LOCUS KP872291 241 bp DNA linear PRI 31-AUG-2015 DEFINITION Gorilla gorilla gorilla MHC class II antigen (DRB6) gene, DRB6-WLG1 allele, exon 2 and partial cds. ACCESSION KP872291 VERSION KP872291.1 KEYWORDS . SOURCE Gorilla gorilla gorilla (western lowland gorilla) ORGANISM Gorilla gorilla gorilla Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Gorilla. REFERENCE 1 (bases 1 to 241) AUTHORS Hans,J.B., Haubner,A., Arandjelovic,M., Bergl,R.A., Funfstuck,T., Gray,M., Morgan,D.B., Robbins,M.M., Sanz,C. and Vigilant,L. TITLE Characterization of MHC class II B polymorphism in multiple populations of wild gorillas using non-invasive samples and next-generation sequencing JOURNAL Am. J. Primatol. (2015) In press PUBMED 26283172 REMARK Publication Status: Available-Online prior to print REFERENCE 2 (bases 1 to 241) AUTHORS Hans,J.B. TITLE Direct Submission JOURNAL Submitted (03-MAR-2015) Primatology, Max Planck Institute for Evolutionary Anthropology, Deutscher Platz 6, Leipzig, Saxony 04103, Germany COMMENT ##Assembly-Data-START## Assembly Method :: leeHom published in Nucl. Acids Res. (13 October 2014) 42 (18): e141. v. 2014 Sequencing Technology :: Illumina ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..241 /organism="Gorilla gorilla gorilla" /mol_type="genomic DNA" /sub_species="gorilla" /db_xref="taxon:9595" /country="Democratic Republic of the Congo: Goualougo Triangle in the Nouabale-Ndoki National Park" /PCR_primers="fwd_name: gh46, fwd_seq: ccggatccttcgtgtccccacagcacg, rev_name: ab60, rev_seq: ccgaattccgctgcactgtgaagctctc" gene <1..>241 /gene="DRB6" /allele="DRB6-WLG1" /note="MHC-DRB6" mRNA <1..>241 /gene="DRB6" /allele="DRB6-WLG1" /product="MHC class II antigen" CDS <1..>241 /gene="DRB6" /allele="DRB6-WLG1" /codon_start=2 /product="MHC class II antigen" /protein_id="AKC57772.1" /translation="FLEQAKCECHILNGTERVQYLNRYIHKREENLRFDSDVGEFQAV TELGRPVAEKWNSQKEILEEKRDKVDTYCRYSYGVF" exon <1..>241 /gene="DRB6" /allele="DRB6-WLG1" /number=2 BASE COUNT 66 a 49 c 81 g 45 t ORIGIN 1 tttcttggag caggctaagt gtgagtgtca tatcctcaat gggacggagc gggttcagta 61 cctgaacaga tacatccata aacgggagga gaacctgcgc ttcgacagcg acgtagggga 121 gttccaggcg gtaacggaac tggggcggcc tgtcgcagag aaatggaaca gccagaagga 181 aatcctggag gagaagcggg acaaggtgga cacctactgc agatacagtt acggggtttt 241 t //