326,
                     263458..263614,278711..278956)
                     /locus_tag="AXF42_Ash012304"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKA53363.1"
                     /translation="MDLLPIGCSFPCHFGSYTLKIIERRLNSKQPKFLLSGKHNISSS
                     ISKSSYNLRESYQDSYKNENLHEKDGHRLLSFIERLHSQDVAVRTDGTCNYHVADGDT
                     GLRNIPRKLDQCENILIPSLPNTYNGDNCHPITSCFWEWKPKLSVHYEMSGTENIGAP
                     GVLFLPGFGVGAFHYEKQLKDLGRDYRVWSMDFLGQGLSLPSEDPAPLSKLNFPSQRM
                     DSKWGFGNESEPWAAELVYSVDLWREQVQHFIEQVIGEPVYIVGNSLGGFVAVYFAAF
                     SSQLVKGVTLLNATPFWGFLPNPTRSPIWSKIFPWAGTFPLPLSVRILMEFVWQKISD
                     PSNIEEILKQVYADHTTKVDKVFSHIVEITQHPAAAAAFASIMFAPRGQLSFQEALIK
                     CELQNVPICLMYGKDDPWVRPIWGLQVKRQAPETPYYEISPAGHCPHDEVPEVVNFLL
                     RGWIKSLESRGSISLPLLEESTIPEISFSRVLEYVKEEGSQKSVQVRFFGTEVSLWDQ
                     ISSFLSSDASILRPNVR"
     assembly_gap    277962..278234
                     /estimated_length=273
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            284867..318195
                     /locus_tag="AXF42_Ash012305"
     mRNA            join(284867..284935,287754..287807,288887..288948,
                     298409..298477,298574..298625,298696..298770,
                     306645..306774,306884..306954,313869..313916,
                     318124..318195)
                     /locus_tag="AXF42_Ash012305"
                     /product="GDT1-like protein 1, chloroplastic"
     CDS             join(284867..284935,287754..287807,288887..288948,
                     298409..298477,298574..298625,298696..298770,
                     306645..306774,306884..306954,313869..313916,
                     318124..318195)
                     /locus_tag="AXF42_Ash012305"
                     /note="GO_component: GO:0016020 - membrane [Evidence IEA]"
                     /codon_start=1
                     /product="GDT1-like protein 1, chloroplastic"
                     /protein_id="PKA53364.1"
                     /db_xref="InterPro:IPR001727"
                     /translation="MQLQNLEMENLFSTVGILAMLIQAFLLVFFSELGDKTFFIAALL
                     AARNSGTVVFAGTFAALSTMTVVSIVLGRTFHYIDGILPFRLGDTDFPIDDFAAACLF
                     VYYGFSTLLDASSGDESKKKEEQEKAALAISNIRGNGSGILAAANTVISTFLLVFVAE
                     WGDKSFFSTIALAAAASPLGVVAGALAGHAFATLLAVLGGSLIGSYFSEKVIAYIGGT
                     LFLVFAAVTLAEIIS"
     gene            330109..330459
                     /locus_tag="AXF42_Ash012306"
     mRNA            330109..330459
                     /locus_tag="AXF42_Ash012306"
                     /product="hypothetical protein"
     CDS             330109..330459
                     /locus_tag="AXF42_Ash012306"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKA53365.1"
                     /translation="MTDMDVTDTNSWKEKNLSNEVENPKQDDDPRRYDMDHESCKRGA
                     TGGEVDMEANITADDVARAGGFGTRDDISSFLPVAADSTDFEASLRDAKDFEEPLEEK
                     RRPGLGWTEAVEKK"
     gene            336012..337680
                     /gene="ARR9"
                     /locus_tag="AXF42_Ash012307"
     mRNA            join(336012..336114,336221..336294,336374..336451,
                     336567..336637,337476..337680)
                     /gene="ARR9"
                     /locus_tag="AXF42_Ash012307"
                     /product="Two-component response regulator ARR9"
     CDS             join(336012..336114,336221..336294,336374..336451,
                     336567..336637,337476..337680)
                     /gene="ARR9"
                     /locus_tag="AXF42_Ash012307"
                     /note="GO_function: GO:0000156 - phosphorelay response
                     regulator activity [Evidence IEA];
                     GO_process: GO:0000160 - phosphorelay signal transduction
                     system [Evidence IEA];
                     GO_process: GO:0006355 - regulation of transcription,
                     DNA-dependent [Evidence IEA]"
                     /codon_start=1
                     /product="Two-component response regulator ARR9"
                     /protein_id="PKA53366.1"
                     /db_xref="InterPro:IPR001789"
                     /translation="MAVAAEPQFHVLAVDDSLTDRKLIERLLRTNSYQVTAVESVSKA
                     LEFLGLLQEETSVPPEVDVNLIITDYCMPGMTGYDLLRKIKESSLLKDIPVVIMSSEN
                     VPSRINRCLEEGADEFFLKPVQLSDMKRLRPHILKGQTEDLITLSSNNSSSKRKGSGE
                     GIFSGTKRSRLNLAAA"
     gene            342020..349058
                     /gene="PIP5K6"
                     /locus_tag="AXF42_Ash012308"
     mRNA            join(342020..342643,343124..343236,343379..343546,
                     343642..343807,343905..344015,344439..344632,
                     344724..344847,348780..349058)
                     /gene="PIP5K6"
                     /locus_tag="AXF42_Ash012308"
                     /product="Phosphatidylinositol 4-phosphate 5-kinase 6"
     CDS             join(342020..342643,343124..343236,343379..343546,
                     343642..343807,343905..344015,344439..344632,
                     344724..344847,348780..349058)
                     /gene="PIP5K6"
                     /locus_tag="AXF42_Ash012308"
                     /EC_number="2.7.1.68"
                     /note="GO_function: GO:0016307 - phosphatidylinositol
                     phosphate kinase activity [Evidence IEA];
                     GO_process: GO:0046488 - phosphatidylinositol metabolic
                     process [Evidence IEA]"
                     /codon_start=1
                     /product="Phosphatidylinositol 4-phosphate 5-kinase 6"
                     /protein_id="PKA53367.1"
                     /db_xref="InterPro:IPR002498"
                     /db_xref="InterPro:IPR003409"
                     /db_xref="InterPro:IPR016034"
                     /db_xref="InterPro:IPR023610"
                     /translation="MSSAASEDADEQSLPPPEDPFDDDDEVYHAERLLPNGDFYTGQW
                     YGEVPHGTGKYLWTDGCMYEGEWWHSRTMGRGKFSWPSGATYEGEFKSGFMDGYGTYT
                     GVCGDTYRGAWSLNLKHGPGKKSYANGDYYDGEWRADLQEGHGRYVWKNGSEFAGQWR
                     AGKFHGRGSLVWTSGNRYDGGWEEGQPRGNGSFRWADGSLYIGIWVVGRSPGRIRWVA
                     KEMKKQGDTISKNHKNYELMLNLQLGIRHAVGKQALATSLDLKASAFDPKEKVWTRFP
                     PEGSKQTPPHQSCDFRWKDYCPLVFRTLRRLFKVDPGDYMISICGNDALRELSSPGKS
                     GSFFYLTNDDKYMIKTMKKSEVKVLLRMLPAYYNHVRAFENTLVTKFFGLHCVKLTGA
                     IQVRFVIMGNLFCTEYTIHRRFDLKGSSHGRTTDKPEEEIDETTTLKDLDLNFIFHLQ
                     RTWFQEFCKQVDRDCDFLEQERIMDYSLLVGVHFRDVSISQGDLLRVNNLIKLGANMP
                     ARVEQILRRPDGESLLIGEPTGEFYDVVLFFGIIDILQDYDISKKLEHAYKSIQYDPT
                     SISAVDPKQYSKRFRYFIFRAFTEDA"
     gene            350453..351180
                     /locus_tag="AXF42_Ash012309"
     mRNA            join(350453..350521,350614..351180)
                     /locus_tag="AXF42_Ash012309"
                     /product="Histone H1"
     CDS             join(350453..350521,350614..351180)
                     /locus_tag="AXF42_Ash012309"
                     /note="GO_component: GO:0000786 - nucleosome [Evidence
                     IEA];
                     GO_component: GO:0005634 - nucleus [Evidence IEA];
                     GO_function: GO:0003677 - DNA binding [Evidence IEA];
                     GO_process: GO:0006334 - nucleosome assembly [Evidence
                     IEA]"
                     /codon_start=1
                     /product="Histone H1"
                     /protein_id="PKA53368.1"
                     /db_xref="InterPro:IPR005818"
                     /translation="MAAVIPLRRDPLRRTPDHPPYATMIGEAIRKLRDAGGSTEPAIS
                     EYIISHFDGLPWAHDRLYPYLLRKLVAMGEFAEPTPGRFLLAADMPVSARMRMPAPAA
                     EAAASEAASSLPDRDFKNVGGPTWGRRRWRSWRRPALLQKIADVDDGGAQQELVNSPE
                     PWRTKEEEEEEKQQFEVLHQRNFCVRVVRPDSTKTVAKQSERRNGTAYMTR"
     gene            373540..374538
                     /locus_tag="AXF42_Ash012310"
     mRNA            373540..374538
                     /locus_tag="AXF42_Ash012310"
                     /product="Retrovirus-related Pol polyprotein from
                     transposon TNT 1-94"
     CDS             373540..374538
                     /locus_tag="AXF42_Ash012310"
                     /codon_start=1
                     /product="Retrovirus-related Pol polyprotein from
                     transposon TNT 1-94"
                     /protein_id="PKA53369.1"
                     /translation="MALPTHIPDDAICEGLSANRPPLFKGQHYNFWKRRMMIYLQGMD
                     IELWEVTRKPFVIPKREDKVTPKEFAELEVEEKRLAQLNAKALNHLQCGLSPSEFNRI
                     CNLNTAYEVWSKLELTYEGTNQVKESQINILFHDYELFEMHPNESIKDMFTRFTNITN
                     GLISLGKIFTNEELVRKVLRCLPRDYDAKATAIVEARDLSTLELDMLLGSLTTYELEM
                     KRKRKKNEEDEYAKKKKTLALKVSSPTSSASDTNSSEDDEEKLKDEIALISRRFDTLM
                     KKKRHLFRRSQRKSFKNRENKENTLKAKEDDVICYKCNKPGHKEKEGPCSHFERFR"
     gene            376490..377062
                     /locus_tag="AXF42_Ash012311"
     mRNA            376490..377062
                     /locus_tag="AXF42_Ash012311"
                     /product="putative mitochondrial protein"
     CDS             376490..377062
                     /locus_tag="AXF42_Ash012311"
                     /codon_start=1
                     /product="putative mitochondrial protein"
                     /protein_id="PKA53370.1"
                     /db_xref="InterPro:IPR013103"
                     /translation="MSMMGELNFFLGLQIKQLPNGIFICQSKYTIELLKRFDMDKSKH
                     IGTPMSSSTKLEKDEKGKSIDEKLYRGMIGSLLYLTTSRPDIIFSVCMCARFQSSPKE
                     SHLTAVKRIFRYLVGTHSLGLWYPKESTSNLIGYSDADFAGCKDDRKSTSSTCQFFGN
                     ALVSWSSRKQNFIALSTAEAEYVAAGSCCA"
     gene            complement(407716..429948)
                     /gene="ALG3"
                     /locus_tag="AXF42_Ash012312"
     mRNA            complement(join(407716..407860,417559..417647,
                     418747..418800,418890..418956,419078..419235,
                     423110..423178,429419..429556,429660..429694,
                     429807..429948))
                     /gene="ALG3"
                     /locus_tag="AXF42_Ash012312"
                     /product="Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol
                     alpha-1,3-mannosyltransferase"
     CDS             complement(join(407716..407860,417559..417647,
                     418747..418800,418890..418956,419078..419235,
                     423110..423178,429419..429556,429660..429694,
                     429807..429948))
                     /gene="ALG3"
                     /locus_tag="AXF42_Ash012312"
                     /EC_number="2.4.1.258"
                     /note="GO_component: GO:0005783 - endoplasmic reticulum
                     [Evidence IEA];
                     GO_component: GO:0016021 - integral to membrane [Evidence
                     IEA];
                     GO_function: GO:0016758 - transferase activity,
                     transferring hexosyl groups [Evidence IEA]"
                     /codon_start=1
                     /product="Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol
                     alpha-1,3-mannosyltransferase"
                     /protein_id="PKA53371.1"
                     /db_xref="InterPro:IPR007873"
                     /translation="MARDSSLRKKSSAKSWRGHGVTKSVAFASALLIMDAALVFLIIY
                     SVPYTKIDWDAYMSQVDGFLGGERDYMNLKGDTGPLVYPAGFLYVYSAIKFVTGGQVL
                     PAQILFGIFYIVNLGIVLLIYLNTDVLPWWAFVLLSLSKRVHSLFMLRLFNDCVAMSL
                     LHGALAFLLYQKWYSAIICFSAAVSIKMNVLLFAPPLLLLMLKALSVKGILYALLLAA
                     FLQILLGLPFLVSNPIAYLTRAFNLGRVFIHFWSVNFKFVPEGVFISKGFSLTLLFTQ
                     LTLLLMFAHYKWCKYVLNLSCF"
     assembly_gap    433394..435448
                     /estimated_length=2055
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     assembly_gap    438223..441222
                     /estimated_length=3000
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     assembly_gap    451637..458803
                     /estimated_length=7167
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            460669..463538
                     /gene="XRCC2"
                     /locus_tag="AXF42_Ash012313"
     mRNA            join(460669..460749,460879..461082,462903..463032,
                     463363..463538)
                     /gene="XRCC2"
                     /locus_tag="AXF42_Ash012313"
                     /product="DNA repair protein XRCC2 like"
     CDS             join(460669..460749,460879..461082,462903..463032,
                     463363..463538)
                     /gene="XRCC2"
                     /locus_tag="AXF42_Ash012313"
                     /codon_start=1
                     /product="DNA repair protein XRCC2 like"
                     /protein_id="PKA53372.1"
                     /translation="MLARLETERPALLIPPLHRIHIRAGNVAAIHCILPKEWNGVHFG
                     GLERLVAYFDLDCRFDVLRLSQALKHRIMRVYGNASLPAALLSFTKGSSDLLFGIGAG
                     VITSERDALRSAVPKRFCGIIVGSILLGKNRLPFACGDGVKQAIPKMDDILASMGVET
                     HQELIEKVLTKMVDSAVGLLELASYALGQWPVVLLG"
     gene            468815..482441
                     /gene="XRCC2"
                     /locus_tag="AXF42_Ash012314"
     mRNA            join(468815..469060,472702..472772,473704..473766,
                     474994..475131,478453..478602,480828..480927,
                     481503..481539,481649..481749,481827..481919,
                     482037..482075,482400..482441)
                     /gene="XRCC2"
                     /locus_tag="AXF42_Ash012314"
                     /product="DNA repair protein XRCC2 like"
     CDS             join(468815..469060,472702..472772,473704..473766,
                     474994..475131,478453..478602,480828..480927,
                     481503..481539,481649..481749,481827..481919,
                     482037..482075,482400..482441)
                     /gene="XRCC2"
                     /locus_tag="AXF42_Ash012314"
                     /codon_start=1
                     /product="DNA repair protein XRCC2 like"
                     /protein_id="PKA53373.1"
                     /translation="MTVTISEGATCSYGNKCIVVNETCYTRGAILVTIGGGRTYGIGG
                     RTMFPATVEGSERLAVSHSSPIYGTKAMVFLTNRSCYMTMHFQFLEASEQIGVSIHIL
                     MIDSIGAFYWMNRAYLSLPTDDKTRKEISLENLSKTVVEEINNIRNVQPLLVLATKVA
                     IFGVADPKIDVQSAGVIKDYHGNLLKAADTKLYTHSFSTAKAMGALVAIIAAQEWADT
                     TNRIWVVVKGHSEGSGNVEDRKITGNLLYREYMPLVWQSFVTHKVHLGISDVVASDER
                     NGASPTYICKWIQPPVNMFDRYVVTNLIVLFFPLIGWHLYGFLKSARTVFTYWIVLKD
                     FIHAANEVYDLIYLPTKASIHQPQD"
     gene            complement(484329..497384)
                     /gene="cemA"
                     /locus_tag="AXF42_Ash012315"
     mRNA            complement(join(484329..484397,485458..485593,
                     488430..488527,491151..491265,492464..492637,
                     493572..493657,496794..497384))
                     /gene="cemA"
                     /locus_tag="AXF42_Ash012315"
                     /product="Chloroplast envelope membrane protein"
     CDS             complement(join(484329..484397,485458..485593,
                     488430..488527,491151..491265,492464..492637,
                     493572..493657,496794..497384))
                     /gene="cemA"
                     /locus_tag="AXF42_Ash012315"
                     /note="GO_component: GO:0016021 - integral to membrane
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Chloroplast envelope membrane protein"
                     /protein_id="PKA53374.1"
                     /db_xref="InterPro:IPR004282"
                     /translation="MSNSMVFCGSLVCLRDVGSGAECHVWEAREIFDFSLRRGRIRVV
                     RLVTKARNGHARKRPWWERLFSDEDDENWHGLDGEDVLGDDTGDMLGDEKFEAWKRRA
                     EAITELREAQEGVRNAEGREWEDWLGDASEYAVGSSWDNDLGNGEMEVAEEVSSDPND
                     TMREKGFSRTMRNLITGKNDDELLFEDKVFQFASTSSVKFIVVLLLIPWVVSFLVHDY
                     VLMPFLDRYVKTVPLAAELLDVRRQQKLEMVKVLRVEKARYRLEIEIGKSPPLSDEEV
                     WVELRHKVIELRDEFRLENRRAFANIWSDMIYGVTLFILVYANKSKVALLKFTGYKLL
                     NNISDTGKAFLIILITDIFLGYHSESGWQSLIEIILDRYGLEVDQAAVTIFICTFPVV
                     IDACVKLWLFKFLPRLSPNVANIFQEMKRH"
     gene            505252..529191
                     /gene="DAW1"
                     /locus_tag="AXF42_Ash012316"
     mRNA            join(505252..505350,505467..505622,506191..506271,
                     506345..506434,506579..506887,507028..507125,
                     511418..511453,513365..513485,513587..513823,
                     518398..518493,518678..518743,519709..519747,
                     519840..519974,526338..526699,527728..527821,
                     528801..528992,529093..529191)
                     /gene="DAW1"
                     /locus_tag="AXF42_Ash012316"
                     /product="Dynein assembly factor with WDR repeat domains
                     1"
     CDS             join(505252..505350,505467..505622,506191..506271,
                     506345..506434,506579..506887,507028..507125,
                     511418..511453,513365..513485,513587..513823,
                     518398..518493,518678..518743,519709..519747,
                     519840..519974,526338..526699,527728..527821,
                     528801..528992,529093..529191)
                     /gene="DAW1"
                     /locus_tag="AXF42_Ash012316"
                     /note="GO_function: GO:0005515 - protein binding [Evidence
                     IEA]"
                     /codon_start=1
                     /product="Dynein assembly factor with WDR repeat domains
                     1"
                     /protein_id="PKA53375.1"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="InterPro:IPR021772"
                     /translation="MHRVGSAGNTSNSSRPRKEKRLTYVLTDADKTKHCAGVNCLAVL
                     KSSSDSYDYLFTGSRDGTLKRWAIADDEASCSATYESHVDWKYRVLQVNDAVLTGKSL
                     VSCSSDTTVKVWKSLSDSVCTRTLRQHSDYVICLATADKNSNIVASGGLGGEVFVWDI
                     EAALAPVAKSTDPMDDESSNRMINSGNYGIPMTSLRSVTSSNNVSGNNAQTHGYTPVA
                     AKGHKESVYALAMNDSGTLLVSGGTEKVIRVWDPRTGSKNMKLRGHTDNIRALLLDST
