LOCUS KU232291 667 bp RNA linear VRL 10-FEB-2016 DEFINITION Zika virus isolate 051ZV_PEBR15 NS5 protein gene, partial cds. ACCESSION KU232291 VERSION KU232291.1 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; Riboviria; Orthornavirae; Kitrinoviricota; Flasuviricetes; Amarillovirales; Flaviviridae; Orthoflavivirus; Orthoflavivirus zikaense. REFERENCE 1 (bases 1 to 667) AUTHORS Pessoa,R. and Sanabani,S. TITLE Investigation into an Outbreak of Dengue-like Illness in Pernambuco, Brazil Revealed a Co-circulation of Zika, Chikungunya, and Dengue Virus Type 1 JOURNAL Unpublished REFERENCE 2 (bases 1 to 667) AUTHORS Pessoa,R. and Sanabani,S. TITLE Direct Submission JOURNAL Submitted (03-DEC-2015) Virology, Instituto de Medicina Tropical, R. Doutor Eneias de Carvalho Aguiar, 470, Sao Paulo, SP 05403-000, Brazil COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..667 /organism="Zika virus" /mol_type="genomic RNA" /isolate="051ZV_PEBR15" /host="Homo sapiens" /db_xref="taxon:64320" /country="Brazil" /collection_date="25-May-2015" /note="type: Asiatic" CDS <1..>667 /codon_start=1 /product="NS5 protein" /protein_id="AME17076.1" /translation="FLNEDHWMGRENSGGGVEGLGLQKLGYVLEEMSRIPGGRMYADD TAGWDTRISRFDLENEALVTNQMEKGHRALALAIIKYTYQNKVVKVLRPAEKGKTVMD IISRQDQRGSGQVVTYALNTFTNLVVQLIRNMEAEEVLEMQDLWLLRRSEKVTNWLQS NGWDRLKRMAVSGDDCVVKPIDDRFAHALRFLNDMGKVRKDTQEWKPSTGWDNWEEVP FCSH" BASE COUNT 209 a 124 c 195 g 139 t ORIGIN 1 ttcttgaacg aggatcactg gatgggaaga gagaactcag gaggtggtgt tgaagggctg 61 ggattacaaa aactcggata tgtcctagaa gagatgagtc gcataccagg aggaaggatg 121 tatgcagatg acactgctgg ctgggacacc cgcatcagca ggtttgatct ggagaatgaa 181 gctctagtca ccaaccaaat ggagaaaggg cacagggcct tggcattggc cataatcaag 241 tacacatacc aaaacaaagt ggtaaaggtc cttagaccag ctgaaaaagg gaaaacagtt 301 atggacatta tttcgagaca agaccaaagg gggagcggac aagttgtcac ttacgctctt 361 aacacattta ccaacctagt ggtgcaactc attcggaata tggaggctga ggaagttcta 421 gagatgcaag acttgtggct gctgcggagg tcagagaaag tgaccaactg gttgcagagc 481 aacggatggg ataggctcaa acgaatggca gtcagtggag atgattgcgt tgtgaagcca 541 attgatgata ggtttgcaca tgccctcagg ttcttgaatg atatgggaaa agttaggaag 601 gacacacaag agtggaaacc ctcaactgga tgggacaact gggaagaagt tccgttttgc 661 tcccacc //