LOCUS       KP063115               74193 bp    DNA     linear   PLN 10-NOV-2014
DEFINITION  Saccharum officinarum clone LA Purple_99P01 genomic sequence,
            complete sequence.
ACCESSION   KP063115
VERSION     KP063115.1
KEYWORDS    HTG.
SOURCE      Saccharum officinarum
  ORGANISM  Saccharum officinarum
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; PACMAD
            clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae;
            Saccharum; Saccharum officinarum complex.
REFERENCE   1  (bases 1 to 74193)
  AUTHORS   Zhang,J., Yu,Q., Sharma,A., Wang,J., Zhu,L., Li,L., Chen,Y. and
            Ming,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (27-OCT-2014) Center for Genomics and Biotechnology,
            Fujian Agriculture and Forestry University, Fujian Agriculture and
            Forestry University, Fuzhou, Fujian 350002, China
FEATURES             Location/Qualifiers
     source          1..74193
                     /organism="Saccharum officinarum"
                     /mol_type="genomic DNA"
                     /cultivar="LA Purple"
                     /db_xref="taxon:4547"
                     /clone="LA Purple_99P01"
     gene            <11106..>15101
                     /locus_tag="LA99P01_001"
     mRNA            join(<11106..11114,11298..11473,11595..11712,11914..12087,
                     13583..13746,13843..13930,14127..14180,15012..>15101)
                     /locus_tag="LA99P01_001"
                     /product="putative cell division control protein 2-like
                     protein 2"
     CDS             join(11106..11114,11298..11473,11595..11712,11914..12087,
                     13583..13746,13843..13930,14127..14180,15012..15101)
                     /locus_tag="LA99P01_001"
                     /codon_start=1
                     /product="putative cell division control protein 2-like
                     protein 2"
                     /protein_id="AIW39790.1"
                     /translation="MDQTEKIGEGTYGVVYKGTNRHTNETIALKKIRLEQEDEGVPST
                     AIREISLLKEMQHRNIVRLQDVVHNDKCIYLVFEYLDLDLKKHMDSSADFKNHRIVKS
                     YLYQILRGIAYCHSHRVLHRDLKPQNLLLDRRNNILKLADFGLARAFGIPVRTFTHEV
                     VTLWYRAPEILLGARHYSTPVDVWSVGCIFAEMVNQKPLFPGDSEIDELFKIFRILGT
                     PTEETWPGVASLPDYKSTFPKWPSVDLATVVPTLEPAGIDLLSKMLRLDPSKRINARA
                     ALAHEYFRDLEHAY"
     gene            <17569..>21350
                     /locus_tag="LA99P01_002"
     mRNA            join(<17569..17637,18050..18107,19474..19687,19778..20103,
                     20630..20862,20989..21056,21140..21201,21289..>21350)
                     /locus_tag="LA99P01_002"
                     /product="putative shrunken seed protein"
     CDS             join(17569..17637,18050..18107,19474..19687,19778..20103,
                     20630..20862,20989..21056,21140..21201,21289..21350)
                     /locus_tag="LA99P01_002"
                     /codon_start=1
                     /product="putative shrunken seed protein"
                     /protein_id="AIW39791.1"
                     /translation="MEAYKLWVRRNRDLVRSLESLANGLTWILPERFANSEIAPEAVY
                     ALLGVVSSVNQHIIDAPTENHSFASKEQSIPWGLVVSVLKDVEAVVEVAAQHFVGDDR