                     GRFCLSGSSDSMIRLWDLGQQRCVHSYAVHTDSVWALASTPSFSHVYSGGRDLSLYLT
                     DLSTRESILLCTNEHPVLQLALQDEGIWVATTDSSVHRWPTEGCYPQKVFQRGGSFLA
                     GNLSFSRARACLEGTTPAPVYKEPSFSIPGIPAIVQHEILNNRRQVLTKDTSGSVKLW
                     EITRGIVIEDFGKVSFEEKKKELFEMVSIPAWFTMDTRLGSLSVHLDTPQCFSAEMYA
                     VDLSILGAPEDLKINLAQETLRGLLAQWMAKRRQRSGSQASTIGDIPPGRDMPSRNFS
                     HSRIEVDETAEYHNLVLPAFQFSTISPPSIITEDSQGGSWRKKITELDGSEDEKDIPW
                     WCLDCVLNGRIPPRENTKCSFYLHPCEGSNVQVLTQGKLSAPRILRIHKVVNYVIEKM
                     VLDKPLEGGNSDGQFGLVPGVGQSQLTSLGDGSFRGGLKPWQKIKPHIEILCNNQVLS
                     HDMSLATVRTYIWKKPEDLVLNYRIVQNR"
     gene            complement(531374..537623)
                     /locus_tag="AXF42_Ash012317"
     mRNA            complement(join(531374..531597,532530..532785,
                     534236..534484,536386..536516,537386..537623))
                     /locus_tag="AXF42_Ash012317"
                     /product="GDSL esterase/lipase"
     CDS             complement(join(531374..531597,532530..532785,
                     534236..534484,536386..536516,537386..537623))
                     /locus_tag="AXF42_Ash012317"
                     /EC_number="3.2.1.51"
                     /note="GO_function: GO:0016788 - hydrolase activity,
                     acting on ester bonds [Evidence IEA];
                     GO_process: GO:0006629 - lipid metabolic process [Evidence
                     IEA]"
                     /codon_start=1
                     /product="GDSL esterase/lipase"
                     /protein_id="PKA53376.1"
                     /db_xref="InterPro:IPR001087"
                     /translation="MALALAILLVFSLLRATTADTNASSASFVFGDSLVDAGNNNYLS
                     TLSKADIPPNGIDFTASGGQPTGRYTNGRTIADIVGEELGQVNYAQPFLAPNTTGRVI
                     LNGVNYASGGGGILNSTGQIFINRIGMDIQVDYFNITRQEMERILGEPKAKAFLMKNA
                     IFSITIGSNDFLNNYLFPFLSVGERISQSPNTFVDDLINNLRGQLIRLYSLDARKFVV
                     GNVGPIGCIPYQRSINKLKESECVSLPNELARLYNARLRDLLAELNHNLPRAKFCLAD
                     VYDLVLELITNYQTYGFKTSSSPCCGNGGRFAGIIPCGPTSSMCEDRSKHVFWDPYHP
                     SEAANVIIAKYLVDGDNKYISPINLRQLKDL"
     gene            542048..569004
                     /locus_tag="AXF42_Ash012318"
     mRNA            join(542048..542119,546792..546902,551023..551079,
                     551174..551244,562780..562879,566604..566674,
                     566832..566932,567001..567104,567222..567275,
                     567391..567446,568705..568743,568851..569004)
                     /locus_tag="AXF42_Ash012318"
                     /product="hypothetical protein"
     CDS             join(542048..542119,546792..546902,551023..551079,
                     551174..551244,562780..562879,566604..566674,
                     566832..566932,567001..567104,567222..567275,
                     567391..567446,568705..568743,568851..569004)
                     /locus_tag="AXF42_Ash012318"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKA53377.1"
                     /db_xref="InterPro:IPR024462"
                     /translation="MAENELHQNGKNLYKLSAVANNLSVEMDPEKPAQLTWQRKLNDE
                     GKDIIEFTVNMTEKIFLAPMFLKLCHYYIKDIANGRAAAYNPFKKWETTSSLGVPLGG
                     IGAGSIGRSYKGYFQNWQLFPEMCEEKPILANQFSIFISRPNGERFSSVLSPRSTQVP
                     RGSMNPGIESWDWDLNGKKSTYHALYPRSWTVYDGEPDPELKITCRQISPFIPNNYQQ
                     SSYPVAVFTFTLVNSGMTPADVTLLFTWANSVGGNSEYSGNHSNSRMRVQDGVHGVLL
                     HHRTANEQPPVTFAIAAQETSDVHVSECPFFVISGDANAFTARDMWDEIKKVC"
     assembly_gap    572806..572830
                     /estimated_length=25
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            complement(575812..576243)
                     /locus_tag="AXF42_Ash012319"
     mRNA            complement(575812..576243)
                     /locus_tag="AXF42_Ash012319"
                     /product="hypothetical protein"
     CDS             complement(575812..576243)
                     /locus_tag="AXF42_Ash012319"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKA53378.1"
                     /translation="MSTRSGLHFRDDEIGNTPRDLILQLQEQVKNLTNEVAALKVSKA
                     TTSEIPRVTEEHVGASQSHPPRMVVPPPRATPESDLLEDDLFYESGDYYHPPRHQTRP
                     IGPRSWAYVLQGEGGRLQYGYDASYRARNPYQREPPRIPAP"
     assembly_gap    578191..579760
                     /estimated_length=1570
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     assembly_gap    582726..584159
                     /estimated_length=1434
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            597691..599476
                     /gene="CNR10"
                     /locus_tag="AXF42_Ash012320"
     mRNA            join(597691..597748,598162..598233,599226..599476)
                     /gene="CNR10"
                     /locus_tag="AXF42_Ash012320"
                     /product="Cell number regulator 10"
     CDS             join(597691..597748,598162..598233,599226..599476)
                     /gene="CNR10"
                     /locus_tag="AXF42_Ash012320"
                     /codon_start=1
                     /product="Cell number regulator 10"
                     /protein_id="PKA53379.1"
                     /db_xref="InterPro:IPR006461"
                     /translation="MANGRWSVGLCSCVNDLSTCCLTCFLPCVTFGRIAEAVDDGHSS
                     CGANCCIYGLLMGAQLQWLYSCTYRKKMRSKFGLESEPCADCCVHFLCEPCALCQEHA
                     ELQNRGLVPFKGKFVNFARKSKII"
     assembly_gap    602966..602975
                     /estimated_length=10
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            complement(604860..607629)
                     /gene="COAD"
                     /locus_tag="AXF42_Ash012321"
     mRNA            complement(join(604860..605027,607357..607426,
                     607529..607629))
                     /gene="COAD"
                     /locus_tag="AXF42_Ash012321"
                     /product="Phosphopantetheine adenylyltransferase"
     CDS             complement(join(604860..605027,607357..607426,
                     607529..607629))
                     /gene="COAD"
                     /locus_tag="AXF42_Ash012321"
                     /EC_number="2.7.7.3"
                     /codon_start=1
                     /product="Phosphopantetheine adenylyltransferase"
                     /protein_id="PKA53380.1"
                     /translation="MQFIKSELIVQVEPITDPFGPSIVDDKLDAIVVSKETLAGGLSV
                     NEVRAKKGLPQLKVEVVDLLAGGSSGGKLSSSALRLLESRRKLEETTDQNNCDQNSHQ
                     IGAAASRRLH"
     assembly_gap    612857..615412
                     /estimated_length=2556
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            complement(619115..619597)
                     /locus_tag="AXF42_Ash012322"
     mRNA            complement(join(619115..619244,619359..619597))
                     /locus_tag="AXF42_Ash012322"
                     /product="pantetheine-phosphate adenylyltransferase"
     CDS             complement(join(619115..619244,619359..619597))
                     /locus_tag="AXF42_Ash012322"
                     /EC_number="2.7.7.3"
                     /codon_start=1
                     /product="pantetheine-phosphate adenylyltransferase"
                     /protein_id="PKA53381.1"
                     /translation="MAGDGEGSGAENTGSESGSRRGLYGSVVLGGTFDRLHDGHKRLL
                     KVRRPSLSLSTLALFRGCFLVDPVRFLWAGISGSGPWRSDAAAGPHRTHRDENEGCRK
                     LHQGETIAAVISLYVTCVFL"
     gene            complement(622559..649172)
                     /gene="PMP22"
                     /locus_tag="AXF42_Ash012323"
     mRNA            complement(join(622559..622613,642434..642519,
                     642594..642664,647411..647486,647729..647830,
                     648918..649016,649101..649172))
                     /gene="PMP22"
                     /locus_tag="AXF42_Ash012323"
                     /product="Peroxisomal membrane protein PMP22"
     CDS             complement(join(622559..622613,642434..642519,
                     642594..642664,647411..647486,647729..647830,
                     648918..649016,649101..649172))
                     /gene="PMP22"
                     /locus_tag="AXF42_Ash012323"
                     /note="GO_component: GO:0016021 - integral to membrane
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Peroxisomal membrane protein PMP22"
                     /protein_id="PKA53382.1"
                     /db_xref="InterPro:IPR007248"
                     /translation="MSELVADSWRRYLRQLQRHPLRTKAITSGVLAGCSDVIAQKISG
                     VKKLQFKRLLLIMLYGFAYAGPFGHFLHKLMDHIFKGKKGNSTVAKKVVLEQLTSSPW
                     NNMMFMIYYGMVVEGRPWLLVKNKVKKDYPSVQLTAWRFWPIVSWINYQYMPLQFRVL
                     FHSFVASCWAIFLNLKARSAVTIKAN"
     assembly_gap    638789..639339
                     /estimated_length=551
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     assembly_gap    652719..652728
                     /estimated_length=10
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     assembly_gap    661363..661463
                     /estimated_length=101
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            661670..661855
                     /locus_tag="AXF42_Ash012324"
     mRNA            661670..661855
                     /locus_tag="AXF42_Ash012324"
                     /product="hypothetical protein"
     CDS             661670..661855
                     /locus_tag="AXF42_Ash012324"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKA53383.1"
                     /db_xref="InterPro:IPR023780"
                     /translation="MKIKPNLSYKEEPIRILARDVRRLRNKQIPMIKVLWSNQTEKEA
                     TWESENEMKKFYPDLFA"
     assembly_gap    662887..666003
                     /estimated_length=3117
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            675434..676045
                     /locus_tag="AXF42_Ash012326"
     mRNA            675434..676045
                     /locus_tag="AXF42_Ash012326"
                     /product="hypothetical protein"
     CDS             675434..676045
                     /locus_tag="AXF42_Ash012326"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKA53384.1"
                     /translation="MLTNLTDLVTSLTTQQAMILRQTQPVCAAILPPAPLPPIAADPI
                     PLPPIAAPSIQSSGSSRPPGHPIPPQEVPQNPFPPCLLPQPTFFPPSFPPFLTGRNPL
                     FAGAQALLYKPDPFFSSLDSNASFFDAIRQAPVPEDFRPPRLEAYRGVTDLRENIQGF
                     EAAIRYRQLDEATKCHLLASTLKGAAFSWFVKLPRVTSVPTST"
     gene            complement(687212..688809)
                     /gene="WNK1"
                     /locus_tag="AXF42_Ash012327"
     mRNA            complement(join(687212..687820,687901..688058,
                     688140..688372,688481..688809))
                     /gene="WNK1"
                     /locus_tag="AXF42_Ash012327"
                     /product="putative serine/threonine-protein kinase WNK1"
     CDS             complement(join(687212..687820,687901..688058,
                     688140..688372,688481..688809))
                     /gene="WNK1"
                     /locus_tag="AXF42_Ash012327"
                     /EC_number="2.7.11.1"
                     /note="GO_function: GO:0004672 - protein kinase activity
                     [Evidence IEA];
                     GO_function: GO:0004713 - protein tyrosine kinase activity
                     [Evidence IEA];
                     GO_function: GO:0005524 - ATP binding [Evidence IEA];
                     GO_process: GO:0006468 - protein phosphorylation [Evidence
                     IEA]"
                     /codon_start=1
                     /product="putative serine/threonine-protein kinase WNK1"
                     /protein_id="PKA53385.1"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR006740"
                     /db_xref="InterPro:IPR020635"
                     /translation="MSRATPPVIAFPTLHASRHAVQTRMSSRVLGFLIPSSVGVPLTK
                     HSGFHQFDVYGDLLGLLAAHPIAPLVSIHHLDVVEPIFPKSPSRPAAIRRLFDAPSAS
                     TLPGSCSRYRQKHRSVNIRAIKHWCRQILNGLLYLHSHDPPIIHKDVKCDNIFINGNQ
                     GGLAAILRKPQADHCVGKLHYLAPTDQRTPEFMAPEVYEEAYNELVDIYSFGMCVLEM
                     VTFEYPYSECTHPAQIYKRVVSGIKPEALYKIKDPEVRRFVDKCLAKASERLSASELL
                     NDPFLQIDEPKVIYWGGEIAAMGQIFRQPSYIPLHSDESLITGAFSPDDLPYDMLVEY
                     GFPCNAAELIHSPENEPCSNLDIAIKGIRREDGSIFIRLRILDREGNSTLYGVHLLYR
                     QNLIYAETLSLLSVDLFSIIIGLITHLNLLCRPCEEPSIELLFYLANRLK"
     gene            complement(695319..695761)
                     /locus_tag="AXF42_Ash012328"
     mRNA            complement(join(695319..695431,695464..695761))
                     /locus_tag="AXF42_Ash012328"
                     /product="putative mitochondrial protein"
     CDS             complement(join(695319..695431,695464..695761))
                     /locus_tag="AXF42_Ash012328"
                     /codon_start=1
                     /product="putative mitochondrial protein"
                     /protein_id="PKA53386.1"
                     /db_xref="InterPro:IPR013103"
                     /translation="MIAMQKELNQLTCNDVSELVAQPSNHPIIGTKCVFKNKFTDQGK
                     IIRNKAHLAAKSYNQVERINFNETFAPVARLEVIRHLLAYSSINDFKLFQIISNYCFI
                     NDKVYVEQPQVHKFRFSKLCISSKKGFAQFKTSP"
     gene            713131..737275
                     /gene="LUG"
                     /locus_tag="AXF42_Ash012329"
     mRNA            join(713131..713162,713285..713382,713987..714096,
                     714194..714486,714613..714688,714793..714904,
                     716437..716486,716633..716938,723053..723124,
                     726979..727206,728471..728620,732749..732751,
                     733182..733298,737132..737275)
                     /gene="LUG"
                     /locus_tag="AXF42_Ash012329"
                     /product="Transcriptional corepressor LEUNIG"
     CDS             join(713131..713162,713285..713382,713987..714096,
                     714194..714486,714613..714688,714793..714904,
                     716437..716486,716633..716938,723053..723124,
                     726979..727206,728471..728620,732749..732751,
                     733182..733298,737132..737275)
                     /gene="LUG"
                     /locus_tag="AXF42_Ash012329"
                     /note="GO_function: GO:0003697 - single-stranded DNA
                     binding [Evidence IEA];
                     GO_function: GO:0005515 - protein binding [Evidence IEA]"
                     /codon_start=1
                     /product="Transcriptional corepressor LEUNIG"
                     /protein_id="PKA53387.1"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR006594"
                     /db_xref="InterPro:IPR008116"
                     /db_xref="InterPro:IPR013720"
                     /db_xref="InterPro:IPR017986"
                     /translation="MAQSNWEADKMLDVYIYDYLLKRNLQTTAKAFMAEGKVAPDPVA
                     IDAPGGFLFEWWSVFWDIFIARTNEKHSEVAAAYIETQQLKAREQQQLQMQQLQFMQQ
                     RQAQLQRTNPNHPSLSGPMSAISSDGIMGGSAASVLAAKLYEERLKNTHSMDSENSPQ
                     LLDPNRMALLKSPTSHPGQLAQSNAGAVSAALQQIQARNQQANDIKGDGNLALAQRSL
                     PVDPSSIYGQGIIQSKSGLGAPGLNQGVSGLPLKGWPLTGIDQIRPNIGPQMQKPFLS
                     TQSQFQLLSPQQQQQYLAQAQVQGNLINSPNFGDMDPRRFRSLPRGNLSGKDGQPAVT
                     DGSVGSPMQTNSPKVRPDQAEYLMKMKVGKQQSSQQPQEQLQQQQQLQQSNRKRKQAT
                     SSGPANSNGTGNTLGPSNSQPSTPSTHTTGEGVAMAGSMQHANSLPKGLMMYGTDVTG
                     GIAASSNQMVVLWNMETLQTETTAEEHTLLITDVRFRPGSMHLATSSFDRTVRLWNAA
                     DDGATAQVRFQPRIGQLLAAAAESIVTIFDVESDRKIRTLQSLELWNMVEKQTRTVQA
                     HDGLIPALAQSPFTGMVASASHDKSVKLWK"
     gene            739098..742280
                     /locus_tag="AXF42_Ash012330"
     mRNA            join(739098..739216,742028..742280)
                     /locus_tag="AXF42_Ash012330"
                     /product="hypothetical protein"
     CDS             join(739098..739216,742028..742280)
                     /locus_tag="AXF42_Ash012330"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKA53388.1"
                     /db_xref="InterPro:IPR008504"
                     /translation="MAVQDDAKSSSERKSGDGNEDLPIFNAENLQINVKSLYYSRTFL
                     SIVGGVVAGIWGFTGLTGFVFYFLVMALTSLGLLAKANFSTGNYFDSWNRIALDGFFG
                     GLMVCFLEYLVACSRLYSVPS"
     gene            749809..750063
                     /locus_tag="AXF42_Ash012331"
     mRNA            749809..750063
                     /locus_tag="AXF42_Ash012331"
                     /product="hypothetical protein"
     CDS             749809..750063
                     /locus_tag="AXF42_Ash012331"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKA53389.1"
                     /translation="MVSIKGIKANLEKIQAILDIELPRTVQDVQKLNGGVTALSRFIF
                     RSGKRCLPFFKILRGEYPTWNDDCRQPFESLKRYLLLPPL"
     gene            complement(761487..764255)
                     /gene="PP2B10"
                     /locus_tag="AXF42_Ash012332"
     mRNA            complement(join(761487..761633,761685..761861,
                     763983..764255))
                     /gene="PP2B10"
                     /locus_tag="AXF42_Ash012332"
                     /product="F-box protein PP2-B10"
     CDS             complement(join(761487..761633,761685..761861,
                     763983..764255))
                     /gene="PP2B10"
                     /locus_tag="AXF42_Ash012332"
                     /note="GO_function: GO:0005515 - protein binding [Evidence
                     IEA]"
                     /codon_start=1
                     /product="F-box protein PP2-B10"
                     /protein_id="PKA53390.1"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="InterPro:IPR025886"
                     /translation="MAETARFDFSRLPEECLSLIISLTSPRDSCRSAAVSAAFRSSAL
                     SDAVWHRFLPPDLISILSRSRDPPSFASKKELYLRLCDRPILIDGGRRFEEIAELLDV
                     CWLDISGRICRHELSPMTEYAAYLVFKIAEGAYGLTAPAQQATVEAEGREENSELMPR
                     ERSDGWMEVELGKFFSGEEGEGGEVLMRLVEVRALNWK"
     gene            773843..785010
                     /locus_tag="AXF42_Ash012333"
     mRNA            join(773843..774318,784851..785010)
                     /locus_tag="AXF42_Ash012333"
