LOCUS       KP872291                 241 bp    DNA     linear   PRI 31-AUG-2015
DEFINITION  Gorilla gorilla gorilla MHC class II antigen (DRB6) gene, DRB6-WLG1
            allele, exon 2 and partial cds.
ACCESSION   KP872291
VERSION     KP872291.1
KEYWORDS    .
SOURCE      Gorilla gorilla gorilla (western lowland gorilla)
  ORGANISM  Gorilla gorilla gorilla
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Gorilla.
REFERENCE   1  (bases 1 to 241)
  AUTHORS   Hans,J.B., Haubner,A., Arandjelovic,M., Bergl,R.A., Funfstuck,T.,
            Gray,M., Morgan,D.B., Robbins,M.M., Sanz,C. and Vigilant,L.
  TITLE     Characterization of MHC class II B polymorphism in multiple
            populations of wild gorillas using non-invasive samples and
            next-generation sequencing
  JOURNAL   Am. J. Primatol. (2015) In press
   PUBMED   26283172
  REMARK    Publication Status: Available-Online prior to print
REFERENCE   2  (bases 1 to 241)
  AUTHORS   Hans,J.B.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2015) Primatology, Max Planck Institute for
            Evolutionary Anthropology, Deutscher Platz 6, Leipzig, Saxony
            04103, Germany
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: leeHom published in Nucl. Acids Res. (13
                                     October 2014) 42 (18): e141. v. 2014
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..241
                     /organism="Gorilla gorilla gorilla"
                     /mol_type="genomic DNA"
                     /sub_species="gorilla"
                     /db_xref="taxon:9595"
                     /country="Democratic Republic of the Congo: Goualougo
                     Triangle in the Nouabale-Ndoki National Park"
                     /PCR_primers="fwd_name: gh46, fwd_seq:
                     ccggatccttcgtgtccccacagcacg, rev_name: ab60, rev_seq:
                     ccgaattccgctgcactgtgaagctctc"
     gene            <1..>241
                     /gene="DRB6"
                     /allele="DRB6-WLG1"
                     /note="MHC-DRB6"
     mRNA            <1..>241
                     /gene="DRB6"
                     /allele="DRB6-WLG1"
                     /product="MHC class II antigen"
     CDS             <1..>241
                     /gene="DRB6"
                     /allele="DRB6-WLG1"
                     /codon_start=2
                     /product="MHC class II antigen"
                     /protein_id="AKC57772.1"
                     /translation="FLEQAKCECHILNGTERVQYLNRYIHKREENLRFDSDVGEFQAV
                     TELGRPVAEKWNSQKEILEEKRDKVDTYCRYSYGVF"
     exon            <1..>241
                     /gene="DRB6"
                     /allele="DRB6-WLG1"
                     /number=2
BASE COUNT           66 a           49 c           81 g           45 t
ORIGIN      
        1 tttcttggag caggctaagt gtgagtgtca tatcctcaat gggacggagc gggttcagta
       61 cctgaacaga tacatccata aacgggagga gaacctgcgc ttcgacagcg acgtagggga
      121 gttccaggcg gtaacggaac tggggcggcc tgtcgcagag aaatggaaca gccagaagga
      181 aatcctggag gagaagcggg acaaggtgga cacctactgc agatacagtt acggggtttt
      241 t
//