                     KWSFLAVMEAVKAGVRLAAFRESGYKMLLQGGEVANEEEVTVLENNYGVNGNGVPAIY
                     PMDGHAGNGHKAMTKGLDGKNGFVSKSLEKRAVAALNKFGENAKMMSDPMWMRRLQPT
                     PEPTVMVAEKPTLASIWSAKGGTGRLFVLGEVVHIFRPLVYVLLIRKFGIKSWTPWLV
                     SLAVELASLGIHSHVTDLSHRLGKLKRRKMMWALYLMRDPFFASYTKRHLQKAEQVLN
                     PVPLIGFLTGKLIELLEGVQTRYTYTSGS"
     gene            complement(<24395..>26866)
                     /locus_tag="LA99P01_003"
     mRNA            complement(join(<24395..24676,24754..24901,25012..25162,
                     25258..>26866))
                     /locus_tag="LA99P01_003"
                     /product="hypothetical protein"
     CDS             complement(join(24395..24676,24754..24901,25012..25162,
                     25258..26866))
                     /locus_tag="LA99P01_003"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AIW39792.1"
                     /translation="MTTAPSRPGPAAAAAAVHLADHLESATLAPPPPPPPPPSPTTIL
                     TAWSRLRDASTSPTDALAALETLHHHRRALRLSSAHASLLLPLLPLHPRLVAPLLAAA
                     PHLVAASVPASLPFAPRLLLLGARASAKDLPGHASFGKPASTANNPGSGESASGHDDD
                     PVVAVRRVLEDVERGDQSIDDLDHLALTGVGYALAAADEVQFRRILVSLLRICGRTGN
                     LATGVRVLKLMEWLVMGFVEARKMRKVQVLFELISPEKCEGEDYVLFPVVMATCGGLR
                     ALRVASARYRLDFDPRLKEAPERTIQFVAERAVLEGRPADDQRILVQCVALGLTRCGQ
                     ITFHESVLRCVCMGLLKELLPLPDLLRMSVEKAEGNEFVKAQVNQHLDSILFKEAGPV
                     TGVLCNQYSYANDKAKSFVETCVWEYAQEIYCHLRAAVLLHRGKQDDLITAIDKIAEA
                     SFLVVVVFAAEVTKHRLNAKSSEGFQPEVAARILVAFSCVEHLRRLRLPEYTEAVRSA
                     VLDIQENAAATALFIESMPSYTELTSKPDLPALAGTTYIWHRDEVQTSRILFYLRVVP
                     TCVGLIPVHMIQDKVASIMFLYLQHSNEKVTSASHSVMVSFSSSGSDTDQDDRAALKE
                     QLTFYYIKRSLEAYPGVTPFDGLASGVAALVRHLPAGSAAILFCIHSLVVKAKDLCEV
                     AKVQNKSLWRSWEESTDPCKKMLDLLLRLIFLVDIQVGIWSCSFPLM"
     gene            <29773..>31404
                     /locus_tag="LA99P01_004"
     mRNA            <29773..>31404
                     /locus_tag="LA99P01_004"
                     /product="putative tyrosine-specific protein
                     phosphatase-like protein"
     CDS             29773..31404
                     /locus_tag="LA99P01_004"
                     /codon_start=1
                     /product="putative tyrosine-specific protein
                     phosphatase-like protein"
                     /protein_id="AIW39793.1"
                     /translation="MAAKRRARRPRSDDSKELGRNGGYEGSDEEVEESGKSGETAMSA
                     EPKEMRLKQAEQPSPPSTKDAGAQGSGEASPARSAPRGGVALKTSTTSKLAKTPPPAS
                     QEEDEAGDSGDASPARDPLPDDTADAGHNKRAVTPKRGPPPQQGEERPETVAASALQQ
                     LRKALTKPTSPPSSSDIAQEDEHHGREMAEQEQSNTSPSQDEHRARKELQQEKKITEQ
                     DHAGDTSPPHDKDKDKDMHKPRSAGDTSPPHDKDKDMHKPRSSETEKKPAVERSWSYD
                     DELKILNALVVHAQSHNGALPDSSHLLANLTFDKIDATEDKLTDKIRKLRRRYCRFLL
                     QGCPSDDLSRRLFKLSEILWGQADEDERVEPTCRDFSVLSKLYPHLAKEVKAYAETHS
                     SGDLIMAMFMTIGDEKARDLDAKCKKQHIEAFKLELGQASLTNELLSALSSLTTKITD
                     PSQATPCKRRAEKLEEPLDEQYLRRSKRVAGKTEGFKDKPNADDVFNPKPLAMVPTLN
                     SPAPHLTKDIGDGIATAFLQIHPRDVWRTDQAGHR"
     gene            32438..49782