                     /product="F-box protein"
     CDS             join(773843..774318,784851..785010)
                     /locus_tag="AXF42_Ash012333"
                     /codon_start=1
                     /product="F-box protein"
                     /protein_id="PKA53391.1"
                     /db_xref="InterPro:IPR025886"
                     /translation="MEGISRLPRDCLSLVLALTSPRDSCRSAAVSTAFLSAAASDAVW
                     ERFLPPDLVAILSRAVDPPSFTSRRELYFHLCHHPILIDGGRKVVSLFFLFFIFRTTT
                     GPHSSHRKSVSISSQSFWLERKTGAKCYEVGARDLSISWSNDPRYWGWHLVPESTSRA
                     LHSTSKLYSNTIHTNVNYTTSKLYLNTIFALCIVHDAEIVFEYDFETIYYI"
     assembly_gap    788319..788343
                     /estimated_length=25
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            797809..799698
                     /locus_tag="AXF42_Ash012334"
     mRNA            797809..799698
                     /locus_tag="AXF42_Ash012334"
                     /product="ubiquitin-conjugating enzyme E2 S"
     CDS             797809..799698
                     /locus_tag="AXF42_Ash012334"
                     /note="GO_function: GO:0008270 - zinc ion binding
                     [Evidence IEA]"
                     /codon_start=1
                     /product="ubiquitin-conjugating enzyme E2 S"
                     /protein_id="PKA53392.1"
                     /db_xref="InterPro:IPR004332"
                     /db_xref="InterPro:IPR006564"
                     /db_xref="InterPro:IPR007527"
                     /db_xref="InterPro:IPR018289"
                     /translation="MKERDGSDFFSSCLMADNSFAVQELINNNSLAVQELMSGNSLVV
                     PEHSLVSASNSLVIGQEFPDVETCRRAFKDIAIAFHFDLRIVKSDRSRFIAKCSKEGC
                     PWRVHVAKCNGGPTFSIRTLHGEHTCEGVRNLHHQQATVGWVARSVESRVRDNPRYKP
                     KEILQDIREQHGVAVSYMQAWRGKERSLAAVHGTFEDGYRLLPEYCEQIRKTNPGSIA
                     LVYATGQENCFHGLFISYRASIYGFLHACRPLLELDKASLKGKYLGTLLCASAVDADH
                     TLFPLAFAIVDAESDDNWMWFLSELRKLLGVNTDKMPTLTILSERHKGIVDAVETHFP
                     SAFHGFCLRYVSESFRDEFKNTKLVNLFWNAVYALTSAEFEAKVAEMMEIQDVMPWFH
                     LFPPNLWAVAYFEGMRYGHFTLAITEALYHWALEGHELPIVQMMEHIRSQLTVWFDER
                     RNLGLSWTSILVPSAERLTLEAIADSHCYQVLRANKVEFEIVSSERTNIIDIQRRCCS
                     CRRWQIYGIPCAHAAAALLSCGEDVRLYAQECFSVRKYLEAYSEIIYPVPDRNLWKGF
                     VEGTDGGFQKADIIIRPPKTRRPPGRPKKKVLRIESLKRPKKVVQCGRCHLLGHSQKK
                     CTFQI"
     assembly_gap    806878..809802
                     /estimated_length=2925
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            811573..823567
                     /gene="RPL28C"
                     /locus_tag="AXF42_Ash012335"
     mRNA            join(811573..811720,811801..811964,823439..823567)
                     /gene="RPL28C"
                     /locus_tag="AXF42_Ash012335"
                     /product="60S ribosomal protein L28-2"
     CDS             join(811573..811720,811801..811964,823439..823567)
                     /gene="RPL28C"
                     /locus_tag="AXF42_Ash012335"
                     /note="GO_component: GO:0005622 - intracellular [Evidence
                     IEA];
                     GO_component: GO:0005840 - ribosome [Evidence IEA];
                     GO_function: GO:0003735 - structural constituent of
                     ribosome [Evidence IEA];
                     GO_process: GO:0006412 - translation [Evidence IEA]"
                     /codon_start=1
                     /product="60S ribosomal protein L28-2"
                     /protein_id="PKA53393.1"
                     /db_xref="InterPro:IPR002672"
                     /translation="MATVPDALLWEIVKKNNSFLVKQFGNGNAMVQFSKEKNNLYNVN
                     SFKFSGLANKKTVSIQPAGKDLSVILATTKKKKQNKPASVAHKSIMKKEFWKIAKAVT
                     NQVSDNYYRRDLTGAALARLSAVRRSLQVAKSGPKKRNRQAQKK"
     assembly_gap    821800..821824
                     /estimated_length=25
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     assembly_gap    826709..827237
                     /estimated_length=529
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     assembly_gap    829639..831940
                     /estimated_length=2302
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     assembly_gap    837918..837927
                     /estimated_length=10
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            complement(844253..845611)
                     /gene="PP2B1"
                     /locus_tag="AXF42_Ash012336"
     mRNA            complement(join(844253..844454,845319..845611))
                     /gene="PP2B1"
                     /locus_tag="AXF42_Ash012336"
                     /product="F-box protein PP2-B1"
     CDS             complement(join(844253..844454,845319..845611))
                     /gene="PP2B1"
                     /locus_tag="AXF42_Ash012336"
                     /codon_start=1
                     /product="F-box protein PP2-B1"
                     /protein_id="PKA53394.1"
                     /db_xref="InterPro:IPR025886"
                     /translation="MNGSANDWERRQQKHREAAEGVHVARDLPDLSAGCVPIRRGLPS
                     VPGRLVVRRRLGARPAVRLRRDPLRGRRSLANRLQEAFTISASVTASLSTAARWFEDV
                     VELLDVCYLEIHGNIDTRILSRRTNYVVCLIFETFHGSEGVASNGSYVSKSSVYLHQV
                     IEVA"
     gene            complement(847271..871841)
                     /gene="PP2B15"
                     /locus_tag="AXF42_Ash012337"
     mRNA            complement(join(847271..847889,871315..871433,
                     871560..871841))
                     /gene="PP2B15"
                     /locus_tag="AXF42_Ash012337"
                     /product="F-box protein PP2-B15"
     CDS             complement(join(847271..847889,871315..871433,
                     871560..871841))
                     /gene="PP2B15"
                     /locus_tag="AXF42_Ash012337"
                     /codon_start=1
                     /product="F-box protein PP2-B15"
                     /protein_id="PKA53395.1"
                     /db_xref="InterPro:IPR025886"
                     /translation="MEGEGGGAGGNIQKLPVECLSHAISLTSPRDASRSEAVSVAFRV
                     AAASDVVWERFLPPDCGEILARAADPLEVVSKKHLYFLLCNSILIDGGRMSFALDRET
                     GAKCFMLSARELVIIWGDTPHYWSWIRHPDSRFDEVAELLNVCWLEIRGKFDSRILSP
                     KTNYAAYLIFKISVGSRGLGYPLQEVSLIVGSFVSKSSVRLHRDAKVFPPEGPFFHRR
                     PFFRRGPFNLLRHANLPQEPGALEEPPHDPHEPEPEPEPEPEPEPEPLVAEEALPHDQ
                     HEDSQVQVGGVARKRHDGWMEVLLGEFYNEEGDDGDVIMSLMETKGGHWKSGLIVQGI
                     EIRPK"
     assembly_gap    851154..859642
                     /estimated_length=8489
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     assembly_gap    865911..869132
                     /estimated_length=3222
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            complement(885010..948531)
                     /locus_tag="AXF42_Ash012338"
     mRNA            complement(join(885010..885435,889169..889273,
                     894528..894611,911503..911615,911717..911810,
                     913642..913707,916231..916393,916555..916661,
                     921196..921393,921518..921643,933209..933313,
                     943811..943954,947657..947709,947857..948022,
                     948379..948531))
                     /locus_tag="AXF42_Ash012338"
                     /product="putative aarF domain-containing protein kinase"
     CDS             complement(join(885010..885435,889169..889273,
                     894528..894611,911503..911615,911717..911810,
                     913642..913707,916231..916393,916555..916661,
                     921196..921393,921518..921643,933209..933313,
                     943811..943954,947657..947709,947857..948022,
                     948379..948531))
                     /locus_tag="AXF42_Ash012338"
                     /note="GO_function: GO:0004672 - protein kinase activity
                     [Evidence IEA];
                     GO_function: GO:0005524 - ATP binding [Evidence IEA];
                     GO_process: GO:0006468 - protein phosphorylation [Evidence
                     IEA]"
                     /codon_start=1
                     /product="putative aarF domain-containing protein kinase"
                     /protein_id="PKA53396.1"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002575"
                     /db_xref="InterPro:IPR004147"
                     /translation="MADLEALKIYADYVQSVFEVWTTPLPEFYDPEKVEQYFSCRPHV
                     LLLRMIEVLASFSYAVIRVQFARAFKFIWQGAYENYSLRDSQYHVGQILKEAMLHLGP
                     TFVKVGQSLSTRPDIIGSETSEALSGLHDKIPAFPRAVAMKIIEKELGGPVNYFFKYI
                     SEEPVAAASFGQVYQGCTLDGCIVAIKVQRPDLLHSVVRDIYILRLGLNILRIVAKRK
                     NDLSLYADELGKGLVGELDYRIEAANASEFLEAHSRYSFMLVPRVHRHLSTKKVLTME
                     WMVGENPNHLLLQSRGLSHGENKHTKVLQLEAKRCLLDLVNKGVEATLVQLLESGLLH
                     ADPHPGNLFYTKDGRIGFMDFGLLCRMKKEHQTAMLASIIHIVNGDWGALVYDLTLMD
                     VVRPNTNLYHVRKDLVETLGVVDYSNGIPAFKFSLVLGKIWSIALKYHFRMPPYFTLV
                     LRSLASWEGLAVAADQNFKTFEAAYPYVVMKLLHDNSATTRRILYSVVFNKRMEIQWK
                     KVQLFLKIGSVRYVDEKSQRNKQDAFEVVHLILRLLLSKDGAVLRRLLMAADTVSLTE
                     AMISKDAWLFRRYIGLALADAIYRRAILTENGSQVYEMEGKQTRNIGSTSPASTHLHS
                     IMQDRRLRVIFYRKFKEVSRHPLLMLRASWSCFTVFVMALAITLNRFVANFFDAFFNS
                     IKFVPGRIAVSFSQSNSS"
     gene            complement(953694..987989)
                     /gene="TGD3"
                     /locus_tag="AXF42_Ash012339"
     mRNA            complement(join(953694..953732,954210..954294,
                     954364..954539,960004..960111,976458..976533,
                     976624..976685,981204..981281,981384..981479,
                     986470..986598,987795..987989))
                     /gene="TGD3"
                     /locus_tag="AXF42_Ash012339"
                     /product="Protein trigalactosyldiacylglycerol 3,
                     chloroplastic"
     CDS             complement(join(953694..953732,954210..954294,
                     954364..954539,960004..960111,976458..976533,
                     976624..976685,981204..981281,981384..981479,
                     986470..986598,987795..987989))
                     /gene="TGD3"
                     /locus_tag="AXF42_Ash012339"
                     /note="GO_function: GO:0000166 - nucleotide binding
                     [Evidence IEA];
                     GO_function: GO:0005524 - ATP binding [Evidence IEA];
                     GO_function: GO:0016887 - ATPase activity [Evidence IEA];
                     GO_function: GO:0017111 - nucleoside-triphosphatase
                     activity [Evidence IEA]"
                     /codon_start=1
                     /product="Protein trigalactosyldiacylglycerol 3,
                     chloroplastic"
                     /protein_id="PKA53397.1"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /translation="MSISAARLTIAWGTPAASFHSSSRCRASVSGRRSWGSSSSWRNV
                     LCTCSAPPRNLGDGLASLESDNSRVVENLGAFSDSMNEGEVLIECRDIHKSFGEKQIL
                     RGVSFKIRHGEAVGIIGPSGTGKSTVLKILAGLLSPDRGEVLIRGRKRPGLVDDEEIS
                     GLRIGLVFQSAALFDSLTVRENVGFQLYENSNMPQDKIAELVTENLAAVGLKGIENRL
                     PSELSGGMKKRVALARSIIYDSTKEAVEPEVLLYDEPTAGLDPIASTVVEDLIRSVHQ
                     KGESSDRRLGMIASYVVVTHQHSTIKRATDRLLFLYGGRIVWEGMTHEFATSTNPIVR
                     QFASGSLDGPIKY"
     gene            990268..991680
                     /locus_tag="AXF42_Ash012340"
     mRNA            990268..991680
                     /locus_tag="AXF42_Ash012340"
                     /product="hypothetical protein"
     CDS             990268..991680
                     /locus_tag="AXF42_Ash012340"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKA53398.1"
                     /db_xref="InterPro:IPR003690"
                     /translation="MAGDGSSAVFLVVLVSLKGLFSSRLWIMAIRVSARRSLSLLVRS
                     SPHRCFSCPPTTQSKSNFARQISLAGLLRRHGLPSSHLREFLQKNDFLLHSTSLEIES
                     SIRELLSFGLSQKSFLSVVSLCPRSLELGYLTRWLEVFSDLGLSSTSSAGVIQMVLEQ
                     SARCRIEPEEFLRHCHLMRSAGLGTETMTRVFEELPTAFMNDGIDFKCRIDFLKEVVG
                     IKADEELNRICQSYPAFLAFSINTRLRPLFAELSELEFDRNEIRNFLIQNPRLLLDME
                     PGELSRCVNLLNGLKCRIAIKKRILARGRLPAAIDVKLRIDFLSSHGLTRRDAFKILH
                     VEPRSILYSTEELGKKMEFFLQKMGFCIDHLVEFPDFLGVNLEKQIVPRFQVMGALKS
                     MGGLGMEVGLKHLVRFSRREFYNFFVKPYPECEQIFGGLVRESKVDQRTVKPKYPTGL
                     WKLFKPKKFSDSEEDVKNLK"
     gene            complement(992514..1049358)
                     /gene="DDB1A"
                     /locus_tag="AXF42_Ash012341"
     mRNA            complement(join(992514..993095,995034..995318,
                     1001909..1002260,1003430..1003704,1003778..1004053,
                     1010023..1010133,1010324..1010539,1010646..1010846,
                     1011134..1011242,1011368..1011474,1011598..1011807,
                     1017736..1017811,1018061..1018110,1018223..1018285,
                     1039085..1039136,1043697..1043788,1043908..1043967,
                     1048698..1048746,1049255..1049358))
                     /gene="DDB1A"
                     /locus_tag="AXF42_Ash012341"
                     /product="DNA damage-binding protein 1a"
     CDS             complement(join(992514..993095,995034..995318,
                     1001909..1002260,1003430..1003704,1003778..1004053,
                     1010023..1010133,1010324..1010539,1010646..1010846,
                     1011134..1011242,1011368..1011474,1011598..1011807,
                     1017736..1017811,1018061..1018110,1018223..1018285,
                     1039085..1039136,1043697..1043788,1043908..1043967,
                     1048698..1048746,1049255..1049358))
                     /gene="DDB1A"
                     /locus_tag="AXF42_Ash012341"
                     /note="GO_component: GO:0005634 - nucleus [Evidence IEA];
                     GO_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA]"
                     /codon_start=1
                     /product="DNA damage-binding protein 1a"
                     /protein_id="PKA53399.1"
                     /db_xref="InterPro:IPR004871"
                     /translation="MSVWNYVVTAHKPTAVTHSCVGNFTSPQELNLIISKCTRIEIHL
                     LSPHGLQPMLDVPIYGRIATLELFRPPGEPQDLLFIATERYKFCVLQWDGETSELITR
                     AMGDVSDRIGRPTDNGQIGIIDPDCRLVGLHLYDGLFKVIPFDNKGQLKEAFNIRLEE
                     LQVLDIKFLYGCSKPTIAVLYQDNKDARHLKTYEVALKDKDFIEGPWSQNNLDNGAGL
                     LIPVPLPLGGVVIIGEETIVYCNGSSFKAIPIRPSITRAYGRVDPDGSRYLLGDNSGL
                     LYLLVISYDRERITGLKIEHLGETSVASTISYLDNAVVYIGSKYGDSQLIKLNLQSDE
                     KGSYVEVLEKYVNLGPIVDFCVVDLERQGQGQVVTCSGAYKDGSLRIVRNGIGINEQA
                     SVELQGIKGLWSLRSSTSDQYDTYLVVSFISETRILAMNMEDELEETEIEGFYAQTQT
                     LFCQNAIHDQLIQVTGSSIRLVSCASRELLDEWNAPSGFSVNVATANATQILLATGGG
                     HLVYIEIGNGKLNEVKHIQLEYEIACLDVNPIGQNANFSTMAAVGMWTDISVRIFWLP
                     SLELITKESLGGEIIPRSVLMCSFEGVSYLLCALGDGHLFNFLLNVSTGELSNRKKVS
                     LGTQPITLRTFSSKDATYVFAASDRPTVVYSSNKKLLYSNVNLKEVSHMSPFSSAAFP
                     DSLAIAKEGELSIGTFDEIQKLHIRSIPLGEHARRICHQEQSRTFAICSIKNCLINNE
                     ETEIHFVRLLDDQTFEFMSTYQLDAFEYGCSILSCSFSDDNNVYYCVGTAYVLPEENE
                     PTKGRILVFVVEDGKLQLIAEKETKGAVYSLNAFNGKLLAAINQKIQLYKWMLREDGA
                     WELQSECGHHGHILALYVQTRGDFIVVGDLMKSISLLLYKHEEGAIEERARDYNANWM
                     SAVEILDDDIYIGAENNFNLFAVRKNSDAATDEERGRLEAVGEYHLGEFVNRFRHGSL
                     VMRLPDSEAGNISTIIFGTVNGVIGVVASLPHDHYVFLEKLQSQLVKVIKGVGGLSHE
                     QWRSFNNEKKTVDARNFLDGDLIESFLDLSRPKMEEISNAIGVSVEDLCKRVEEMTRL
                     H"
     assembly_gap    1061825..1064031
                     /estimated_length=2207
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     assembly_gap    1065499..1065977
                     /estimated_length=479
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     assembly_gap    1068786..1070708
                     /estimated_length=1923
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     assembly_gap    1096627..1096826
                     /estimated_length=200
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     assembly_gap    1103584..1103608
                     /estimated_length=25
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            complement(1112737..1113894)
                     /locus_tag="AXF42_Ash012342"
     mRNA            complement(1112737..1113894)
                     /locus_tag="AXF42_Ash012342"
                     /product="hypothetical protein"
     CDS             complement(1112737..1113894)
                     /locus_tag="AXF42_Ash012342"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKA53400.1"
                     /db_xref="InterPro:IPR021099"
                     /translation="MMTILHRTSWHYRNIISSVCPFNCFVQKRWKKPVDSAQTRLENR
                     TIDLQLDKLVKQIKKLNLFLRLHELMSKRRASHTSVQLLSKWRNTIGLNVRIGSFIQR
                     HSQVFELYMHPVKRNLCCRISAKMLDLIAEEDQVIRESEMDIVQRLKKLLLMSNRNML
                     NAHALWLARREFGLPDDFRDSILQKYPNVFRLVDPDTLELITKDDILAIAEVEKWRKR
                     EYVEKWLSEFEIRYAFPIHFPTGFKIESGLREKIKNWQRLPYPKPYCSKDAISVGRSR
                     SSDRSEKHAVGILHEFLSLTVEKLIDAEKIAHFRRDLNIEVNLRELFLKHPGIFYLST
                     KGNTLTVIVREKYVKGHLNEPNRIYMARRKMLDFLLSRHPNPNRKQHMEEH"
     assembly_gap    1134936..1141864
                     /estimated_length=6929
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     assembly_gap    1144655..1149425
                     /estimated_length=4771
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     assembly_gap    1151276..1153080
                     /estimated_length=1805
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            1159046..1206518
                     /gene="DCP2"
                     /locus_tag="AXF42_Ash012343"
     mRNA            join(1159046..1159134,1176720..1176871,1184527..1184654,
                     1191846..1191944,1192450..1192602,1197461..1197564,
                     1197653..1197720,1206340..1206518)
                     /gene="DCP2"
                     /locus_tag="AXF42_Ash012343"
