LOCUS KU232293 679 bp RNA linear VRL 10-FEB-2016 DEFINITION Zika virus isolate 057ZV_PEBR15 NS5 protein gene, partial cds. ACCESSION KU232293 VERSION KU232293.1 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; Riboviria; Orthornavirae; Kitrinoviricota; Flasuviricetes; Amarillovirales; Flaviviridae; Orthoflavivirus; Orthoflavivirus zikaense. REFERENCE 1 (bases 1 to 679) AUTHORS Pessoa,R. and Sanabani,S. TITLE Investigation into an Outbreak of Dengue-like Illness in Pernambuco, Brazil Revealed a Co-circulation of Zika, Chikungunya, and Dengue Virus Type 1 JOURNAL Unpublished REFERENCE 2 (bases 1 to 679) AUTHORS Pessoa,R. and Sanabani,S. TITLE Direct Submission JOURNAL Submitted (03-DEC-2015) Virology, Instituto de Medicina Tropical, R. Doutor Eneias de Carvalho Aguiar, 470, Sao Paulo, SP 05403-000, Brazil COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..679 /organism="Zika virus" /mol_type="genomic RNA" /isolate="057ZV_PEBR15" /host="Homo sapiens" /db_xref="taxon:64320" /country="Brazil" /collection_date="25-May-2015" /note="type: Asiatic" CDS <1..>679 /codon_start=3 /product="NS5 protein" /protein_id="AME17078.1" /translation="LGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYA DDTAGWDTRISRFDLENEALITNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTV MDIISRQDQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWL QSNGWDRLKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEE VPFCSHH" BASE COUNT 210 a 128 c 198 g 143 t ORIGIN 1 cccttggatt cttgaacgag gatcactgga tggggagaga gaactcagga ggtggtgttg 61 aagggctggg attacaaaga ctcggatatg tcctagaaga gatgagtcgc ataccaggag 121 gaaggatgta tgcagatgac actgctggct gggacacccg catcagcagg tttgatctgg 181 agaatgaagc cctaatcacc aaccaaatgg agaaagggca cagggccttg gcattggcca 241 taatcaagta cacataccaa aacaaagtgg taaaggtcct tagaccagct gaaaaaggga 301 aaacagttat ggacattatt tcgagacaag accaaagggg gagcggacaa gttgtcactt 361 acgctcttaa cacatttacc aacctagtgg tgcaactcat tcggaatatg gaggctgagg 421 aagttctaga gatgcaagac ttgtggctgc tgcggaggtc agagaaagtg accaactggt 481 tgcagagcaa cggatgggat aggctcaaac gaatggcagt cagtggagat gattgcgttg 541 tgaagccaat tgatgatagg tttgcacatg ccctcaggtt cttgaatgat atgggaaaag 601 ttaggaagga cacacaagag tggaaaccct caactggatg ggacaactgg gaagaagttc 661 cgttttgctc ccaccattt //