                     /locus_tag="LA99P01_005"
                     /pseudogene="unprocessed"
     mobile_element  complement(join(32735..34893,45479..49035))
                     /mobile_element_type="retrotransposon:Gypsy"
     repeat_region   complement(32740..33088)
                     /rpt_type=long_terminal_repeat
     mobile_element  34889..45483
                     /mobile_element_type="retrotransposon:Copia"
     repeat_region   34896..36875
                     /locus_tag="LA99P01_005"
                     /rpt_type=long_terminal_repeat
     repeat_region   43499..45478
                     /locus_tag="LA99P01_005"
                     /rpt_type=long_terminal_repeat
     repeat_region   complement(48682..49030)
                     /rpt_type=long_terminal_repeat
     gene            complement(<51580..>55853)
                     /locus_tag="LA99P01_010"
     mRNA            complement(join(<51580..51810,51996..52217,52540..52652,
                     52754..52871,53654..53748,55625..>55853))
                     /locus_tag="LA99P01_010"
                     /product="putative NADP-dependent D-sorbitol-6-phosphate
                     dehydrogenase"
     CDS             complement(join(51580..51810,51996..52217,52540..52652,
                     52754..52871,53654..53748,55625..55853))
                     /locus_tag="LA99P01_010"
                     /codon_start=1
                     /product="putative NADP-dependent D-sorbitol-6-phosphate
                     dehydrogenase"
                     /protein_id="AIW39794.1"
                     /translation="MAAKDVAPAVNGHSHRVVAVPAAVNGHSRRMVPTVTLSSGHRMP
                     AVGLGVWRMEKTAVRRLIHAAIRNGYRHFDCAAKYGNEAEVGDALAEAFQTGLVNRED
                     LFITTKLWNSDHGNVVEACKDSLKKLQLDYLDLYLIHFPVATRHTEIGATVSVIGEDG
                     VLDIDTTISLEATWHAMEDLVSMGLNYGVLLTRDCLAYARIKPAVNQIELHPYFQRDS
                     LVKFCQKHGICVTAHTPLGGGFTANAKLFGSLSCLEDPVIKELAKKYGKTPAQLVLRW
                     GLQRNAAVIPKTSKVERLQENLEVLDFDISEEDMKEMKAIDRNHRTNQPAKFWGIDIY
                     A"
     gene            complement(<61636..>65306)
                     /locus_tag="LA99P01_011"
     mRNA            complement(join(<61636..61866,62010..62229,63134..63266,
                     63340..63457,63892..63986,65156..>65306))
                     /locus_tag="LA99P01_011"
                     /product="putative NADP-dependent D-sorbitol-6-phosphate
                     dehydrogenase"
     CDS             complement(join(61636..61866,62010..62229,63134..63266,
                     63340..63457,63892..63986,65156..65306))
                     /locus_tag="LA99P01_011"
                     /codon_start=1
                     /product="putative NADP-dependent D-sorbitol-6-phosphate
                     dehydrogenase"
                     /protein_id="AIW39795.1"
                     /translation="MAAAKDAAVALSSGHRMPAVGLGVWRMDKRDVRGLIHAALRVGY
                     RHLDCAADYQNEAEVGDALAEAFQTGLVKREDLFITTKLWNSDHGHVLEACKDSLKKL
                     QLDYLDLYLIHFPVATRHTGVGTTSSALGDDGVLDIDTTISLETTWHAMEELVSMGLV
                     RSIGISNYDIFLTRDCLAYAKIKPAVNQIETHPYFQRDSLVKFCQKHGICVTAHTPLG
                     GSTANTEWFGTVSCLDDPVIKSLAEKYGNTPAQLVLRWGLQRNTVVIPKTSKLERLQE
                     NFEVFDFDISSEDMEKMKAVDRNYRTNQPAKFWGIDLFA"