                     /product="mRNA-decapping enzyme subunit 2"
     CDS             join(1159046..1159134,1176720..1176871,1184527..1184654,
                     1191846..1191944,1192450..1192602,1197461..1197564,
                     1197653..1197720,1206340..1206518)
                     /gene="DCP2"
                     /locus_tag="AXF42_Ash012343"
                     /EC_number="3.-.-.-"
                     /note="GO_function: GO:0003723 - RNA binding [Evidence
                     IEA];
                     GO_function: GO:0016787 - hydrolase activity [Evidence
                     IEA];
                     GO_function: GO:0030145 - manganese ion binding [Evidence
                     IEA]"
                     /codon_start=1
                     /product="mRNA-decapping enzyme subunit 2"
                     /protein_id="PKA53401.1"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="InterPro:IPR007722"
                     /translation="MAGTSINPSSSGAPGRNHFPPQELLDDLCSRFVLNVPKEDLESF
                     ERMLFLLEQAHWFYEDNSVEQNPSLKSLSFKEFTSLMFSSCAALRPYVDHIDDIYKDF
                     TSYKFRVPVTGGIILDESYERCLLVKGWKAGASWSFPRGKKSKDEEDHTCAVREVLEE
                     TGFDVSKLLKLDDFIEVVIGQQRVRLYIITDVKEDTAFAPLTKKEISEISWHRLDELQ
                     PAGDEAISRGVNGLKLYMVAPFLNALKTWIAAHPTPVSQKADLSIKGTTVWKAKNSTS
                     AAPVTENPLQRVGSDPHNADVRPGRSFRTFRFDIPSILQAMESAFSN"
     gene            complement(1212875..1216884)
                     /gene="DRB6"
                     /locus_tag="AXF42_Ash012344"
     mRNA            complement(join(1212875..1213638,1214341..1214560,
                     1216639..1216884))
                     /gene="DRB6"
                     /locus_tag="AXF42_Ash012344"
                     /product="Double-stranded RNA-binding protein 6"
     CDS             complement(join(1212875..1213638,1214341..1214560,
                     1216639..1216884))
                     /gene="DRB6"
                     /locus_tag="AXF42_Ash012344"
                     /codon_start=1
                     /product="Double-stranded RNA-binding protein 6"
                     /protein_id="PKA53402.1"
                     /db_xref="InterPro:IPR014720"
                     /translation="MYKNQLQELAQRSCFSLPSYTCLREGPDHAPRFKATVSFNGEIF
                     ESPAFCTTLRQAEHAAAEVALNALSSRGPSHSLAARILDETGVYKNLLQEVAQRVGAP
                     LPSYTTYRSGHWHHPVFTCTVELAEISFNGEPAKSKKQAEKNAAMAAWKSLKQSACGE
                     SSSLIETENNDELEQITIARALLSYRLREKRAMTTTSFADKFLLHSDKRTSHTSYNAG
                     SKLLPVIRPRTASRIQPASPVKMDDFRFALHATPLEHQRSRGPQFPAAEAPPYMPVQH
                     FTMPYTSVAPPVTMRTAVPVFSSPPLPPPPAHQRLPYVMNPPPQIAPPVHVRRTVPVF
                     AAPPAQFPSPPPAAVSKIIEQPTLTTITGVYVKEEQTDIIAFKGNEGKVGAAVAAGIL
                     ERSATELVIENLGELKL"
     gene            1224050..1242157
                     /locus_tag="AXF42_Ash012345"
     mRNA            join(1224050..1224198,1230760..1230871,1241965..1242015,
                     1242089..1242157)
                     /locus_tag="AXF42_Ash012345"
                     /product="hypothetical protein"
     CDS             join(1224050..1224198,1230760..1230871,1241965..1242015,
                     1242089..1242157)
                     /locus_tag="AXF42_Ash012345"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKA53403.1"
                     /translation="MGRRSNAEMALRRRNLLLGFVIALFFGTAVYFRLWAIDSSFTVD
                     DREELRRQFDRANMEAMDESASWRMKYDMEFDKSRLLQDDLTKVKAALASTNERLVAL
                     LKENASLKKQLEHCNCKNLSALLR"
     gene            complement(1257788..1275925)
                     /locus_tag="AXF42_Ash012346"
     mRNA            complement(join(1257788..1257979,1258468..1258651,
                     1275714..1275925))
                     /locus_tag="AXF42_Ash012346"
                     /product="CASP-like protein 1"
     CDS             complement(join(1257788..1257979,1258468..1258651,
                     1275714..1275925))
                     /locus_tag="AXF42_Ash012346"
                     /codon_start=1
                     /product="CASP-like protein 1"
                     /protein_id="PKA53404.1"
                     /db_xref="InterPro:IPR006702"
                     /translation="MFVSRPAVHPVEAPPLTDATENPPRVRMKDVQGMPGTVGGLALR
                     FLQFMFALAALGVMASTSDFSSVSAFCLKWKILDLQLNYHVLCSYLVAATILQSLWSI
                     LLIFLDVYALLVKRSLQNPRVICLFAIGDGITSTLTFAAACASAGITVLIGNDLNICS
                     KNNCGSFETATAMAFISWFAVSPSFLLNFWSLASR"
     gene            1300031..1300948
                     /gene="GATA9"
                     /locus_tag="AXF42_Ash012347"
     mRNA            1300031..1300948
                     /gene="GATA9"
                     /locus_tag="AXF42_Ash012347"
                     /product="GATA transcription factor 9"
     CDS             1300031..1300948
                     /gene="GATA9"
                     /locus_tag="AXF42_Ash012347"
                     /note="GO_function: GO:0003700 - sequence-specific DNA
                     binding transcription factor activity [Evidence IEA];
                     GO_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     GO_function: GO:0043565 - sequence-specific DNA binding
                     [Evidence IEA];
                     GO_process: GO:0006355 - regulation of transcription,
                     DNA-dependent [Evidence IEA]"
                     /codon_start=1
                     /product="GATA transcription factor 9"
                     /protein_id="PKA53405.1"
                     /db_xref="InterPro:IPR000679"
                     /translation="MATKAYLEGSGTEKACDDLFESIDDLLDFSGDDSELPTEDACKD
                     EGTPSPIPAPVMVSAGIGGAGDHLSYPEDDDPEIANLEWLSNFFEDPEISFDFSFRSS
                     SHVSVLISGAGVAGGGSGSDAYSSSSSSSCSSYSSGSGSVLIVPARARTKRPRPLSFS
                     SRSFLPPPDSESVGESSPARKMKMKRKKKETAAVVGVEEIPTSATSASVRKCAHCEIQ
                     KTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPAIHSNSHKKVVEMRLR
                     SREAAADDGGEKAVAARSCELMEYIRRGE"
     gene            complement(1301955..1331048)
                     /gene="OST1B"
                     /locus_tag="AXF42_Ash012348"
     mRNA            complement(join(1301955..1302080,1305450..1305539,
                     1311205..1311273,1314073..1314252,1314934..1315081,
                     1320127..1320755,1321085..1321129,1330914..1331048))
                     /gene="OST1B"
                     /locus_tag="AXF42_Ash012348"
                     /product="Dolichyl-diphosphooligosaccharide--protein
                     glycosyltransferase subunit 1B"
     CDS             complement(join(1301955..1302080,1305450..1305539,
                     1311205..1311273,1314073..1314252,1314934..1315081,
                     1320127..1320755,1321085..1321129,1330914..1331048))
                     /gene="OST1B"
                     /locus_tag="AXF42_Ash012348"
                     /note="GO_component: GO:0005783 - endoplasmic reticulum
                     [Evidence IEA];
                     GO_component: GO:0016021 - integral to membrane [Evidence
                     IEA];
                     GO_function: GO:0004579 -
                     dolichyl-diphosphooligosaccharide-protein glycotransferase
                     activity [Evidence IEA];
                     GO_process: GO:0006486 - protein glycosylation [Evidence
                     IEA]"
                     /codon_start=1
                     /product="Dolichyl-diphosphooligosaccharide--protein
                     glycosyltransferase subunit 1B"
                     /protein_id="PKA53406.1"
                     /db_xref="InterPro:IPR007676"
                     /translation="MEKYSPPLAILGRTTLLFLLFFSPLSALGSFSSSSDLRILSAEK
                     RVDLTSSIVRVYLTLKVENLGTSHASEFLLAFSPTEAEHLAIIKASSVEGKRKKKAYT
                     LSVSSTDLVDTPNGARLFSVSLISPLKTGDTASIEVLYVLTNLLEPFPAEISQAESQL
                     VFYRDSAILLSPYHVVEQMMYVRTPTNKIESFTRVNPTDRAGTELKYGHFHDQPPYSF
                     SPIIIHFENNNPFAVIEELVREVEISHWGSLQMKEYYKLKHAGARHKGVFSRLEYQAR
                     PSVNGASSFKQLLAKLPPRVHSVYYRDEIGNISSSHLRTDYSQSELEIEPRYPLFGGW
                     KATFVIGYSLPLEDFVFESPAGQHYLNLSFGCPLIETQVDSLTIKVMLPEGSKSPRAA
                     VPFSADHHLEKTYSYLDVVGRTTVVIRKMNVVPEHNIPFQVYYNFSPVFMLAEPLMLI
                     TAYFMLFSACIAYLHTDLSLVKT"
     gene            complement(1332568..1353430)
                     /gene="EPSIN2"
                     /locus_tag="AXF42_Ash012349"
     mRNA            complement(join(1332568..1333016,1333104..1333797,
                     1337775..1337986,1347949..1348124,1348218..1348313,
                     1348385..1348426,1348676..1349038,1349123..1349288,
                     1349385..1349451,1349602..1349680,1349761..1349840,
                     1353118..1353169,1353396..1353430))
                     /gene="EPSIN2"
                     /locus_tag="AXF42_Ash012349"
                     /product="Clathrin interactor EPSIN 2"
     CDS             complement(join(1332568..1333016,1333104..1333797,
                     1337775..1337986,1347949..1348124,1348218..1348313,
                     1348385..1348426,1348676..1349038,1349123..1349288,
                     1349385..1349451,1349602..1349680,1349761..1349840,
                     1353118..1353169,1353396..1353430))
                     /gene="EPSIN2"
                     /locus_tag="AXF42_Ash012349"
                     /codon_start=1
                     /product="Clathrin interactor EPSIN 2"
                     /protein_id="PKA53407.1"
                     /db_xref="InterPro:IPR001026"
                     /db_xref="InterPro:IPR013809"
                     /translation="MKKAFDQTVRELKREVNKKVLKVPGIEQKILDATSNEPWGPHGS
                     LLADIAQATRNYHEYQIIMHVVWKRLNDTGKNWRHVYKALTVLEYLVGHGSERVIDEI
                     RERLYLMLQTLSDFQYIDSSGKDQGNNVRRKSQILVSLVNDKEKVQEIREKANANKDK
                     YRATFSSGGSHRSSSYSSTGGYGDRYDDDRYEGRYGSRDDDRNGYGRERDSGYRDDDQ
                     YGRGGNFYRDGDQYGRDADERYEKYKDDDSRGRSNDDYQFGPSKSFEKERDNSFEDDD
                     NVSYRNVGGRANEASPNERHLEHEHSGQSLAAPPSYEAAVKSAPNVAQDERDGGAGAA
                     VVTKPLSPTAPQASSPQSSGQGSHHSVAGAHPTLSENNTSFDEFDPRGSIPDSTTPAV
                     SNASLVARGSEVDLFGNPSSLDPVNSLALVLMTTSTTNETEVKTNSDFGTNFVALSSV
                     SAALSQPTEDPFGGVPFKAVPKEHFPSQQHGSVNVVSASSFLPSATSTGTVQHAPSAT
                     PTLENSLNFDFGDSFGGLTYIPTANTSQSAPTPTFSVTEFSTTQGTNNAHLGPTNMLT
                     ANTGYVHTSSPVFSSQANEPVAPPNVQTVNADFLPQLGSSIPQAASVPMQSFRSVAPQ
                     ISPQVASRNPTLNTGLSPPVVIQQVTTSSGPPTSKPSHDKFETRSSVWADTLNKGLVN
                     LDISGSKVNPLVDIGIDFDSINRMERRKEKEKSVSNPAMSTVSMGKAMGSGSGIGRAG
                     AGALNPSRPNVGTGMGMGMGMGMGGQGIGVGGFGGAMNQPMGLNMGMSMGVGPGGPIR
                     LPPAGTQPPPPGFPGVGYNSTAGMGNYGSQQPYGGGYR"
     gene            1356520..1357716
                     /locus_tag="AXF42_Ash012350"
     mRNA            1356520..1357716
                     /locus_tag="AXF42_Ash012350"
                     /product="hypothetical protein"
     CDS             1356520..1357716
                     /locus_tag="AXF42_Ash012350"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKA53408.1"
                     /translation="MGSVSLKIGDGTARFRRASLCSSALHLVMLASVLTTNLFALYAF
                     TFAPNSSSSSSPVLHNRNLSVISEHVSAIVREIDSSERRLQQIERELSGYDSLDPSLP
                     STPAELKLFLARHTLPLGPDSRSKITEMTSSVAHSCARSADLLAQFMSYKPHALCPTA
                     DSHLPQKLISRGCEPLPRRRCLTRPKPRQLLPLPTSLWNTPSPAGGVLIDKQMWVKPR
                     GKNDFLIADVLALGGGGIRIGFDIAGGAGDFAARMSERNVTIVTSTLNAGGAVGEFVA
                     ARGLFPLQLSPAHRFPFYDSVFDLVHTINGLDEGGAAGMGRTRPEALEFLMFDIDRIL
                     RAGGLFWLDNHLCVDDERKRTVTRVIERFGYKKLKWVVGEKADAGSSGKTQVYLSAVL
                     QKPPRG"
     gene            complement(1363862..1364161)
                     /locus_tag="AXF42_Ash012351"
     mRNA            complement(1363862..1364161)
                     /locus_tag="AXF42_Ash012351"
                     /product="hypothetical protein"
     CDS             complement(1363862..1364161)
                     /locus_tag="AXF42_Ash012351"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKA53409.1"
                     /translation="MQQNERFRYLGSIIQNDGEIDNDVISRIQAGRVKWRNASGVLCD
                     RKIPSKIKDKFYKTVVRPAMVYGAECWPAKKKHTNKINVAKNEDVKVDVWIYTKG"
     gene            complement(1372582..1377005)
                     /gene="ycf37"
                     /locus_tag="AXF42_Ash012352"
     mRNA            complement(join(1372582..1372749,1375553..1375721,
                     1376845..1377005))
                     /gene="ycf37"
                     /locus_tag="AXF42_Ash012352"
                     /product="Uncharacterized protein ycf37"
     CDS             complement(join(1372582..1372749,1375553..1375721,
                     1376845..1377005))
                     /gene="ycf37"
                     /locus_tag="AXF42_Ash012352"
                     /codon_start=1
                     /product="Uncharacterized protein ycf37"
                     /protein_id="PKA53410.1"
                     /translation="MALVLSLEATPTTSSWYWAVKNTPLPQNMGGNLQGQKDLANGMG
                     QGDFLYNTLRVREKMNSVYEVGELFELGIQLSYLLILLGLLGLGTFFVIRQVLIRREL
                     DLSAKELQEQVRSGDASATEYFELGAVMLRRKFYPAATKYLQQAIEKWDRDDQDLAQV
                     CENPD"
     assembly_gap    1392418..1393834
                     /estimated_length=1417
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            complement(1394353..1395879)
                     /locus_tag="AXF42_Ash012353"
     mRNA            complement(join(1394353..1394681,1395609..1395879))
                     /locus_tag="AXF42_Ash012353"
                     /product="Putative AC transposase"
     CDS             complement(join(1394353..1394681,1395609..1395879))
                     /locus_tag="AXF42_Ash012353"
                     /EC_number="1.1.1.1"
                     /note="GO_function: GO:0046983 - protein dimerization
                     activity [Evidence IEA]"
                     /codon_start=1
                     /product="Putative AC transposase"
                     /protein_id="PKA53411.1"
                     /db_xref="InterPro:IPR008906"
                     /translation="MPWAFRNDKARRGLVRFVVRTEQPFTICEKEGFLEYIVQYLQSQ
                     YTRISRHTLKKDCMSMYDEYRKSLIEHLSNISYRVSLTSDIWTSITEKFNDDMSLLEW
                     WKSSSKQYPILSALTRDVLAAQASTVVSESAFSTTGRIVGDYISSLSPATLCMLTYLQ
                     DWFAAESRNQQYNFVDEFKDNSSEEEQEYLRRILCNYDE"
     assembly_gap    1397071..1406645
                     /estimated_length=9575
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            complement(1411562..1441130)
                     /locus_tag="AXF42_Ash012354"
     mRNA            complement(join(1411562..1411601,1416781..1416872,
                     1419632..1419656,1421532..1421583,1423968..1424031,
                     1427523..1427595,1438190..1438257,1439738..1439764,
                     1441002..1441130))
                     /locus_tag="AXF42_Ash012354"
                     /product="hypothetical protein"
     CDS             complement(join(1411562..1411601,1416781..1416872,
                     1419632..1419656,1421532..1421583,1423968..1424031,
                     1427523..1427595,1438190..1438257,1439738..1439764,
                     1441002..1441130))
                     /locus_tag="AXF42_Ash012354"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKA53412.1"
                     /db_xref="InterPro:IPR021852"
                     /translation="MDSKRESTRVMKSRSVLCVLLILLNLSAVSSIEDKCSACNAIAD
                     EIEIELSNYPANHGQSLDSKGRSEGNLIDSRDSELRITKLLDGLCNKMQDFTLEKLAT
                     DEEIWVRVHDWNNLPAGKDKQEVRAYSKYISSFCARLLEETKDKLLELMKTGDVKLGR
                     IGKALCNDLSEHCDSNSDDDDDDYMHDEL"
     gene            complement(1446746..1471353)
                     /locus_tag="AXF42_Ash012355"
     mRNA            complement(join(1446746..1446830,1456631..1456786,
                     1456868..1456955,1463746..1463830,1468817..1469014,
                     1469045..1469205,1471188..1471353))
                     /locus_tag="AXF42_Ash012355"
                     /product="RanBP2-type zinc finger protein"
     CDS             complement(join(1446746..1446830,1456631..1456786,
                     1456868..1456955,1463746..1463830,1468817..1469014,
                     1469045..1469205,1471188..1471353))
                     /locus_tag="AXF42_Ash012355"
                     /EC_number="2.7.7.-"
                     /note="GO_function: GO:0008270 - zinc ion binding
                     [Evidence IEA]"
                     /codon_start=1
                     /product="RanBP2-type zinc finger protein"
                     /protein_id="PKA53413.1"
                     /db_xref="InterPro:IPR001876"
                     /translation="MGEGREGDWDCGSCGNRNYAFRSFCNRCKKPRLLVDSKTPADSK
                     WLPRIGDWICTGCSNNNYASRDKCKKCGQPKEEAAMLTITMPRAPLPTYSHYLARLQC
                     LVGSKMNWMEGNSAFQHTLPTMFGWPLGMFPNNGNSGTSYSDSWNPSLTVPKGWRNGD
                     WICKCGFHNYSSRSQCKKCNEPVPATSMSSSTVSSSTIPNLFPALGSKRLASEEFCYD
                     WDNKRLNAGDLNSHLKTTKPHLIYQGHERLTGPASHPTHGLYSKYSGGSLSAMSSQFP
                     VMPTLLGKGAKQWRDGDWMCNKCNNHNYASRSCCNR"
     gene            complement(1473656..1479813)
                     /locus_tag="AXF42_Ash012356"
     mRNA            complement(join(1473656..1473985,1475095..1475261,
                     1476280..1476427,1478310..1478747,1479222..1479505,
                     1479606..1479813))
                     /locus_tag="AXF42_Ash012356"
                     /product="Endoglucanase 24"
     CDS             complement(join(1473656..1473985,1475095..1475261,
                     1476280..1476427,1478310..1478747,1479222..1479505,
                     1479606..1479813))
                     /locus_tag="AXF42_Ash012356"
                     /EC_number="3.2.1.4"
                     /note="GO_function: GO:0004553 - hydrolase activity,
                     hydrolyzing O-glycosyl compounds [Evidence IEA];
                     GO_process: GO:0005975 - carbohydrate metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Endoglucanase 24"
                     /protein_id="PKA53414.1"
