LOCUS KU232300 692 bp RNA linear VRL 10-FEB-2016 DEFINITION Zika virus isolate 067ZV_PEBR15 NS5 protein gene, partial cds. ACCESSION KU232300 VERSION KU232300.1 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; Riboviria; Orthornavirae; Kitrinoviricota; Flasuviricetes; Amarillovirales; Flaviviridae; Orthoflavivirus; Orthoflavivirus zikaense. REFERENCE 1 (bases 1 to 692) AUTHORS Pessoa,R. and Sanabani,S. TITLE Investigation into an Outbreak of Dengue-like Illness in Pernambuco, Brazil Revealed a Co-circulation of Zika, Chikungunya, and Dengue Virus Type 1 JOURNAL Unpublished REFERENCE 2 (bases 1 to 692) AUTHORS Pessoa,R. and Sanabani,S. TITLE Direct Submission JOURNAL Submitted (04-DEC-2015) Virology, Instituto de Medicina Tropical, R. Doutor Eneias de Carvalho Aguiar, 470, Sao Paulo, SP 05403-000, Brazil COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..692 /organism="Zika virus" /mol_type="genomic RNA" /isolate="067ZV_PEBR15" /host="Homo sapiens" /db_xref="taxon:64320" /country="Brazil" /collection_date="25-May-2015" /note="type: Asiatic" CDS <1..>692 /codon_start=2 /product="NS5 protein" /protein_id="AME17085.1" /translation="EALGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRM YADDTAGWDTRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGK TVMDIISRQDQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTN WLQSNGWDRLKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNW EEVPFCSHHFNK" BASE COUNT 216 a 131 c 201 g 143 t ORIGIN 1 tgaagccctt ggattcttga acgaggatca ctggatgggg agagagaact caggaggtgg 61 tgttgaaggg ctgggattac aaagactcgg atatgtccta gaagagatga gtcgcatacc 121 aggaggaagg atgtatgcag atgacactgc tggctgggac acccgcatca gcaggtttga 181 tctggagaat gaagctctaa tcaccaacca aatggagaaa gggcacaggg ccttggcatt 241 ggccataatc aagtacacat accaaaacaa agtggtaaag gtccttagac cagctgaaaa 301 agggaaaaca gtyatggaca ttatttcgag acaagaccaa agggggagcg gacaagttgt 361 cacttacgct cttaacacat ttaccaacct agtggtgcaa ctcattcgga atatggaggc 421 tgaggaagtt ctagagatgc aagacttgtg gctgctgcgg aggtcagaga aagtgaccaa 481 ctggttgcag agcaacggat gggataggct caaacgaatg gcagtcagtg gagatgattg 541 cgttgtgaag ccaattgatg ataggtttgc acatgccctc aggttcttga atgatatggg 601 aaaagttagg aaggacacac aagagtggaa accctcaact ggatgggaca actgggaaga 661 agttccgttt tgctcccacc acttcaacaa gc //