     mobile_element  69751..74193
                     /note="similar to RLC_scMaximus_2.2"
                     /mobile_element_type="retrotransposon:Copia"
BASE COUNT        21242 a        15897 c        16905 g        20149 t
ORIGIN      
        1 gtaaacgtaa ataatatata tatatatata tatatatata tatatatatg ataataattt
       61 ttattatatg ttttaaaata taaatataga gtaaaaaata tattgcgcta ttaggggggc
      121 acatgcccct accgtcctcc ttgctccacc ccttgcacgc tattcatatg tgtaatgtct
      181 agttcgagtg gatagatcaa acttattagt gaagctgtgc ttagttagtt gtagttcacg
      241 tggttgccat ataggaacac cggcaggaac cccgcctgtt gccgcaggca gaaaagagca
      301 agctgaaaag gccaagttgc atggcaacgg cataattgca aatgggaaca cttaggctaa
      361 caacaatttg actgaaataa caatagtgat gtccgaacga actttataaa agcaagattg
      421 ttcattacac agttgtcgtt gtcagtgtct agaggaccgg gcatctaaac agagcgacta
      481 gtaaatttgt atctgcacgt cttaggccct gatggtgtgc aaagcggaca caaggatgta
      541 tactgattcg ggcatgaacg gttctacgtc tagtgggttt cgctgcggct cgtgttgcct
      601 tgcaccggag tgctcgtagt aggggttaca agctttcgag aaagggagcg gatcccaggt
      661 cttttttgtg aggggtggtg cgtggaagcg tgatgtgtgg tttcgattga ggtggactct
      721 atctgttgct gcttgatcgc cccctttaga cgtggctcct acctcccctt ttatagcttc
      781 taaggggagg gctcgggtta cattcgtggt aaaggggtaa aaacggaaag aatgaaagag
      841 aaaaataaaa aaggtggttt tggacgtggc cgtcttcctc cttattctgt gggagcagtc
      901 cccctgtagc gtggagacgt actgggcgtt gatcttttgg tctctccgtc tgctggtgtt
      961 gcgtgttatg gccatgcctt gtcctgtgtg cctctgtgcc actcaggacg tgcgacatgg
     1021 atacccgaat ttgcataggg aggggttagg tggtatagtg atggttatcc ccgtcactgt
     1081 agaagtatgg atgtcgtcgt ggtagaatga ccggggtcac attgagtcag ggcgtggctc
     1141 ccgtgctcct cttgactgtg cacgatcacg tctgtcctat cggtgggagc gggcgccgcg
     1201 gttggggggt tcccgtggct caccgtcttg ccagaggatt acacgtgtcc ctcgagcgag
     1261 gcggaactaa accgagggag tcgggcactt tgatgacgtt acggggactc gggcgagacg
     1321 gagaaatgtc gcccgaggcg cctatctcgc ccgagacctt tccgcaaggc tcgggtggga
     1381 tggagtttgt cgttcgtgcc tcgagcgact gacatgctgt caatgctttt ggcaagtcgg
     1441 ttttgcaggg ggccctacgg tggggcttta gcaatcgtgc agggtgccgt attttaccgt
     1501 ttgttgggtg taacaccctc ggtgttactg cgttaataaa tcactaaacc atgtcatgag
     1561 catcatgttt atgtattatt gtttatggca aaatgagaaa ttaaactttg ttgcattaat
     1621 tcttaatttg agctctaatt taattccttg tccaaatatt cctcagcaca gttcaactaa
     1681 ctattgtaat cctgatccaa ctccagcgct ggcaatttct tttgctttct aaaattccct
     1741 gatcgcactg tagcagagca gagtactgta gcgccgcaga aatgtactgt agaagagcag
     1801 agctactgta gcgacgcaga aacgcactgt agcagcacag agattactgt agcgcgcaga
     1861 aaacactgta gcacggagac ttgctgcgtc gcgcacgtca atctcttttc cagtgcgagc
     1921 gtccctgcgt ctctcgtcct taaaaggaga cgtctcgcga tcgcgagctc gtcaaacttg
     1981 ttgtccacct cttcctctct aatcaagttt ctctgttctt gtcgtgtaag ctgcgtctat
     2041 cgaagcatca gtggactgcg gtaagtatcc cgcgagttcc tcttgtactt cctctgtttc
     2101 tccttagcag cgccatccgt cttcattatt cctttgatta aagacctcat tcatgagcaa
     2161 gtcacgggag aaagccatga gctaattaag ttcctttgat tttttagaga ttattaatag
     2221 ctactttgcg caaccaatat ctccaccata cgaactccaa ttccgttgat tcttcttcct
     2281 aaattcattg aaaatcaaga gttgtctgtc catgtcatct ttcttcgtct ctagagctca