                     /db_xref="InterPro:IPR001701"
                     /translation="MGASKHAKGCTGWLIVLVVAAVVVAAAVIAIRKKTHHSDSSPVP
                     GPPGAITQKYSDALSVAFQFFQIQKSGKLVDNKISWRGDSALEDGSDAGLDLSKGMYD
                     AGDHIKFGFPMAFSATVLSWAILEYGDQMSAVNQLDPALDSLKWITDYLINAHPSDSV
                     LIIQVGDPDIDHKCWQRPEEMTEKRPLTQINKKNPGTEIAAETAAAMAAASLVFKNTN
                     SSYSDLLLQHAQKLFTFADNYKVSYTVSFPALQKYYNSTGFGDELLWAASWLYHATGD
                     ETYLSYVTVQNGESYADWGRPTWFSWDDKRSGTQVLLARLNIFGAKQSTNAENKGLQM
                     YQKTAEAVMCGLLPNSPTATSSRTNAGLLWVDEWNALQHPVAASFLAVLYSDYMLTSR
                     KSSFSCNGVTFSSSDLRSFAMTQADYVLGDNPMKMSYLVGYGEKYPQQVHHRGASIPA
                     NANSGCAGFQWLKSPKPNPNVAVGALVGGPFRNDSYIDGRNNSMQAEPTTYNSAALVA
                     LLSGLVTTSSTVISFT"
     gene            complement(1484894..1485409)
                     /locus_tag="AXF42_Ash012357"
     mRNA            complement(1484894..1485409)
                     /locus_tag="AXF42_Ash012357"
                     /product="hypothetical protein"
     CDS             complement(1484894..1485409)
                     /locus_tag="AXF42_Ash012357"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKA53415.1"
                     /translation="MEAKLLSSPLPPAFMSSALRRKSPPLRSTTTLPSLRRTRLAPIS
                     SANSHDSNPSENEDPPRATNIRYRPRSRRDNKKKQQQRRQEEEEEEGGLRRPKADPKK
                     KWEEMDLGEKALEAYMGEKGLLFWLNKFAYASIFAVVGGWILFRFVGPSLGLYRLDSP
                     PLPPTSVFKGD"
     gene            complement(1489194..1501352)
                     /gene="E2FB"
                     /locus_tag="AXF42_Ash012358"
     mRNA            complement(join(1489194..1489256,1494179..1494233,
                     1494306..1494394,1494497..1494582,1494679..1494735,
                     1494902..1495088,1501140..1501352))
                     /gene="E2FB"
                     /locus_tag="AXF42_Ash012358"
                     /product="Transcription factor E2FB"
     CDS             complement(join(1489194..1489256,1494179..1494233,
                     1494306..1494394,1494497..1494582,1494679..1494735,
                     1494902..1495088,1501140..1501352))
                     /gene="E2FB"
                     /locus_tag="AXF42_Ash012358"
                     /note="GO_component: GO:0005667 - transcription factor
                     complex [Evidence IEA];
                     GO_function: GO:0003700 - sequence-specific DNA binding
                     transcription factor activity [Evidence IEA];
                     GO_process: GO:0006355 - regulation of transcription,
                     DNA-dependent [Evidence IEA]"
                     /codon_start=1
                     /product="Transcription factor E2FB"
                     /protein_id="PKA53416.1"
                     /db_xref="InterPro:IPR003316"
                     /db_xref="InterPro:IPR015633"
                     /translation="MSGVEGSSLAQRHLPLRPPEILPRPPNPYFRFGPGEFPGFQCLF
                     SGVSEKGKAPVQSLAPFGRAFPLKNDFIRKDDFGASEAKSCKILVKEEQEDEKGQHIL
                     QPASQKVLKKRRKQITTRHKACEPREPESADAAASNGLLGASSCRYDSSLSLLTKKFL
                     SLLLEARDGTLDLNKAAHVLDVQKRRMYDITNVLEGIGLIEKSLKNMIRLKDTHMSKP
                     KEVDGYKARLKAEVKTLHEEEKRLDRLIRYV"
     assembly_gap    1520429..1520438
                     /estimated_length=10
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            1532828..1533799
                     /locus_tag="AXF42_Ash012359"
     mRNA            join(1532828..1532932,1533011..1533182,1533792..1533799)
                     /locus_tag="AXF42_Ash012359"
                     /product="hypothetical protein"
     CDS             join(1532828..1532932,1533011..1533182,1533792..1533799)
                     /locus_tag="AXF42_Ash012359"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKA53417.1"
                     /translation="MLQQSHEGGCAFSPAFFGCKIRLTLLTSPLPSLLQICFRIGLLQ
                     RLLVPAAHGSGGCTADFASERDHPELSGSFTGYHLLPSSPWTLAKALSCS"
     gene            1544957..1556312
                     /locus_tag="AXF42_Ash012360"
     mRNA            join(1544957..1545228,1545511..1545535,1548652..1549033,
                     1552453..1552790,1556115..1556312)
                     /locus_tag="AXF42_Ash012360"
                     /product="hypothetical protein"
     CDS             join(1544957..1545228,1545511..1545535,1548652..1549033,
                     1552453..1552790,1556115..1556312)
                     /locus_tag="AXF42_Ash012360"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKA53418.1"
                     /translation="MANLRLAMDAAFWDLNIASPRRMEGVVRSVAGEPAPPPTARASR
                     TVRPQQLSLLRHVLPLGIIPSFSPTSEKDLGSFALQYLLLASEFSNLVTVFSIAVLPN
                     HDVTLEAAWPEVFLDRDGAYWEVPSSASFDVSSLVSDSGFRYRFGLHKNDGNPEAVNS
                     SLNYVPMSLMPGLCAKAAFSFEKRRDFWREWEQNGAQEERSVRKPVWLIPYDEQLKEP
                     HAAVSAIIGGTCEAWLGGNNIDSKSKAQIGNEVGQCSSSISSRRKHISMDLFGSFGYT
                     FQQGKFTHDYNDLTRVDARLDVTSASAVLKGFGHLVPSAFKGQVHEKVNPLALLRFNV
                     LLQQQIAGPIVFRVDTKFSFSSPSGGYLPYAEDVIYGLSYSLRTLQSGKMLAWYSTKR
                     KEGMIEVRIFEF"
     gene            complement(1563301..1564267)
                     /gene="WUS"
                     /locus_tag="AXF42_Ash012361"
     mRNA            complement(join(1563301..1563687,1563781..1563854,
                     1563922..1564267))
                     /gene="WUS"
                     /locus_tag="AXF42_Ash012361"
                     /product="Protein WUSCHEL"
     CDS             complement(join(1563301..1563687,1563781..1563854,
                     1563922..1564267))
                     /gene="WUS"
                     /locus_tag="AXF42_Ash012361"
                     /note="GO_function: GO:0003700 - sequence-specific DNA
                     binding transcription factor activity [Evidence IEA];
                     GO_function: GO:0043565 - sequence-specific DNA binding
                     [Evidence IEA];
                     GO_process: GO:0006355 - regulation of transcription,
                     DNA-dependent [Evidence IEA]"
                     /codon_start=1
                     /product="Protein WUSCHEL"
                     /protein_id="PKA53419.1"
                     /db_xref="InterPro:IPR001356"
                     /translation="MEANYIQEQSNEDAHGGGGAPGGSKSSSYLCRQSSARWIPTGDQ
                     IRILRDLYYNYGVRSPTADQIQRISSKLRQYGKIEGKNVFYWFQNHKARERQKKRLTA
                     DVSTSAASSPAVNRPAGSSYEAAQFSCSTPPADLHNFRGCYFAEGGGGGGGMKNGAGW
                     YAHHDQLSSFPMLPWTYHCSIGCPEAEAAPPRSIQTLPLFPVRAADDHEQEDEERGVP
                     DQDHNCMVSGWNSPHRPRPLSGGSGGGGGGGAAFLELSLNSYFFEPPSSA"
     gene            1566004..1587938
                     /locus_tag="AXF42_Ash012362"
     mRNA            join(1566004..1566047,1569062..1569166,1572699..1572745,
                     1576457..1576633,1580961..1580998,1583169..1583210,
                     1586146..1586284,1587802..1587938)
                     /locus_tag="AXF42_Ash012362"
                     /product="hypothetical protein"
     CDS             join(1566004..1566047,1569062..1569166,1572699..1572745,
                     1576457..1576633,1580961..1580998,1583169..1583210,
                     1586146..1586284,1587802..1587938)
                     /locus_tag="AXF42_Ash012362"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKA53420.1"
                     /translation="MHANCREPATPISMQVDLSISDPPRSSLLAATGWGPRPHSLDHP
                     LILMPLLKFRTFHSIHCLLSTERGMQWGFYAGKYLLCHPSLLQAPIIITTIIIISLFQ
                     SIQYPSVALGAMNPCIYGMQQSIWLNEIRSVGSIQVGTRHYGCVRNSLKLCDASDFRQ
                     RGIAVIVSEVQMLKNWARVGKAKARELSQLKKLNLESDFEDFRSVENLEISPSSTAPR
                     ALLPSTSLVASTDDSRSSIQIRFR"
     gene            1588396..1597350
                     /gene="UEV1C"
                     /locus_tag="AXF42_Ash012363"
     mRNA            join(1588396..1588471,1591645..1591784,1591870..1591995,
                     1597210..1597350)
                     /gene="UEV1C"
                     /locus_tag="AXF42_Ash012363"
                     /product="Ubiquitin-conjugating enzyme E2 variant 1C"
     CDS             join(1588396..1588471,1591645..1591784,1591870..1591995,
                     1597210..1597350)
                     /gene="UEV1C"
                     /locus_tag="AXF42_Ash012363"
                     /note="GO_function: GO:0016881 - acid-amino acid ligase
                     activity [Evidence IEA]"
                     /codon_start=1
                     /product="Ubiquitin-conjugating enzyme E2 variant 1C"
                     /protein_id="PKA53421.1"
                     /db_xref="InterPro:IPR000608"
                     /translation="MSSSLALRLLVDWKAREKEINDGKKIPRNFRLLEELERGEKGIG
                     DGTVSYGMDDADDIYMRSWTGTIIGPLNTVHEGRIYQMKLFCDKDYPDKPPSVRFHSR
                     INMTCVNHETGVVEPKKFHMLANWQREFTMEHILTQLKKEMAAPHNRKLVQPPEGTFF
                     "
     gene            complement(1614137..1627782)
                     /locus_tag="AXF42_Ash012364"
     mRNA            complement(join(1614137..1614243,1624811..1625145,
                     1627538..1627782))
                     /locus_tag="AXF42_Ash012364"
                     /product="hypothetical protein"
     CDS             complement(join(1614137..1614243,1624811..1625145,
                     1627538..1627782))
                     /locus_tag="AXF42_Ash012364"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKA53422.1"
                     /db_xref="InterPro:IPR002902"
                     /translation="MRLQVETVPLKWERYFVRDLEIQLHRNAILKSVGQCPRNLSTFA
                     CLSCMEDAMEVILKDCHGLDACGVVSSSCSLKYSTITWYKVSNQTVDRDDAPNLVFRL
                     IQSVSRVPMHYWEYFNKAVRKEMRLLVKTVSSKWEGYFIRDLEIKLPTNAILKSVGQC
                     PRNLSISACLTCMEAAMEVILQKCHGLNACGVLRNTVSFKIYRRNEVTADNVEWSARK
                     DQQRSRILSK"
     assembly_gap    1615622..1623962
                     /estimated_length=8341
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     assembly_gap    1631641..1639397
                     /estimated_length=7757
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     assembly_gap    1642316..1646815
                     /estimated_length=4500
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            1647701..1648358
                     /locus_tag="AXF42_Ash012365"
     mRNA            join(1647701..1647745,1648167..1648358)
                     /locus_tag="AXF42_Ash012365"
                     /product="hypothetical protein"
     CDS             join(1647701..1647745,1648167..1648358)
                     /locus_tag="AXF42_Ash012365"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKA53423.1"
                     /translation="MLLAKLMNAPFVLVQTERTFVEIKIGILLRGRIMPSFNWPLWLI
                     GSIVTGLLPAFFSPCGYRPASFRPQTISTLGGRL"
     assembly_gap    1652368..1653590
                     /estimated_length=1223
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            complement(1655134..1657060)
                     /gene="GSTF1"
                     /locus_tag="AXF42_Ash012366"
     mRNA            complement(join(1655134..1655588,1656739..1656787,
                     1656914..1657060))
                     /gene="GSTF1"
                     /locus_tag="AXF42_Ash012366"
                     /product="putative glutathione S-transferase GSTF1"
     CDS             complement(join(1655134..1655588,1656739..1656787,
                     1656914..1657060))
                     /gene="GSTF1"
                     /locus_tag="AXF42_Ash012366"
                     /EC_number="2.5.1.18"
                     /note="GO_function: GO:0005515 - protein binding [Evidence
                     IEA]"
                     /codon_start=1
                     /product="putative glutathione S-transferase GSTF1"
                     /protein_id="PKA53424.1"
                     /db_xref="InterPro:IPR004045"
                     /db_xref="InterPro:IPR004046"
                     /db_xref="InterPro:IPR017933"
                     /translation="MAVRVFGLPKSTCTSRVLLVLEELGVEYELVPVNFAAGEHKQHP
                     YLERNPFGQLPAFQDGDLSLFESRVITRYLVRKYGKDSGLLKETAPEEAAAVDQWMEV
                     ETAQFNPAICAIVFQIVILPIIFGGTTDEKVVEAQLDKLGKVLDVYEARLSKSKYLAG
                     ESYTLADIHHISYIHYFLTATPHASFFDSRPHVKAWWEAISSRPAIAKITAGLSFK"
     assembly_gap    1666970..1666994
                     /estimated_length=25
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            complement(1678424..1678882)
                     /locus_tag="AXF42_Ash012367"
     mRNA            complement(1678424..1678882)
                     /locus_tag="AXF42_Ash012367"
                     /product="hypothetical protein"
     CDS             complement(1678424..1678882)
                     /locus_tag="AXF42_Ash012367"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKA53425.1"
                     /translation="MSLFSSVAGFVRDEPPEAEGPAQSGQASVRRLPAHEKAPKRPQI
                     RLSNLRGDAVDGGSSRGAVRVTPRSLQSCVHVTPLVDSTVIVKDDEVQPVEEGMEAQP
                     SVPLTTEVLDVPSSDCSTLIPVPSPLRPSVALENSLGATQKGPISGSSSA"
     gene            complement(1694826..1746033)
                     /locus_tag="AXF42_Ash012368"
     mRNA            complement(join(1694826..1694924,1695200..1695340,
                     1705093..1705183,1705347..1705403,1705529..1705587,
                     1712852..1713103,1713209..1713265,1713343..1713406,
                     1718579..1718675,1722592..1722698,1722771..1722823,
                     1722900..1722959,1723030..1723105,1728834..1728938,
                     1737006..1737111,1737221..1737420,1741036..1741141,
                     1742160..1742218,1742347..1742553,1742635..1742719,
                     1742802..1742866,1742935..1743025,1743119..1743215,
                     1745851..1746033))
                     /locus_tag="AXF42_Ash012368"
                     /product="hypothetical protein"
     CDS             complement(join(1694826..1694924,1695200..1695340,
                     1705093..1705183,1705347..1705403,1705529..1705587,
                     1712852..1713103,1713209..1713265,1713343..1713406,
                     1718579..1718675,1722592..1722698,1722771..1722823,
                     1722900..1722959,1723030..1723105,1728834..1728938,
                     1737006..1737111,1737221..1737420,1741036..1741141,
                     1742160..1742218,1742347..1742553,1742635..1742719,
                     1742802..1742866,1742935..1743025,1743119..1743215,
                     1745851..1746033))
                     /locus_tag="AXF42_Ash012368"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKA53426.1"
                     /translation="MVIVYIRRRKKVKFYGRRRRGILDGKQPHSSGLEVQNFGLCSSV
                     EDRDSGFLEGHRVAFESMSSEVKAESHARVSSDQSAIHIVVHNRRLPEDEPRVGVIPS
                     GIVRVNEEPLLSALQKLTSSLRIQRRSRSASKHASSRGRSNIEEPRDEVISCGKIVDK
                     PVLSVLQQLTSNLRIQRKPRSARKSSSLASRRWSNIKGYSSAYSKFKASQHDASAPVC
                     SDTFPITSIEPSLNIIKIGMLSKINGLHESISLARTNTLHTDDKGNVQSIPSTNLKME
                     LYGDRNRKCALGLVHELQHTIRFPKASRSARAKRQPFCVISEVNQEIPHQLNFRECDA
                     KLYCAHKKQVIDMMSSKELLFSVESRTVCKGLFNSRKDKCSQKVDGFEGKNQLKEMLH
                     SNCFSTKSDRVKLDTSCESIPSVSRNIVNVEIAKQAKKHVNHRDLDSHQKAFDFLANG
                     SILSYRSCGEEVLKGYKHGKGILCSCCNILVSPSQFQAHAGHERRRKPYHNIYTAFGN
                     SLHELALSLLHEKILHDPNKNHNITVEQCPSSSSGPFSLYPGRRFQAPSSFGSCILCR
                     DGDATLNIFGVCDSSMLFCGQCGRMFHVGCLRHHGICRIETRPCPPDSWLCGNKCKKT
                     RADLLDFVNRGPMTISKSILSSLRSRSAGRTSPDQTEATVHWQLLSGRFQGDQNESLL
                     HQATAIFKETFHAAYKGRRDVLSVMVNGEKGIAEFFGGMFCAVLTVKSVIVSAALLRV
                     FGHFVAEIPLAVTHKERQQGYFKVLFSKIEEMLSFMEVENLILPADDQTLPMWIDKFG
                     FKILEWNQVLDYRRLHRIVVFEKTTTLQKAVPLSKEMVSS"
     assembly_gap    1733476..1733485
                     /estimated_length=10
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            complement(1754439..1780304)
                     /gene="APC2"
                     /locus_tag="AXF42_Ash012369"
     mRNA            complement(join(1754439..1754570,1754669..1754737,
                     1766549..1766728,1768027..1768108,1768182..1768270,
                     1768462..1768581,1769521..1769600,1769690..1769801,
                     1769899..1770100,1770213..1770629,1774279..1774520,
                     1777867..1777938,1778058..1778335,1780211..1780304))
                     /gene="APC2"
                     /locus_tag="AXF42_Ash012369"
                     /product="Anaphase-promoting complex subunit 2"
     CDS             complement(join(1754439..1754570,1754669..1754737,
                     1766549..1766728,1768027..1768108,1768182..1768270,
                     1768462..1768581,1769521..1769600,1769690..1769801,
                     1769899..1770100,1770213..1770629,1774279..1774520,
                     1777867..1777938,1778058..1778335,1780211..1780304))
                     /gene="APC2"
                     /locus_tag="AXF42_Ash012369"
                     /note="GO_component: GO:0031461 - cullin-RING ubiquitin
                     ligase complex [Evidence IEA];
                     GO_function: GO:0031625 - ubiquitin protein ligase binding
                     [Evidence IEA];
                     GO_process: GO:0006511 - ubiquitin-dependent protein
                     catabolic process [Evidence IEA]"
                     /codon_start=1
                     /product="Anaphase-promoting complex subunit 2"
                     /protein_id="PKA53427.1"
                     /db_xref="InterPro:IPR001373"
                     /db_xref="InterPro:IPR014786"
                     /db_xref="InterPro:IPR016158"
                     /translation="MNTEQQESYLISSYQLMASSVLLTTLPSHFTKLLQLYFKHKLEE
                     LNTIVDGDSEDGCDSLHNERILKYDKLDEMNIDESNYDSVLTKNNCLVKSIGRVVLDL
                     RNIGFKAITEDAYAFSIFQHLKGKVESLAGDDYRTPVLESIKRWIQAVPLRFLHDLLS
                     YLGDLYSYGNILSSFKSPLASSPLSYPGIDAPSEGLVRWQLRLEYFAYETLQDLRISK
                     LFEIIVDYPDSSPAIQDLKQCLEHTGQHSKLVDSFISSLQHRLLTAGASTNDILHQYV
                     STIKSLRMIDQTGVFLEAVGEPIREYLRGRKDTIKCIVTMLTDGSGGNASAAGNIGDS
