LOCUS       KU232300                 692 bp    RNA     linear   VRL 10-FEB-2016
DEFINITION  Zika virus isolate 067ZV_PEBR15 NS5 protein gene, partial cds.
ACCESSION   KU232300
VERSION     KU232300.1
KEYWORDS    .
SOURCE      Zika virus
  ORGANISM  Zika virus
            Viruses; Riboviria; Orthornavirae; Kitrinoviricota; Flasuviricetes;
            Amarillovirales; Flaviviridae; Orthoflavivirus; Orthoflavivirus
            zikaense.
REFERENCE   1  (bases 1 to 692)
  AUTHORS   Pessoa,R. and Sanabani,S.
  TITLE     Investigation into an Outbreak of Dengue-like Illness in
            Pernambuco, Brazil Revealed a Co-circulation of Zika, Chikungunya,
            and Dengue Virus Type 1
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 692)
  AUTHORS   Pessoa,R. and Sanabani,S.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-DEC-2015) Virology, Instituto de Medicina Tropical,
            R. Doutor Eneias de Carvalho Aguiar, 470, Sao Paulo, SP 05403-000,
            Brazil
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..692
                     /organism="Zika virus"
                     /mol_type="genomic RNA"
                     /isolate="067ZV_PEBR15"
                     /host="Homo sapiens"
                     /db_xref="taxon:64320"
                     /country="Brazil"
                     /collection_date="25-May-2015"
                     /note="type: Asiatic"
     CDS             <1..>692
                     /codon_start=2
                     /product="NS5 protein"
                     /protein_id="AME17085.1"
                     /translation="EALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRM
                     YADDTAGWDTRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGK
                     TVMDIISRQDQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTN
                     WLQSNGWDRLKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNW
                     EEVPFCSHHFNK"
BASE COUNT          216 a          131 c          201 g          143 t
ORIGIN      
        1 tgaagccctt ggattcttga acgaggatca ctggatgggg agagagaact caggaggtgg
       61 tgttgaaggg ctgggattac aaagactcgg atatgtccta gaagagatga gtcgcatacc
      121 aggaggaagg atgtatgcag atgacactgc tggctgggac acccgcatca gcaggtttga
      181 tctggagaat gaagctctaa tcaccaacca aatggagaaa gggcacaggg ccttggcatt
      241 ggccataatc aagtacacat accaaaacaa agtggtaaag gtccttagac cagctgaaaa
      301 agggaaaaca gtyatggaca ttatttcgag acaagaccaa agggggagcg gacaagttgt
      361 cacttacgct cttaacacat ttaccaacct agtggtgcaa ctcattcgga atatggaggc
      421 tgaggaagtt ctagagatgc aagacttgtg gctgctgcgg aggtcagaga aagtgaccaa
      481 ctggttgcag agcaacggat gggataggct caaacgaatg gcagtcagtg gagatgattg
      541 cgttgtgaag ccaattgatg ataggtttgc acatgccctc aggttcttga atgatatggg
      601 aaaagttagg aaggacacac aagagtggaa accctcaact ggatgggaca actgggaaga
      661 agttccgttt tgctcccacc acttcaacaa gc
//