LOCUS KZ382502 1015 bp DNA linear CON 14-NOV-2017 DEFINITION Teladorsagia circumcincta strain S unplaced genomic scaffold T_circumcincta.1.0_Cont35973, whole genome shotgun sequence. ACCESSION KZ382502 LUHK01000000 VERSION KZ382502.1 DBLINK BioProject: PRJNA72569 BioSample: SAMN02780891 KEYWORDS WGS; HIGH_QUALITY_DRAFT. SOURCE Teladorsagia circumcincta ORGANISM Teladorsagia circumcincta Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida; Rhabditina; Rhabditomorpha; Strongyloidea; Trichostrongylidae; Teladorsagia. REFERENCE 1 (bases 1 to 1015) AUTHORS Mitreva,M. TITLE Draft genome of the parasitic nematode Teladorsagia circumcincta isolate WARC Sus (inbred) JOURNAL Unpublished REFERENCE 2 (bases 1 to 1015) AUTHORS Mitreva,M., Abubucker,S., Martin,J., Minx,P., Warren,C., Pepin,K.H., Palsikar,V.B., Zhang,X.W. and Wilson,R.K. TITLE Direct Submission JOURNAL Submitted (16-SEP-2015) The Genome Institute, Washington University School of Medicine, 4444 Forest Park, St. Louis, MO 63108, USA COMMENT The brown stomach worm, Teladorsagia circumcinta, is economically the most important nematode parasite of sheep throughout temperate regions of the world and has developed multiple resistances to drugs. Globally, these parasites lead to millions of dollars in economic losses due to reduced production of meat, wool and milk and the high costs of treatment. These brownish, thread-like worms infect the fourth stomach (abomasum) of small ruminants (sheep and goats), causing weight loss, decreased wool production and death. The strain sequenced here was developed in the laboratory of Dr. Stewart Bisset (stewart.bisset@agresearch.co.nz) at AgResearch, New Zealand, by subjecting an anthelmintic-susceptible laboratory isolate, originally derived from field-grazed lambs in New Zealand in the 1950s, to two generations of inbreeding (sibling mating) in order to minimize genetic diversity. Worm isolation and DNA extraction was performed by Stewart Bisset and/or the Genome Institute's production team. This assembly consists of fragments, 3kb and 8kb insert whole genome shotgun libraries. The sequences were generating on the Roch/454 platform and assembled using Newbler. To improve scaffolding, the inhouse tool CIGA (Cdna tool for Improving Genome Assembly) was used to map 454 cDNA reads using blat to the genomic assembly to link genomic contigs based on cDNA evidence. Only joins confirmed by additional independent data typing were accepted. Gaps were then closed using Pygap (Gap closure tool) which utilzes the Pyramid assembler and uses Illumina paired reads to close gaps and extend contigs. The repeat library was generated using Repeatmodeler (A.F.A. Smit, R. Hubley & P. Green http://repeatmasker.org). The Ribosomal RNA genes were identified using RNAmmer (Lagesen et. al., 2007 Nucleic Acids Res.) and transfer RNA's were identified with tRNAscan-SE (Lowe and Eddy, Nucleic Acids Res. 1997). Non-coding RNAs, such as microRNAs, were identified by sequence homology search of the Rfam database (Griffiths-Jones et. al., 2003 Nucleic Acids Res.). Repeats and predicted RNA's were then masked using RepeatMasker (A.Smit, R. Hubley & P. Green http://repeatmasker.org). Protein-coding genes were predicted using a combination of ab initio programs Snap (Korf, 2004 BCM Bioinformatics), Fgenesh (Salamov A., Solovyev V. 2000, Genome Res.) and Augustus (M. Stanke, et. al., 2008 Bioinformatics) and the annotation pipeline tool Maker (M. Yandell et. al., 2007 Genomc Research) which aligns mRNA, EST and protein information from same species or cross-species to aid in gene structure determination and modifications. A consensus gene set from the above prediction algorithms was generated, using a logical, hierarchical approach developed at the Genome institute. Gene product naming was determined by BER (http://ber.sourceforge.net). Our goal is to explore this WGS draft sequence of Teladorsagia circumcincta to better define proteins involved in nematode parasitism that impact health and disease and are relevant to both host-parasite relationships and basic biological processes. For information regarding this assembly or project, or any other GSC genome project, please visit our Genome Groups web page (http://genome.wustl.edu/genome_group_index.cgi) and email the designated contact person. For specific questions regarding the Teladorsagia circumcincta genome project contact Makedonka Mitreva (mmitreva@genome.wustl.edu) at Washington University School of Medicine. The National Human Genome Research Institute (NHGRI) of the National Institutes of Health (NIH) provided funds for this project. ##Genome-Assembly-Data-START## Finishing Goal :: High-Quality Draft Current Finishing Status :: High-Quality Draft Assembly Method :: Newbler v. 2.6 Assembly Name :: T_circumcincta.14.0.ec.cg.pg Genome Coverage :: 12.20x Sequencing Technology :: 454 ##Genome-Assembly-Data-END## FEATURES Location/Qualifiers source 1..1015 /organism="Teladorsagia circumcincta" /mol_type="genomic DNA" /submitter_seqid="T_circumcincta.1.0_Cont35973" /strain="S" /isolation_source="developed by two generations of inbreeding (sibling mating) of an anthelmintic-susceptible laboratory isolate that was originally derived from field-grazed lambs in New Zealand in the 1950s" /host="sheep" /db_xref="taxon:45464" /chromosome="Unknown" /country="New Zealand" /lat_lon="42.0000 S 174.0000 E" gene complement(<473..>830) /locus_tag="TELCIR_22471" mRNA complement(join(<473..575,730..830)) /locus_tag="TELCIR_22471" /product="hypothetical protein" CDS complement(join(<473..575,730..>830)) /locus_tag="TELCIR_22471" /note="KEGG: cin:100184046 2.3e-10 similar to Cytosolic 5-nucleotidase III (cN-III) (Pyrimidine 5-nucleotidase 1) (P5N-1) (P5N-1) (PN-I); K01081 5'-nucleotidase" /codon_start=1 /product="hypothetical protein" /protein_id="PIO56134.1" /translation="GVVVSFSQPLIHTFCKNSSVVRKEANFFHDVRGRNNVLLLGDSM GDIHMDVGVEKDGPTLKIGFLNSD" CONTIG join(LUHK01167103.1:1..1015) //