                     LLEELNRDTENQEAADNNEDINADDKQAWINAQRWDPDPVEADPLRGSRCRGKIDILE
                     MLVSIIGSKDQLVNEYRVMLAEKLLNKSDYDIDSEIRTLELLKIHFGESSMQRCEIML
                     NDLIGSKRINGNIKASKLQSLIGTEQGQAMTLNHLDATIISSNFWPTIQEESLHLPSS
                     VEQVLSDYAEKFHEIKTPRKLLWKKNLGIVKLELQFDDRSVEFSVTPIHATIIMQFQD
                     KTSWTSKSLAAAVGIPVDILSKRMSFWISKGVIFESGQAESSDHVFTLVDDITDSNRN
                     GIAHETDGMDEEGERTVSSVEEELQKEMTVYKKFIEGMLTNFGSMTLDRIHNTLKIFC
                     VADPTYDKSLQQLQSFLAVLIEEEKLEMRDGQYLLKKRAT"
     assembly_gap    1762173..1763122
                     /estimated_length=950
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            complement(1806929..1807759)
                     /locus_tag="AXF42_Ash012370"
     mRNA            complement(1806929..1807759)
                     /locus_tag="AXF42_Ash012370"
                     /product="hypothetical protein"
     CDS             complement(1806929..1807759)
                     /locus_tag="AXF42_Ash012370"
                     /note="GO_function: GO:0005515 - protein binding [Evidence
                     IEA]"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKA53428.1"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR018029"
                     /translation="MACRTLELTLISAEDLKDVNVLTKMDVYALATITGDRRQRQRTP
                     TDRNCGKNPCWNAVLRFIVPGDPAAAVHISIHVLLRSERVLGDLDVGEVHIPLKDLLG
                     GRSDGSSFVSYQVRKPSGRAKGVLNLSYKFVDPPAAVTAPPEFTAYPPPAGKGAYEEE
                     PVMAYPAAGSSASAYPPAGYWYGAPPPAGYGYGYGAPAAGYGYGAPGSGYGYGAPAAG
                     YGYGGAPAKNNRNNFGMGLGAGLLGGAIGGLLIGDLVSDAAGYDGGYDAGFDAGGFGF
                     "
     assembly_gap    1810693..1812661
                     /estimated_length=1969
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            1815230..1815445
                     /locus_tag="AXF42_Ash012371"
     mRNA            1815230..1815445
                     /locus_tag="AXF42_Ash012371"
                     /product="hypothetical protein"
     CDS             1815230..1815445
                     /locus_tag="AXF42_Ash012371"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKA53429.1"
                     /translation="MDLADIAIPDDSLGPEQDMEDDVTGGGGVRSDDEGKTGSFCNCC
                     RSECAEEFAGRRRWWLARVDIHFGEGV"
     gene            complement(1816387..1817887)
                     /gene="UGT87A2"
                     /locus_tag="AXF42_Ash012372"
     mRNA            complement(join(1816387..1817240,1817386..1817887))
                     /gene="UGT87A2"
                     /locus_tag="AXF42_Ash012372"
                     /product="UDP-glycosyltransferase 87A2"
     CDS             complement(join(1816387..1817240,1817386..1817887))
                     /gene="UGT87A2"
                     /locus_tag="AXF42_Ash012372"
                     /EC_number="2.4.1.-"
                     /note="GO_function: GO:0016758 - transferase activity,
                     transferring hexosyl groups [Evidence IEA];
                     GO_process: GO:0008152 - metabolic process [Evidence IEA]"
                     /codon_start=1
                     /product="UDP-glycosyltransferase 87A2"
                     /protein_id="PKA53430.1"
                     /db_xref="InterPro:IPR002213"
                     /translation="MATAVGDRRTHIVAVPFPGRGHINPMMNLCRVLATRDLAITVVV
                     TEEWLDLLSGPNLPSSSPALPSNIRLLSVPNILPSERIRGGNYREFFEAVIFKMGEPV
                     ERLVGELEQPADVVVADSLLPWAAEICRRRNIPAVSLWTESASVFLALYTFDRLDSAA
                     QLPDDLSEVESLAHLPNFSSPHIAGILPNATPVDLLRLFARKFYWFHTAHSLLMTTFS
                     ELEPAAVDRITATFAVPIFPVGPSIPHTLPSSSSGSHLLWLDSQPERSVIYVSLGSFL
                     SISVSQMEEIAGGLAGSGAAFLWIVRDELHRELIRNRVEQGSAGGRGFVSPWCEQLRV
                     LCHPAVGGFLTHCGWNSVMEGAYAGVPMLTFPLFWDQEPNSKLVVEEWGIGLRLKEAK
                     RESVEGMVRELMDLDGKESRERRSRAAEIRELSRKAVEEGGASSMRLDEFLGKIRKKQ
                     E"
     gene            complement(1834921..1866655)
                     /locus_tag="AXF42_Ash012373"
     mRNA            complement(join(1834921..1834992,1835329..1835412,
                     1835525..1835572,1843408..1843465,1849660..1849792,
                     1850489..1850561,1853326..1853490,1853596..1853661,
                     1853874..1853923,1854059..1854110,1858482..1858585,
                     1858663..1858720,1858817..1858897,1863549..1863605,
                     1866494..1866655))
                     /locus_tag="AXF42_Ash012373"
                     /product="hypothetical protein"
     CDS             complement(join(1834921..1834992,1835329..1835412,
                     1835525..1835572,1843408..1843465,1849660..1849792,
                     1850489..1850561,1853326..1853490,1853596..1853661,
                     1853874..1853923,1854059..1854110,1858482..1858585,
                     1858663..1858720,1858817..1858897,1863549..1863605,
                     1866494..1866655))
                     /locus_tag="AXF42_Ash012373"
                     /note="GO_component: GO:0005737 - cytoplasm [Evidence
                     IEA];
                     GO_function: GO:0003747 - translation release factor
                     activity [Evidence IEA];
                     GO_function: GO:0016149 - translation release factor
                     activity, codon specific [Evidence IEA];
                     GO_process: GO:0006415 - translational termination
                     [Evidence IEA]"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKA53431.1"
                     /db_xref="InterPro:IPR000352"
                     /db_xref="InterPro:IPR005139"
                     /translation="MDSLLFSYPARCPSASRRTGGTCVSLCGGAARPRRALVSFPTLG
                     AKPSAVVCMAAPYLITKLDSAEKTWKELSVKLADPDIVSNPSEYQKLAQSMAELDEVV
                     AYYRKYKECEKLLEDTKTLEKEEGSDLDMAEMIGYELEELSKELVDLEEKLKVLLLPS
                     NPLDKRNILLEVRAGTGGDEAGIWAGDLVRMYQKYSERNSWKYTIISSSEAEKGGYKT
                     YVMEVKGNRVFSKLKYESGVHRVQRVPQTETQGRVHTSTATVAIMPEADEIEVVVDPK
                     DIELTTARSGGAGGQNVNKVETAVDLSHKPTGIRIFCTEERTQLQNKNRALQLLRAKL
                     YEIKVREQQESIRNQRKSQVGTGARSEKIRTYNYKDNRVSDHRLKMNFELTSFLSGDI
                     EAAVQSCAAMEQKELLEELAESVASSNA"
     assembly_gap    1848443..1848552
                     /estimated_length=110
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     assembly_gap    1870538..1872357
                     /estimated_length=1820
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            complement(1872670..1876068)
                     /gene="CYP71A9"
                     /locus_tag="AXF42_Ash012374"
     mRNA            complement(join(1872670..1873299,1875124..1876068))
                     /gene="CYP71A9"
                     /locus_tag="AXF42_Ash012374"
                     /product="Cytochrome P450 71A9"
     CDS             complement(join(1872670..1873299,1875124..1876068))
                     /gene="CYP71A9"
                     /locus_tag="AXF42_Ash012374"
                     /note="GO_function: GO:0005506 - iron ion binding
                     [Evidence IEA];
                     GO_function: GO:0009055 - electron carrier activity
                     [Evidence IEA];
                     GO_function: GO:0016705 - oxidoreductase activity, acting
                     on paired donors, with incorporation or reduction of
                     molecular oxygen [Evidence IEA];
                     GO_function: GO:0020037 - heme binding [Evidence IEA];
                     GO_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Cytochrome P450 71A9"
                     /protein_id="PKA53432.1"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="InterPro:IPR002401"
                     /translation="MDFCSIFFLCFLFASSLLLLLRKRRRQNISQKKRLPPQPWRLPI
                     VGNLHQLDPNRPHRSLLKLSQRHGPIMLLQLGSVPTLVVSSGEVVREIFRHNDLIFSG
                     RPPMRAAVKLFYNLCDVAFSPYGEFWRQARRISVHELLSAKQVRRFEAVRQQEVAKLV
                     TAINGLCFSSSSSSSNSHLVNLSKLTLSLSNNVVCRVLLGGEYGGEGGYGGGGSGWLH
                     EVLPKTQQLLAELCVGDLIPWMGWVDRLTRLDARLKNTFEEFDRFYDMVIEEHMKKGE
                     DDEEEEEEEDMLKLLLRLRKRAEPGGFLSSMDHVKGILMDMFVAGTDTSAATITWTMA
                     ELIKNPKVMSKLLEELRRVIGNKSKMIEENELEKLEYLKLVVKESLRVHPAAPLLVPR
                     ETIEPCTIYGYHVPAKSRVIINATAMALDARVWENPHDFCPERFSDGKMDFRGRHYEY
                     IPFGAGRRICPGINFALPIVELALANLLHCFEWALPHGMTAEDMNMEEALGITMHKKV
                     PLCLAAKSKSEETIIS"
     gene            complement(1881233..1918005)
                     /gene="APC7"
                     /locus_tag="AXF42_Ash012375"
     mRNA            complement(join(1881233..1881319,1881405..1881465,
                     1882005..1882234,1888808..1888953,1889032..1889125,
                     1889214..1889258,1889341..1889541,1889623..1889673,
                     1889931..1890004,1892564..1892609,1901135..1901191,
                     1904793..1904877,1905975..1906090,1907614..1907676,
                     1907773..1907907,1912652..1912702,1916716..1916784,
                     1917937..1918005))
                     /gene="APC7"
                     /locus_tag="AXF42_Ash012375"
                     /product="Anaphase-promoting complex subunit 7"
     CDS             complement(join(1881233..1881319,1881405..1881465,
                     1882005..1882234,1888808..1888953,1889032..1889125,
                     1889214..1889258,1889341..1889541,1889623..1889673,
                     1889931..1890004,1892564..1892609,1901135..1901191,
                     1904793..1904877,1905975..1906090,1907614..1907676,
                     1907773..1907907,1912652..1912702,1916716..1916784,
                     1917937..1918005))
                     /gene="APC7"
                     /locus_tag="AXF42_Ash012375"
                     /note="GO_function: GO:0005515 - protein binding [Evidence
                     IEA]"
                     /codon_start=1
                     /product="Anaphase-promoting complex subunit 7"
                     /protein_id="PKA53433.1"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /translation="MEVTKDQMTFLLDNGLFDSAQMLGCFLVSSAVTSVEASPYLKAE
                     NLILQGDALFGARKFRRALSMYKQALQHCKIIPKQATAARTALSTLNRSSSPNNMNIS
                     VINENEVKFKIALCHCALNENRAALAEMEGIPLKARTLKMNLTLGKLYRISRNNRGAV
                     SCYKDCLRHCPHALEAITALAELGVSSKEILLLFPQAPNRGRSLLDHWDTTRWLHRYI
                     EAHCCIASNDYKGGLEHFSDILQRFPSNVHILLEVAKVEAIIGRNEEAIMNFEKVRSI
                     DPCVMTYMDEYAMLLNIKSDQSKLNKLVHDLLNVDAARPEAFVALSLLWEKKDERRAL
                     AYAEKSIRIDDRHILGHITKGRLFFSLNRPDTAVTAFRAAQELRPDLRAFQGLVRSYL
                     ALSKAKEALYAAREAMKIMPQSAKALKLVGDVHASNSSGREKARKFYESSLRLEPGYL
                     DAALALAELHVVEGRTKDAVCLLERYIKDCADDSLHTKLAQVFAATSMLSEALSHFQE
                     ALRINPQNEAAKKGLDRLEKQMKGIDPDAPEEDEENEVDDAEGDPEDTDLL"
     assembly_gap    1924779..1926707
                     /estimated_length=1929
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     assembly_gap    1928941..1930271
                     /estimated_length=1331
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            1955270..1956574
                     /locus_tag="AXF42_Ash012376"
     mRNA            1955270..1956574
                     /locus_tag="AXF42_Ash012376"
                     /product="hypothetical protein"
     CDS             1955270..1956574
                     /locus_tag="AXF42_Ash012376"
                     /note="GO_function: GO:0003676 - nucleic acid binding
                     [Evidence IEA];
                     GO_function: GO:0008270 - zinc ion binding [Evidence IEA]"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKA53434.1"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="InterPro:IPR005162"
                     /db_xref="InterPro:IPR013242"
                     /translation="MQAAQTMAQVQATMQAPVPLPSPPSVASVQVGEPHLDRLVELFQ
                     RMHPQHFEGTTDTVIAEKWVGMMEKVFEGIRCPADRKVSLAATAMDGAADDWWRDHCR
                     IFMSGRAIETITWEEFLEAFRLKYIPISAQEKMREELSRLVQRNMIVPEYEAKLAALA
                     KFVPQMIPDEAEKCYLFRKGLRDSVPVAVIPAHTKVYAELVEMATLVEQDQLATQARK
                     EAVGKRKGMASKSILGPVSKKSASSSSRVGDSGGNFGKPKCQHCGKFHWGTCRLESKL
                     EGKNCFVCGEFSHIAKACPKRATPVSGAIVPTSVASTFGGRGGGTSATFRRGRRSATV
                     IGGQGPQPRVHALTQKEAQESLDVITGTIYLCDLPMVALFDSGVSHSFISKNIVRRLS
                     LKVHPLDDVLNVALPTGAMIGVKWGVNEVIKITDHNFQSKPL"
     assembly_gap    1957470..1960538
                     /estimated_length=3069
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            1963178..1963510
                     /locus_tag="AXF42_Ash012377"
     mRNA            1963178..1963510
                     /locus_tag="AXF42_Ash012377"
                     /product="hypothetical protein"
     CDS             1963178..1963510
                     /locus_tag="AXF42_Ash012377"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKA53435.1"
                     /translation="MRFGKKGKLSPRYIGPFEILERVGNVAYQLALPPKMIDFHNVFH
                     VSMLKKYEPDPSYVLSQQDTEIRRDMSYIEKPIGILDQKDQVLRNRTIPLVKILWQHH
                     TSDDATWE"
     gene            1963855..1967509
                     /locus_tag="AXF42_Ash012378"
     mRNA            join(1963855..1963928,1967134..1967509)
                     /locus_tag="AXF42_Ash012378"
                     /product="hypothetical protein"
     CDS             join(1963855..1963928,1967134..1967509)
                     /locus_tag="AXF42_Ash012378"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKA53436.1"
                     /translation="MMKRMKSLICVLWPRKTKRRMQQIRFPDLPLELLGCKTLVKIAA
                     KAGKPLLFNQFTATRENTADLSAEGSSMEIEAYECHGHDRLHRPDAGIQSTTPLASSG
                     NSRGKLSSAMMDATVVNHGSNKDDTIRMQELEVAPHCAQRNWETIHQ"
     assembly_gap    1979589..1982321
                     /estimated_length=2733
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     assembly_gap    1983923..1987416
                     /estimated_length=3494
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            complement(1988615..1988965)
                     /locus_tag="AXF42_Ash012379"
     mRNA            complement(1988615..1988965)
                     /locus_tag="AXF42_Ash012379"
                     /product="hypothetical protein"
     CDS             complement(1988615..1988965)
                     /locus_tag="AXF42_Ash012379"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKA53437.1"
                     /translation="MEDLEETVRRAVKIVSASPVGRQVQNQAAFDVLLQALVDAGTLN
                     QENIRDPAVLPFCGSKGPGRFFEVGSCPSDETPPSRSYVGWGSWPPLRGTSGESPATP
                     LEARWLGRRNPPGS"
     gene            2002378..2015839
                     /locus_tag="AXF42_Ash012380"
     mRNA            join(2002378..2002510,2014464..2014707,2014789..2015042,
                     2015379..2015839)
                     /locus_tag="AXF42_Ash012380"
                     /product="Mevalonate kinase"
     CDS             join(2002378..2002510,2014464..2014707,2014789..2015042,
                     2015379..2015839)
                     /locus_tag="AXF42_Ash012380"
                     /EC_number="2.7.1.36"
                     /note="GO_component: GO:0005737 - cytoplasm [Evidence
                     IEA];
                     GO_function: GO:0004496 - mevalonate kinase activity
                     [Evidence IEA];
                     GO_function: GO:0005524 - ATP binding [Evidence IEA];
                     GO_function: GO:0016301 - kinase activity [Evidence IEA];
                     GO_function: GO:0016773 - phosphotransferase activity,
                     alcohol group as acceptor [Evidence IEA];
                     GO_process: GO:0008152 - metabolic process [Evidence IEA];
                     GO_process: GO:0008299 - isoprenoid biosynthetic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Mevalonate kinase"
                     /protein_id="PKA53438.1"
                     /db_xref="InterPro:IPR006204"
                     /db_xref="InterPro:IPR006205"
                     /db_xref="InterPro:IPR006206"
                     /db_xref="InterPro:IPR013750"
                     /translation="MEVRARAPGKIILAGEHAVVHGSSAIASAIDLYTHVFFRLPLPS
                     ENHGSVEFELKDTGLIFSWPCQRLEEAFSAIATTLSSTPISCSVDHMQLITSLVAEKN
                     IPEAKSWLFSGLCAFLYLYTSIHGFKPATVAVTSELPLGSGLGSSASFCVSLSAAFLA
                     LSNTPSVDNKQSGWLSLSKDNLELVNKWAFEGEKIIHGKPSGIDNTVSTFGSVIMFKS
                     GELTRIQSPTPLKMLITNTKVGRNTKALVAGVSERASRHPGAMHAVFAAVDFISKEFA
                     AIIESPAIDDISITAREEKMEELMEMNHGLLQCMGVSHASIESVLGTTLKYKLASKLT
                     GAGGGGCVLTLLPTCILACSSICSCFLSS"
     assembly_gap    2010486..2010510
                     /estimated_length=25
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     assembly_gap    2028327..2028444
                     /estimated_length=118
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            2037858..2080637
                     /locus_tag="AXF42_Ash012381"
     mRNA            join(2037858..2038038,2044423..2044602,2047065..2047249,
                     2049944..2050039,2058063..2058158,2060625..2060702,
                     2061116..2061949,2080080..2080637)
                     /locus_tag="AXF42_Ash012381"
                     /product="poly(A) RNA polymerase GLD2"
     CDS             join(2037858..2038038,2044423..2044602,2047065..2047249,
                     2049944..2050039,2058063..2058158,2060625..2060702,
                     2061116..2061949,2080080..2080637)
                     /locus_tag="AXF42_Ash012381"
                     /EC_number="2.7.7.19"
                     /codon_start=1
                     /product="poly(A) RNA polymerase GLD2"
                     /protein_id="PKA53439.1"
                     /translation="MEAGHLELKTLKEYKLYPAFVPKLESLLLDVYARLCPTASDYEK
                     RRQLVQSYNVIAKSVFGNTGGFPVMKAFGSFIMDIFTAKSDLDLSINFNDDTSSHLSR
                     QNIISTLRRFSKVLFRRQRKGDVSDVLLVLSAKVPVLKAIDCNTGIECDISVENKDGM
                     SRSLFFSVICFIDERFRIMSYLMKAWAKANNINSSKDRTMNSLSVITLVAFHLQLDLI
                     HHTCLNLVSRFSYSLALFESFLRFRLAQVVTEFKNFGARNKESIAELFVTLLAKIEDF
                     LDRSQNFARSVGKSEMLKIYDCIKESLKHLSCSMRGEDEISQLRSSLFGPISHSTLGI
                     KMNSKDGMNLKPELPGNESVSASSSAACLKRKLPCSESVQPPIATMKPKKAKNVKAAT
                     DSDRGFHEKEPNKSARPPIHTVKPKMATNFKSSNAWCPGFHEMERSTYSRNPSTVYPI
                     LSYFSSQIVNGVENSFIPARLSQPVAASYYHGSHHQLQQLSYTDQAFFPLRYQHVAPH
                     AGPYPFSSQYAPNPAHPSIFYGRQRNMLPGSSTIDVESTQRFYDTKMQPRRPHVFLLA
                     ASAVSRSLGLAIFLLILLKHVLPPPSSAAPLLTSSSHSFAAFPLRRRFLDLFHISDAP
                     AAAASSQNAADPFLDHALLCDSPETTSTILALLSAPRDFSSSPFSLPLGLPSTPSPSK
                     LSIFSDRRPSSCSPPPPQLYYTTLPPARPLPASCSHRMPQRSSVTTNSMIVAS"
     assembly_gap    2073994..2074003
                     /estimated_length=10
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            2080678..2101760
                     /gene="PDE247"
                     /locus_tag="AXF42_Ash012382"
     mRNA            join(2080678..2080776,2100864..2101760)
                     /gene="PDE247"
                     /locus_tag="AXF42_Ash012382"
                     /product="Pentatricopeptide repeat-containing protein"
     CDS             join(2080678..2080776,2100864..2101760)
                     /gene="PDE247"
                     /locus_tag="AXF42_Ash012382"
                     /EC_number="3.6.1.-"
                     /codon_start=1
                     /product="Pentatricopeptide repeat-containing protein"
                     /protein_id="PKA53440.1"
                     /db_xref="InterPro:IPR002885"
                     /translation="MPSRDLVSWTSLIDGCVKNGLPEDALEIFRRMQVERIDSDYVTV
                     IGVAAACGDLGALGHGIWLHRFALSRGLHANVRVGNSLIDMYSRCGRVDFARQVFYEM
                     PSRTLVTWNSMIVGFAANGCSEEALIHFSALQRSEIRPDGVSFTGALTACSHAGMVGE
                     GLRLYKLMQREYRIPARVEHYGCVVDLLGRAGLLEEAMRLVEEMPVKPNEVVLGSLMA
                     ACREHGDVGMAERLMGFLLEVRPETDSNYVLLSNIYAAMGRWEGVGKVRSLMKDLGVK
                     KKPGCSAVEVGCSVHEFVAGDGGHPQTEEIYSLLGLLHLDMELHGYEPVEAIGQS"
     assembly_gap    2090737..2099281
                     /estimated_length=8545
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            complement(2106976..2117732)
                     /gene="SYNC3"
                     /locus_tag="AXF42_Ash012383"
     mRNA            complement(join(2106976..2107159,2110142..2110200,
                     2110380..2110509,2110580..2110830,2111025..2111615,
                     2117235..2117732))
                     /gene="SYNC3"
                     /locus_tag="AXF42_Ash012383"
                     /product="Asparagine--tRNA ligase, cytoplasmic 3"
     CDS             complement(join(2106976..2107159,2110142..2110200,
                     2110380..2110509,2110580..2110830,2111025..2111615,
                     2117235..2117732))
                     /gene="SYNC3"
                     /locus_tag="AXF42_Ash012383"
                     /EC_number="6.1.1.22"
                     /note="GO_component: GO:0005737 - cytoplasm [Evidence
                     IEA];
                     GO_function: GO:0000166 - nucleotide binding [Evidence
                     IEA];
                     GO_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA];
                     GO_function: GO:0004812 - aminoacyl-tRNA ligase activity
                     [Evidence IEA];
                     GO_function: GO:0004816 - asparagine-tRNA ligase activity
                     [Evidence IEA];
                     GO_function: GO:0005524 - ATP binding [Evidence IEA];
                     GO_process: GO:0006418 - tRNA aminoacylation for protein
                     translation [Evidence IEA];
                     GO_process: GO:0006421 - asparaginyl-tRNA aminoacylation
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Asparagine--tRNA ligase, cytoplasmic 3"
                     /protein_id="PKA53441.1"
                     /db_xref="InterPro:IPR000738"
                     /db_xref="InterPro:IPR002312"
                     /db_xref="InterPro:IPR004364"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="InterPro:IPR004522"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR018150"
                     /translation="MADGGSVADPPTRSVAALSLADDGPSSDPALERSQGRIFIKSIL
                     QGLEDFVGRKAVVGGWVKTGREQGKGSFAFLELNDGSCLANLQVIVDAAVFPLAQLTP
                     TGTSVLVEGELKKPPEGVKQNVELRVDKVLEVGLVDPAKYPLPKTKFTLEFLRDFVHF
                     RARTNTISAVARIRDELAYATHTFFRENGFRYVHTPIITTSDCEGAGEMFQVTTLFSD
                     SEKIEKDMKQNPPPSESDIEASKLLVKEKGDSVAYLKSSNASKEEVAAAVSELVKAKE
                     TLAKLEDRFRLKGGIPHKDGKIDYARDFFGRQAFLTVSGQLQVETYACALGNVYTFGP
                     TFRAEHSHTSRHLAEFWMVEPEIAFANLEDDMNYAESYVKFLCKWLLDHCHQDLEFMV
                     KNFDKTATERLSHVSSMPFERISYTKAIQLLENVRDREFENKVEWGVDLASEHERYLT
                     EVVFKRPVIVYNYPKSIKAFYMRLNDDGKTVAAMDVLVPKVGELIGGSQREERLDVLM
                     QRITESGLPLEPYDWYLDLRRYGTVKHSGFGLGFERMILFATGLDNIRDVIPFPRYPG
                     RADL"
     gene            complement(2136357..2185294)
                     /locus_tag="AXF42_Ash012384"
     mRNA            complement(join(2136357..2139425,2140115..2140888,
                     2141318..2141437,2142350..2142572,2145134..2145327,
                     2145662..2146296,2156487..2156600,2156679..2157036,
                     2157251..2157352,2167698..2167964,2168477..2168594,
                     2171511..2171606,2176519..2176576,2179262..2179334,
                     2180170..2180215,2185146..2185294))
                     /locus_tag="AXF42_Ash012384"
                     /product="hypothetical protein"
     CDS             complement(join(2136357..2139425,2140115..2140888,
                     2141318..2141437,2142350..2142572,2145134..2145327,
                     2145662..2146296,2156487..2156600,2156679..2157036,
                     2157251..2157352,2167698..2167964,2168477..2168594,
                     2171511..2171606,2176519..2176576,2179262..2179334,
                     2180170..2180215,2185146..2185294))
                     /locus_tag="AXF42_Ash012384"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKA53442.1"
                     /db_xref="InterPro:IPR025481"
                     /db_xref="InterPro:IPR025614"
                     /translation="MFFLFLISIQDGQYLRPSDPAYEQVLDSLAMVARHTPVPLLEAL
                     LRWRESESPKGANNASTYQKKLAVECMFCSACIRFVECCPQEGITEKLWSGLENFVFD
                     WLINADRVVSQVEYPSLVDLRGLLLDLVAQLLGALSRIRFSSVTERFFMELNTRRIDT
                     SVARSETLSIINGMRYLKLGVRTEGGLNASASFVAKANPLNRTAHKRKSELHHALCNM
                     LSSILAPLSEGGKNHWPPSGVDPALNLWYEAVARIRVQLMHWMDKQSKHIAVGFPLVT
                     LLLCLGDPQMFNSSFGPHMDLLYKHLRDKNHRSMALDCLHHVVKFYLRVYASYQPKNR
                     VWDYLDSVTSQLLTVLRKGLLTQDAQHDKLVEFCVTIAQNNLDFSMNHMILELLRPDS
                     SSEAKVIGLRALLAIAMSSSSKRPGLEIFQDHNIAHYIPKVKSAIESILRACNRTYSL
                     ALLTSPKTTIDTVSKEKSQGSLFKSVLKCIPYLIEEVGRSEKITEILPQHGISIDPGV
                     REEAVQVLNRIVRHLPHRRFAVMKGMANFILKLPDEFPLLIQTQLGRLVEYMRLWRAC
                     LSDQILTDGVLNMRQPTTEGDAFHKTSFSQLGDPYEFRASEMDAIGLVFLSSVDVQIR
                     HIALELLRCIRALRNDLKEIPLLKEHSDQKLKYEPEPIFMIDVLEENGDDIVQSCYWD
                     SSRAYDLRREFDPVPSDVTLQSILESPDKNRWANCFSEIVKYAGELCPNAVFQARSEI
                     MQRLALITPMELGGKAHQPQETENKLDQWLMYAMFTCSCPPDNREDGGLAKVKELFHL
                     IFPSLRHGSEAHALVATTALGHSHLDICEVMFGELGSFAEEVSAESEGKQKWKYQKFR
                     REELRVHIANIHRTVAEKIWPGMLNRKPVFRLHFLKFVEETYRQLLLAHSDSFPDLQP
                     LRHALASVIRYLALEFVDSKSERFDVRTRKKIFDLLMTWCDESVSTWGPEGGNEYRRE
                     VERYKSGQHNRSRESIDKITFDKEVIEQVEAVQWVSMNAIASLLYGPCFDDNARKLTG
                     RVISWINNLFLDSAPRAPYGYSPVDPRTPSYSKYAGDAGRAVGMKDKQKGSHLRVPLA
                     KTALKNLIQTNLDLFPACIDQCYSPEPHLADGYFSVLAEVYMRQEIPNCEVQRVLSLI
                     LYKVVDPSRQIRDDALQMLETLSVREWAEDDTETTARYRASVVGNLPDSYQQFQYKLS
                     AKLAKDHPELSELLCEEIMQRQLDAVDIIAQHQVLTCMAPWIENLNFLKLWESGWSER
                     LLKSLYYVTWKHGDQFPDEIEKLWSTVASNTRNIIPVLDFLITKGIEDCDSNPSAEII
                     GAFATYFSVAKRVSLYLARICPQQTIDHLVCELSQRMLEDSEDPIRPGKVDPTASIVL
                     EFSQGPSMAQLATVVDSQPHMSPLLVRGSLDGPLKNTSGNLSWRTSTVTGRSISGPLS
                     PMPPDVNIVAASAGRSGQLLPSLMNMSGPLMGARGSTGNLRSRHVSRDSGDIFIDTPN
                     SGEDILHQASGGLHGINASELQSALQGHQHLLSRADIALILLAEIAYENDEDFRENLP
                     LLFHVTCVSMDSSDDIVLEHCKNLLVNLLYSLAGRHLELYGSETSEGENKHKVESLIK
                     YIQSKRGCLMWENEDPTLVRTELPSAALLSALVLDMVDAIFFQGDLRETWGAEALKWG
                     MECTSRHLACRSHQIYRALRPSVKNDNCVLLLRCLHRCLGNPVPAVLGFIMEILLTLQ
                     VMVDNMEPEKVILYPQLFWGCVAMMHTDFVHVYCQVLELFSRVIDRLSFRDRTTENVL
                     LSSLPRDEFDINSSDTTELQREESHAGPEPLPSGGRVPAFEGVQPLVLKGLMSTVSHE
                     SAIEVLSRITVPSCDSIFGNPATRLLMHITGLLPWLGLQLNKDLPLVGSTSPLQQQYQ
                     KACFVASNISFWCRTKSLDLADVFLAYARGDITSTEDLFTRASPMICAEWFPKYSSLA
                     FGHLLRLLERGPVDYQRVILLLLKALLHQTPVDAAQSPHVYAIVSQLVESTLCWEALN
                     VLEALLESCSTLTGSHADELGATENGYGLTEKTLQGLLAPQSSFKAKSGQLQYAPGSG
                     FGVGSLVQGATEVALSQREISLQNTRLILGRVLDSCSLGRKRDYKRLVPFVVNIGNT"
     assembly_gap    2152281..2152390
                     /estimated_length=110
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            complement(2190994..2191353)
                     /locus_tag="AXF42_Ash012385"
     mRNA            complement(2190994..2191353)
                     /locus_tag="AXF42_Ash012385"
                     /product="hypothetical protein"
     CDS             complement(2190994..2191353)
                     /locus_tag="AXF42_Ash012385"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKA53443.1"
                     /translation="MLLGANGPDGLNRSDLERHWSRPHSVERDQRFDAYPSPLFTGGD
                     ECRQRREANRGSTAPTFPSARPPPHRDRSGPGDSLLLIHSPSCSGKFSMRALLCASHL
                     VLVSGNAVVRAFSDLPL"
     assembly_gap    2195964..2196790
                     /estimated_length=827
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     assembly_gap    2203868..2204274
                     /estimated_length=407
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     assembly_gap    2224346..2224370
                     /estimated_length=25
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     assembly_gap    2239099..2240807
                     /estimated_length=1709
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     assembly_gap    2246231..2253435
                     /estimated_length=7205
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            2271031..2307926
                     /gene="OSCPNX1"
                     /locus_tag="AXF42_Ash012386"
     mRNA            join(2271031..2271228,2271325..2271510,2271604..2271693,
                     2272467..2272661,2272950..2273034,2289870..2290036,
                     2290887..2291072,2294605..2294718,2294799..2294921,
                     2295412..2295534,2295612..2295710,2295960..2296016,
                     2296869..2296915,2297003..2297146,2297434..2297611,
                     2302894..2302974,2307915..2307926)
                     /gene="OSCPNX1"
                     /locus_tag="AXF42_Ash012386"
                     /product="Cycloartenol Synthase"
     CDS             join(2271031..2271228,2271325..2271510,2271604..2271693,
                     2272467..2272661,2272950..2273034,2289870..2290036,
                     2290887..2291072,2294605..2294718,2294799..2294921,
                     2295412..2295534,2295612..2295710,2295960..2296016,
                     2296869..2296915,2297003..2297146,2297434..2297611,
                     2302894..2302974,2307915..2307926)
                     /gene="OSCPNX1"
                     /locus_tag="AXF42_Ash012386"
                     /EC_number="5.4.99.8"
                     /note="GO_function: GO:0003824 - catalytic activity
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Cycloartenol Synthase"
                     /protein_id="PKA53444.1"
                     /db_xref="InterPro:IPR001330"
                     /translation="MWKLKIAEGGSPLLTTINSHVGRQIWEFNPELGSAEEIAKVEKA
                     RDDFQKNRFKIKNSADLLLRLQFAKENPVELRLQQMKVGEDDQVTDEVVTTSLRRALS
                     FFCSLQAHDGHWPADFGSPMFLMPGLIITLYITGALNIVLSPEHQREIRRFLYNHQNE
                     DGGWGFHIEGHSSMFGSVLSYVTLRLLGEGEDDGGGAMTMGREWILDHGGATYTAQWG
                     KFWLSVLGVFDWAGNNPLLPELMLLPYFLPIHPGRMWILSRTVYLPMAYLYAKRFVGQ
                     ITPVILSLREELYHLPYEKIDWNKARNQCAKVDLYVPRPLVQDFMWATLKNIEPFFHY
                     WPVNKLREKALRNAMEHIHYEDESSRYICLGSVNKAINMLCCWVEDPNSEAFRMHLER
                     IYDYLWLAEDGMKMRAYNGTQLWDTVLAIQAIMSTKFSKDYGPTLRKAHNFIKQTQTL
                     EDPPGKLSYWYRHISKGSWAFSTADNGHPVSDCTAEGLKTALMLSKVSPEVVGEKLET
                     ERLHDAVNVILSFMNKNGGFGSYELQKSYSWLEMLNPSETFENIIVDHPCVECTSASI
                     QALAAFKKQYPMHRRDEVENCIRKAAAFIEKIQRPDGSWYGSWGICFTYGTWFGVAGL
                     VAAGRTFSNSSCIRKACNFLLSKQLLSGGWGESYLSYQNKTYTNLKDGKSHAVNTAWA
                     MLALLGAGQRCR"
     assembly_gap    2281743..2283042
                     /estimated_length=1300
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     assembly_gap    2305164..2305865
                     /estimated_length=702
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     assembly_gap    2311050..2311074
                     /estimated_length=25
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            complement(2348402..2354721)
                     /gene="naat-A"
                     /locus_tag="AXF42_Ash012387"
     mRNA            complement(join(2348402..2348527,2354542..2354721))
                     /gene="naat-A"
                     /locus_tag="AXF42_Ash012387"
                     /product="Nicotianamine aminotransferase A"
     CDS             complement(join(2348402..2348527,2354542..2354721))
                     /gene="naat-A"
                     /locus_tag="AXF42_Ash012387"
                     /EC_number="2.6.1.5"
                     /codon_start=1
                     /product="Nicotianamine aminotransferase A"
                     /protein_id="PKA53445.1"
                     /translation="MSARTGAPSAPAARCNPVLSQPKSSIRGVIAELTALVNPSKPLI
                     SLEVGDAVAAAVASGGGSVIGMKNWVRLFFGLPSDQLREACQRMRSFCQRRRMNCEY"
     gene            2361006..2361527
                     /locus_tag="AXF42_Ash012388"
     mRNA            2361006..2361527
                     /locus_tag="AXF42_Ash012388"
                     /product="hypothetical protein"
     CDS             2361006..2361527
                     /locus_tag="AXF42_Ash012388"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKA53446.1"
                     /translation="MDRRGDLPPGADHLSINLPLDYCLSTAFDPQRDPPRTCSSGIGG
                     APERKLTLFALRLAILEKAASGVGALGFIWATVVLLGGFAIALERTDFWLVTVILLVE
                     GARIFSRSHELEWQHQATWSIADTGALSFRAARCLRLLISSLRLLISSPRSDLSGDFS
                     VAGKIQNTLGGSH"
     gene            2362425..2378807
                     /locus_tag="AXF42_Ash012389"
     mRNA            join(2362425..2362430,2363628..2364425,2366369..2367112,
                     2369223..2369652,2378800..2378807)
                     /locus_tag="AXF42_Ash012389"
                     /product="hypothetical protein"
     CDS             join(2362425..2362430,2363628..2364425,2366369..2367112,
                     2369223..2369652,2378800..2378807)
                     /locus_tag="AXF42_Ash012389"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKA53447.1"
                     /translation="MIFRRLTRCHASSARDHSWRSLEVPLVPYAGWVFLSRNISRLLY
                     WLQLASAAACVVLSVTRLAQQDYGELKLHQAENRNRRPALNVFYGLALAEALLFLAER
                     AFWEWKLSRCRLLEQVSRECGLGPSGVVSIRRFFYDAYSRCVNGSIFDGIRMDLVSFA
                     EELLGSGSRDEQLIGASILLRFATSRRFKEATLRKVGTSAAAMERLVEMLDWKSPAEV
                     EIRRAAAVLVSKLAGKKQNVLRVAGIAGAMESISSLLYTGRAANGTRPEEVTHRYLIA
                     DRADYEYSTFNLLGLRILKKLSNDHHNCGKIGKTRGLLPKIVDFTGEIGHKLRRRKSG
                     GAGSEFEIQEAKTALQALKMLAGTTGRTGELLRREISEIVFTVSNIREILRHGEEEKA
                     LEMLAVEILTCLAMDGEVRERIGATGGVVRELLRIFFSGGGRQSLEAARVEAGEALAM
                     LAVESEGNCRRIVGDGEDVVGRLVVAVEDGVVGLNACRILRNICAYGLDSGHLRQGLR
                     GVIQAFPTVFKAVSCEEMKKLEGSIGLAAQVVRLMSHSEFAEELERAGISGTELIQRM
                     VLILQRYNNPSTMVPRIRRFVIELSIWIMQSDEKFIKLFDDFGMMRELSNVVDTTSDL
                     ECFIVFSGSVGLSRHRTSMSSLVDTALQFIKRAESTH"
     gene            2392142..2405857
                     /locus_tag="AXF42_Ash012390"
     mRNA            join(2392142..2392229,2392870..2392982,2402167..2402246,
                     2402336..2402388,2402465..2402568,2404311..2404372,
                     2405623..2405857)
                     /locus_tag="AXF42_Ash012390"
                     /product="hypothetical protein"
     CDS             join(2392142..2392229,2392870..2392982,2402167..2402246,
                     2402336..2402388,2402465..2402568,2404311..2404372,
                     2405623..2405857)
                     /locus_tag="AXF42_Ash012390"
                     /note="GO_function: GO:0005515 - protein binding [Evidence
                     IEA];
                     GO_function: GO:0008270 - zinc ion binding [Evidence IEA]"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKA53448.1"
                     /db_xref="InterPro:IPR001841"
                     /translation="MEFSGRNDSETCPICLEPLLREAYLDRCFHAFCYQCIAQWSKFV
                     KDKQSQSQSSSKCKFSIKCPLCKTENFSIVYNFDGVSFHRHYVNDNHHDSFFSSNHGL
                     RAQCYRSEAGNLFNIQQYWKYHRYRQKNNWLQNWLRREIQTLTLEEDVDIIVHHIQGV
                     LEAIFTRKGDSKQVTPEPRREEFRALLSDAAMPFLHGRTARFVDELELFLASGLNIEA
                     YDRVYMHHLGISPPTEEARDPDPASD"
     gene            2410666..2456337
                     /gene="FBL4"
                     /locus_tag="AXF42_Ash012391"
     mRNA            join(2410666..2410962,2413069..2413305,2418322..2418725,
                     2419410..2419595,2433722..2433914,2441480..2441556,
                     2443248..2443398,2456041..2456337)
                     /gene="FBL4"
                     /locus_tag="AXF42_Ash012391"
                     /product="F-box/LRR-repeat protein 4"
     CDS             join(2410666..2410962,2413069..2413305,2418322..2418725,
                     2419410..2419595,2433722..2433914,2441480..2441556,
                     2443248..2443398,2456041..2456337)
                     /gene="FBL4"
                     /locus_tag="AXF42_Ash012391"
                     /codon_start=1
                     /product="F-box/LRR-repeat protein 4"
                     /protein_id="PKA53449.1"
                     /db_xref="InterPro:IPR006553"
                     /translation="MKGADLINARVPADLLACIFLRIAGCKSDCDAFSLVCRRWLAID
                     RRFRLTIRIGSSGTADQLLALLVHRFSGLRNVFIDERLPVSSIRQMVSPSSRSRQARK
                     KRRVSPSSEGHHLTKNNEFEESESELFSLTDAGLSSLADGCKLLEKISLIWCSNVTSL
                     GLQSIAMNCKFLKSLDLQGCYIGDQGLIAIGQNCKLQDLNLRFCDGLTDKGLIGLSQH
                     CGRSLKSLGISACAWITDVSLESVAYHCLGLETLSLDSEIITNRGLISVGLGCRALKA
                     LKLQCINIADEALEAVGSLCSSLELLALCSFQRFTDRGLSAIGNGCRRLKDLTLTDCY
                     YISDIGLESVARGCTMLTRLEIDGCHHIETFGVETIGRSCPDLLELALLYCPRISNSA
                     LLEISRGCSHLQSLDLVDCTNIDDGALCSIARGCSSLKKLHIRRCYQVGDQGIISVGQ
                     NCKTLKDLSLRFCDRVGDEALVAIGGGCSLQHLNVSGCHLITDVGITAIARGCPELIS
                     LDISVLQNLGDIALAELGDGCRMLKDIVLSHSHLITDIGLARLVNGCRRLETCHMVYC
                     PSVTSSGIATIIACCPGLKKLLVEKWKVSERTKRRASSILSYLCVGL"
     assembly_gap    2425509..2426074
                     /estimated_length=566
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            2460155..2496002
                     /locus_tag="AXF42_Ash012392"
     mRNA            join(2460155..2460280,2460401..2460556,2469291..2469374,
                     2469479..2469607,2475179..2475403,2475747..2475878,
                     2475980..2476075,2476180..2476341,2476488..2476800,
                     2476887..2477012,2477098..2477167,2480650..2480707,
                     2480866..2480979,2481164..2481320,2487401..2487444,
                     2491413..2491448,2493013..2493270,2493352..2493401,
                     2495804..2496002)
                     /locus_tag="AXF42_Ash012392"
                     /product="hypothetical protein"
     CDS             join(2460155..2460280,2460401..2460556,2469291..2469374,
                     2469479..2469607,2475179..2475403,2475747..2475878,
                     2475980..2476075,2476180..2476341,2476488..2476800,
                     2476887..2477012,2477098..2477167,2480650..2480707,
                     2480866..2480979,2481164..2481320,2487401..2487444,
                     2491413..2491448,2493013..2493270,2493352..2493401,
                     2495804..2496002)
                     /locus_tag="AXF42_Ash012392"
                     /note="GO_function: GO:0003700 - sequence-specific DNA
                     binding transcription factor activity [Evidence IEA];
                     GO_function: GO:0043565 - sequence-specific DNA binding
                     [Evidence IEA];
                     GO_process: GO:0006355 - regulation of transcription,
                     DNA-dependent [Evidence IEA]"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKA53450.1"
                     /db_xref="InterPro:IPR001356"
                     /translation="MFDWISAIEELSGIPSKGITKLLKGTDNFTIQFNDSRGCLRQID
                     IEGLAASLPLHLISVLLSNGWDECLLHVLRGVRLLCTFSDLATRHSKLEQILLDDVKL
                     SEQVLDLVIFLLIILAQSDQGNHDGGSFPVLHAALVTCSFHLLAGYISLQWQDVANVL
                     LAHPKVDIFMDVAFDAVQATVRLLQVRLSILSRENLYYSFRLSSAEKSASFVCQQCEV
                     SLQSLLSFCQHKLFRDRLLKNKELCKNGGILSLTCAILKLSIPNCFKESVDIVAAISR
                     LKSRILSILLQLCEAENFSYLDEVASSQKSLHLAKSVTVEILALLKAGFKNEAVQNGD
                     SVGKRYPKGLLLLNSLRLADIFSDDSNFRSFFMANAIHVFNEILAVPHQVFLSNWCNV
                     DVPVTEEDANLDYDPFAAVSMAFIINTSSLECVSAADLSNEINFSFHSNFNGMHTVSY
                     AQQRTSYLVKILANLHCFVPSFCEEEEQNLFLKRFHGCLLMENPDTFSKHAVNVNTHK
                     AATICENLSSLSNYAASLIPQLLNDEDLQLLRVFTEQLKKLTLPNADAYAQAPFQREC
                     GKMTLEDQSYVHHSLPSWTKFSNGNFNKNYQDVRSTGGAMSSVLVKDELKAQDDILGS
                     KDNIDMKGGTPHSLSLAELDSLVGTAMLYCFISVIYDEGGGSSTLKSFLHGILVKDFV
                     NLVLTLFNIFEATDLAKENGFQEEEKAEGIHSEEKQPKKRKRNIMNERQISLIENALL
                     DEPEMQRNAALLQSWSERLCSQLMLPQGSEITASQLKNWLNNRKARLARAAREARAPS
                     EGENNYDSAGEEPHTVGNSRAIGTQPDPLSDPRPPQREGGDGQTGA"
     gene            2499448..2521060
                     /gene="BSL1"
                     /locus_tag="AXF42_Ash012393"
     mRNA            join(2499448..2499649,2499735..2499795,2499869..2499947,
                     2500041..2500120,2500209..2500303,2501099..2501198,
                     2502732..2502801,2503677..2503778,2504023..2504104,
                     2504192..2504362,2518805..2518997,2519101..2519314,
                     2519392..2519562,2519638..2519876,2520481..2520565,
                     2520689..2520787,2520857..2521060)
                     /gene="BSL1"
                     /locus_tag="AXF42_Ash012393"
                     /product="Serine/threonine-protein phosphatase BSL1 like"
     CDS             join(2499448..2499649,2499735..2499795,2499869..2499947,
                     2500041..2500120,2500209..2500303,2501099..2501198,
                     2502732..2502801,2503677..2503778,2504023..2504104,
                     2504192..2504362,2518805..2518997,2519101..2519314,
                     2519392..2519562,2519638..2519876,2520481..2520565,
                     2520689..2520787,2520857..2521060)
                     /gene="BSL1"
                     /locus_tag="AXF42_Ash012393"
                     /EC_number="3.1.3.16"
                     /note="GO_function: GO:0016787 - hydrolase activity
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Serine/threonine-protein phosphatase BSL1 like"
                     /protein_id="PKA53451.1"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /translation="MATTKPWLVPAPTYRSLEAVWETGMDSPGPRCAHTLTAVAATKS
                     HGPRLILFGGATAIEGGGPLPGIRLDGVTNSVHSYDVLTKKWTRIHPAGEAPSPRAAH
                     AAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKYKWHRVVVQGAGPGPRYGHTMDLV
                     GQRYLVTVSGNDGKRVLSDAWALDTAQKPYKWLKLNPEGDRPSARMYATASARSDGML
                     LLCGGRDLSGAPQSDAYGLLMHTNGQWEWTLAPGVSPSPRYQHSAVFVGARLHVTGGV
                     LRGGKTVEGEGAIAVLDTAAGVWLDRNGIVASSRSQKMTNDYDPSLELMRRCRHASAA
                     VGSQIYIHGGLRGDILLDDFLVADNSPYQVEITSSMYAVDGVPSVTSQKQNHITNLDS
                     PSLPHSLDAREGRSSSAGSSMNKASIDKLVEASTAEAEAVSAVWRAAQEALSFTAEKD
                     TSDEPTSQINDTHESSTDSVDSLEPDVKLHPRAVVVAKEAVGSLGGLVRQLSLDHFEN
                     ESRRMYPINNDQACPPKKFLNRQKSPQGLHKKIISLLLRPRNWRAPSSRSFFLDSYEV
                     GELCYAAEQIFMQEPTVLQLKAPVKVFGDLHGQFGDLMRLFDEYGFPSTAGDITYIDY
                     LFLGDYVDRGQHSLETICLLLALKIEYPENVHIIRGNHEAADINALFGFRLECIERMG
                     ENDGIWAWTRFNQLFNYLPLAALIEKKIICMHGGIGRSINMVEQIEKIERPITMDVGS
                     IILMDLLW"
     gene            complement(2544224..2545183)
                     /locus_tag="AXF42_Ash012394"
     mRNA            complement(2544224..2545183)
                     /locus_tag="AXF42_Ash012394"
                     /product="hypothetical protein"
     CDS             complement(2544224..2545183)
                     /locus_tag="AXF42_Ash012394"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKA53452.1"
                     /translation="MLPPQPKFKEILNSFQIVPAQLSPNVVAYMYSFLKLLQAQGISW
                     TLTLFRTLFSWMVVPRYGGCLALRSKTMKAMFSGASSSHSDWRDYFFVGGDLGIPLMP
                     STCLPEFLGDAKWMAGQDTLKSLERLKGQSWPLKDFLRYVRNDVSLHAKVLGYTIFKE
                     ITPPPSTVLMKRARRGQPPATQLSRERTEVEEEEVIEVPEPVCGGIAVDVVSSPEDVA
                     DDRKTLAELRFTVKGKGSVSAAKPHTILKGDTGIVIGEKEEGNKAGGGREKERIEGPC
                     LDLILNEVPKKKRGPSESTNPEPPSKKAKSVEEEGFVVGGDHD"
     gene            2547146..2552246
                     /locus_tag="AXF42_Ash012395"
     mRNA            join(2547146..2547655,2547745..2548010,2548199..2548271,
                     2551977..2552246)
                     /locus_tag="AXF42_Ash012395"
                     /product="hypothetical protein"
     CDS             join(2547146..2547655,2547745..2548010,2548199..2548271,
                     2551977..2552246)
                     /locus_tag="AXF42_Ash012395"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKA53453.1"
                     /translation="MLGTTLEAAGGTLSIPLIASSILPSSPSMLRALSRATWEGTSFF
                     PLVVSSILLPSSFLPFSSFSSSFQRFAGRKEGKREFLFFSEEGIDIPRGAGPQILKVV
                     FFTLSAKGTPNLGRNRSISSSLSRIFPGASFSPAAVSLTRITSFRSPAFKGGLTGESE
                     TSTTSVASTLLPLLPLGSLQQDPSFQLRRPFRRFQEPPFLNMMSVNRKIAGSLLCDAR
                     QSHPLLPLRYLSNKLLSLAETQGLEEENTDRRASPLSYPNRSYLGQTSDIRVQPNLVH
                     DDPGPSQIRAAANSFLRLFRVSHETRGCLELFLSLSALSSARDRASFASAVSAQHRQE
                     QQQRWLLQENREEDRKGRRRRRKRKERKARASFLSFDR"
     gene            2554742..2554978
                     /locus_tag="AXF42_Ash012396"
     mRNA            2554742..2554978
                     /locus_tag="AXF42_Ash012396"
                     /product="hypothetical protein"
     CDS             2554742..2554978
                     /locus_tag="AXF42_Ash012396"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKA53454.1"
                     /translation="MMEASNLKTWSSASIFFFECIFSFTALEFFGIMAPLKASKSEGG
                     SHLGLEFNHEWRVRWQPNSRVRVRIHFSLFSKRM"
     gene            complement(2556565..2573613)
                     /locus_tag="AXF42_Ash012397"
     mRNA            complement(join(2556565..2556680,2561126..2561219,
                     2561297..2561452,2563064..2563276,2565083..2565461,
                     2568956..2569030,2573246..2573613))
                     /locus_tag="AXF42_Ash012397"
                     /product="putative aminotransferase TAT2"
     CDS             complement(join(2556565..2556680,2561126..2561219,
                     2561297..2561452,2563064..2563276,2565083..2565461,
                     2568956..2569030,2573246..2573613))
                     /locus_tag="AXF42_Ash012397"
                     /EC_number="2.6.1.5"
                     /note="GO_function: GO:0030170 - pyridoxal phosphate
                     binding [Evidence IEA];
                     GO_process: GO:0009058 - biosynthetic process [Evidence
                     IEA]"
                     /codon_start=1
                     /product="putative aminotransferase TAT2"
                     /protein_id="PKA53455.1"
                     /db_xref="InterPro:IPR004839"
                     /translation="MAPATQAMPSNPQPSQLPPLLIPPSLRLVQDSVAGGDSSSAHMV
                     ARCNPVLSQPKTSIRGVVVELTALANPSKPMISLGVGDAAAHPCFASGKKGFSGAVAA
                     AVDSGRFDCYAPSFGLPGARRLEKSRDIIDCNGIFARTTFGLNKELAVAEHLTKGARC
                     SAGIVSPSGGRAHEFREEDVFITVGGTQALQAALTVLAAGGGNVLLPRPGFPVYESAC
                     ELVGLECRYYDLLAGRRWESDHAQICALADANTVAIVVINPNNPTGAAFSAHHLRQIA
                     EAARDLNIPVIADEVYEHMVFGGGKFVPFASFAHVAPIITIGSLAKRWMVPGWRLGWI
                     ALCDPNGVLKQAAVPAILSDANEGFHKNVLKILESSADTLCQGIEHIGLLKCYSRPQG
                     SMFMMVEVNTAQLFGIDNDVDFAKELMKEESVLVLPGSVIGLKNWVRLFFGLPSDQLR
                     EACQRMRSFCKRRRVS"
     gene            complement(2574950..2577701)
                     /gene="HIPP26"
                     /locus_tag="AXF42_Ash012398"
     mRNA            complement(join(2574950..2575611,2577516..2577591,
                     2577663..2577701))
                     /gene="HIPP26"
                     /locus_tag="AXF42_Ash012398"
                     /product="Heavy metal-associated isoprenylated plant
                     protein 26"
     CDS             complement(join(2574950..2575611,2577516..2577591,
                     2577663..2577701))
                     /gene="HIPP26"
                     /locus_tag="AXF42_Ash012398"
                     /note="GO_function: GO:0046872 - metal ion binding
                     [Evidence IEA];
                     GO_process: GO:0030001 - metal ion transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="Heavy metal-associated isoprenylated plant
                     protein 26"
                     /protein_id="PKA53456.1"
                     /db_xref="InterPro:IPR006121"
                     /translation="MSRGQDFNSLKMQTSVLKVNIHCDGCKQKVKKLIQKIDGVYSTL
                     IDGEQGKVTVSGTVDPSTLIKRLRKAGKHAALWPAAKCSSFQQQQQKKLPTNDAKEQQ
                     KLPKGMIDTKPPFKKDQKSVRFSLPLQELRHGGNADDNFGDAGDDYSDNTDGFDDEEE
                     EDDDKGLKEKTGSGKGSKGAQFSGSGNGNNSAAPPRMAGFADNPYTQQQQRLAAMMRQ
                     QRMMMMMNGQAIAYGQAMGHAEPFISYFSDENTSSSCTIM"
     assembly_gap    2593529..2594235
                     /estimated_length=707
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            complement(2596403..2608802)
                     /locus_tag="AXF42_Ash012399"
     mRNA            complement(join(2596403..2596688,2598340..2598630,
                     2599263..2600187,2600285..2600346,2600421..2600493,
                     2608478..2608545,2608612..2608802))
                     /locus_tag="AXF42_Ash012399"
                     /product="hypothetical protein"
     CDS             complement(join(2596403..2596688,2598340..2598630,
                     2599263..2600187,2600285..2600346,2600421..2600493,
                     2608478..2608545,2608612..2608802))
                     /locus_tag="AXF42_Ash012399"
                     /note="GO_component: GO:0016021 - integral to membrane
                     [Evidence IEA];
                     GO_function: GO:0004348 - glucosylceramidase activity
                     [Evidence IEA];
                     GO_process: GO:0006665 - sphingolipid metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKA53457.1"
                     /db_xref="InterPro:IPR006775"
                     /db_xref="InterPro:IPR024462"
                     /translation="MFQHGSFDQMNVNENVLPSVPGSSIGAAVAASLHIPAHAVRTVT
                     FALSWASPQIKFPCGRTYRRRYTKFYGIDDDAAVNLVREAIAEHRKWESQIEDWQRPI
                     LADKRLPAWYPVALFNALYYFNAGGAIWTDGMPSKRSLVNIKQRKFFFDPSSLKNNIM
                     NDNLINNTGIDILNKMTSLMDGFRSPSTLNSAMGTSLLQEGEENVGQFLYLEGSEYHL
                     FNTYDVHFYSSFALLMLFPKLELSIQRDFAMAVLMHDPEKIQPIHGVNQVPRKVFGAV
                     PHDLGQNDPWFELNAYYLHDPNRWKDLNPKFVLQVYRDVVVTGDKSFAHAVWPSVFIA
                     MAFMDQFDKDSDGMIENEGCPDQTYDMWAAFGVSAYTGGLWVAALQAASCMARLVGDT
                     TSEKYFWNRYLKSKAVYNKLWNGSYFNYDNSGSGKSSPIHADQLAGQWFARASGLQPI
                     VENERAKSTLEKIYDFNVLKVMNGKGGVINGMSPDGKIESLTMQAREIWAGVTFSVAA
                     TMIQEGMEEKAFKTAQGVYETAWALEGLGYAFRIPESWNLNGQYRSINYMRPLAIWAM
                     QWALSPPKLLEEEHRMDNVQVEGSFEHTEFSKIADLLKLPEEKPTRSILSVILDIIHQ
                     RLLLRRI"
     assembly_gap    2612718..2619290
                     /estimated_length=6573
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            complement(2620126..2620626)
                     /locus_tag="AXF42_Ash012400"
     mRNA            complement(2620126..2620626)
                     /locus_tag="AXF42_Ash012400"
                     /product="hypothetical protein"
     CDS             complement(2620126..2620626)
                     /locus_tag="AXF42_Ash012400"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKA53458.1"
                     /translation="MSAAAVQQTQVLDPDSLHSGTLRCFFGCSFHCFFRSHCPPDGNR
                     GHHGGADFPAGETLALDCGETQPLDEFGVGVHDWGRTQVIDYSGETVVVEDEDDEGGL
                     SERTILPNDREILVDDLCLEAESARSKDENLVDPDASTDEKEDSVRSCTGAARLALHF
                     CLLLIL"
CONTIG      join(PEFY01005878.1:1..2453,gap(7033),PEFY01005879.1:1..11073,
            gap(10),PEFY01005880.1:1..5187,gap(59),PEFY01005881.1:1..5661,
            gap(6393),PEFY01005882.1:1..134577,gap(5035),
            PEFY01005883.1:1..50517,gap(5192),PEFY01005884.1:1..3361,gap(4500),
            PEFY01005885.1:1..3315,gap(25),PEFY01005886.1:1..33570,gap(273),
            PEFY01005887.1:1..155159,gap(2055),PEFY01005888.1:1..2774,
            gap(3000),PEFY01005889.1:1..10414,gap(7167),
            PEFY01005890.1:1..114002,gap(25),PEFY01005891.1:1..5360,gap(1570),
            PEFY01005892.1:1..2965,gap(1434),PEFY01005893.1:1..18806,gap(10),
            PEFY01005894.1:1..9881,gap(2556),PEFY01005895.1:1..23376,gap(551),
            PEFY01005896.1:1..13379,gap(10),PEFY01005897.1:1..8634,gap(101),
            PEFY01005898.1:1..1423,gap(3117),PEFY01005899.1:1..122315,gap(25),
            PEFY01005900.1:1..18534,gap(2925),PEFY01005901.1:1..11997,gap(25),
            PEFY01005902.1:1..4884,gap(529),PEFY01005903.1:1..2401,gap(2302),
            PEFY01005904.1:1..5977,gap(10),PEFY01005905.1:1..13226,gap(8489),
            PEFY01005906.1:1..6268,gap(3222),PEFY01005907.1:1..192692,
            gap(2207),PEFY01005908.1:1..1467,gap(479),PEFY01005909.1:1..2808,
            gap(1923),PEFY01005910.1:1..25918,gap(200),PEFY01005911.1:1..6757,
            gap(25),PEFY01005912.1:1..31327,gap(6929),PEFY01005913.1:1..2790,
            gap(4771),PEFY01005914.1:1..1850,gap(1805),
            PEFY01005915.1:1..239337,gap(1417),PEFY01005916.1:1..3236,
            gap(9575),PEFY01005917.1:1..113783,gap(10),PEFY01005918.1:1..95183,
            gap(8341),PEFY01005919.1:1..7678,gap(7757),PEFY01005920.1:1..2918,
            gap(4500),PEFY01005921.1:1..5552,gap(1223),PEFY01005922.1:1..13379,
            gap(25),PEFY01005923.1:1..66481,gap(10),PEFY01005924.1:1..28687,
            gap(950),PEFY01005925.1:1..47570,gap(1969),PEFY01005926.1:1..35781,
            gap(110),PEFY01005927.1:1..21985,gap(1820),PEFY01005928.1:1..52421,
            gap(1929),PEFY01005929.1:1..2233,gap(1331),PEFY01005930.1:1..27198,
            gap(3069),PEFY01005931.1:1..19050,gap(2733),PEFY01005932.1:1..1601,
            gap(3494),PEFY01005933.1:1..23069,gap(25),PEFY01005934.1:1..17816,
            gap(118),PEFY01005935.1:1..45549,gap(10),PEFY01005936.1:1..16733,
            gap(8545),PEFY01005937.1:1..52999,gap(110),PEFY01005938.1:1..43573,
            gap(827),PEFY01005939.1:1..7077,gap(407),PEFY01005940.1:1..20071,
            gap(25),PEFY01005941.1:1..14728,gap(1709),PEFY01005942.1:1..5423,
            gap(7205),PEFY01005943.1:1..28307,gap(1300),
            PEFY01005944.1:1..22121,gap(702),PEFY01005945.1:1..5184,gap(25),
            PEFY01005946.1:1..114434,gap(566),PEFY01005947.1:1..167454,
            gap(707),PEFY01005948.1:1..18482,gap(6573),PEFY01005949.1:1..3255)
//