     2341 actaaattta tctatttatc atgaaatgta ttttagttag tagagaatat taggctagct
     2401 agttcttgct tagtagaagt aatggatagc ttagcatgtt aaccattaga gttagttaat
     2461 tagcttagta gttgtgtact tttaagagtt gttgttgtct aagtattaat ttattgcacc
     2521 atcattgcat gcatgtagtg aacgagttgg aggcggacgt ggtgaccatc gacgaccagg
     2581 agtacgagga ggtcgtggtg gtgatcgagg aggtccttgc agcggaggag gttctggagc
     2641 cgccggctga ctttgttgac tccgtgcctg cccaaggcaa gccccggtgc ataaccctat
     2701 tttactaatc acttggtata tatatgtttg cattacgttt caggagttga tatgaaaact
     2761 acttgcacat atatacccac ctatgagtcc tactagtaca ggtcgtgtag atgcgatgct
     2821 taggatgacg gtagcgggta acctgtcgtt actcacaata ggtgattatt attgtatcac
     2881 atgataagaa ggtgaaagaa aattggagac cgggcagtga tatggtttgg gtactggtgg
     2941 gtgtgacaag ttacgtcccg cggccacggg cttagcttgg ttgcatcgtt ttcctgtccg
     3001 cgtcgattaa ggaccgttcg ttgttatgga caatagtctt gtcacagatc ttattatccc
     3061 gtgcacatac ttacggatgg gagtgaggaa gacttgttac tctcttgtca tgggctccgg
     3121 ctctttccgg accgactgat tggaggcggg gataggtaga ggtctaagca ccactttgag
     3181 gccggacctc aagggtgggg gcttggagtc caagtttgga cggggacctg gaacctgtga
     3241 caggagtgga gcgagttggt ctcatctgtg cccggggtac agatgaggcg tgtgtttttt
     3301 tcggggtacc cagctgggca cattgattcg cgaatcaccg tcgcttagac ggtacggctt
     3361 gactatgaca tggcatcgta gtaacaactg gattaataaa gttggtggaa gaaaggaaag
     3421 aaagagaaat gagcatgatt gcttatcact tgcttgaaag tagaacaggt gcttacctag
     3481 aatgtttagc taataaaaaa aaatgactgc taaatattta ccagtaagga tacactttag
     3541 taagctttgc aggcaaaaat gaaacagcaa accaaaaagc ctttcacatc cttgagagtc
     3601 ggaaaatata tattcccact agtcgggtaa gtcttgcaag tacattttgg tacttagggt
     3661 tattttaccc ctgttgcagg tgcaatttaa aaagttggct gctgtgtgga ggattcttct
     3721 ggtgggcaca gacggatcct tgtatcgctt tccgctagat gtttaattag tttccgctgt
     3781 ttaattactg cactctgaac tctggtattg taatgaataa atttccaaga ctgctattgt
     3841 atgaaatgga ctaagtattg taagcttgta ttcattattg tatcctggat gaaaacgtgg
     3901 attattcgag ttctccttcg ggtgtgctcg acggaggtgt ttgacttggt tcattatcgg
     3961 aatacttagt gtcaatggaa gacgagtatt atcgataatg tgccgattca gacggttccg
     4021 ccatattggg taccctgggt attttgatac ccgagaacag tgaaatggag cctttaagtg
     4081 gtcaacgaaa tagttatttc tgaaacctga gatcattgga aggagagtgt cctggaagca
     4141 cacacctaga cagtgagtga cagagtaggc tatgaaatta aacatcataa ccacaaatag
     4201 tttttggcta tcttttatta ataatttcat ttggcaaaag ctaacacagg tcattaagtt
     4261 ttagatctat acaattagaa gagagataat aatctggatt cgacaaaaga catgaaggta
     4321 tcagattctt aaggaatctc attatattaa ccttgacctt tgtatatatc atctagttga
     4381 ggatgtttgc caagtgaagt aagaccatgt aggttctgta tctgcataag aaaatgacga
     4441 taagaattta gttatcgctg tatatagcta attcctgtaa attacagaag gcatattagg
     4501 gtttttgtta ttgcattggt agttatatat atgactggca tgtatcaagt gaagtatgtc
     4561 tcaataaagt cgaaaatcaa ctaactatcc taggatagaa atattactta tcgtataaga
     4621 tattcaaggg caatctaaaa gtggacatcg tactctatgc tattcaaagt agggttaacc
     4681 tagaaccaca taattttagg ctagccgtat ttcatatttt tgttgcacag aaagccatca
     4741 aggttgagta aacctagatt tgcaattagc ggtgatgaat tacaatcaat agtgcgctct
     4801 aaggttgacg aatgcattct atgttctata gctaaatact agaaaaaata ctgagaattc
     4861 aaaacaatat gctacatatt ctatcagtca attttttaaa attattggag aaatattgta
     4921 ccttccacag caggcaggca aatatttgga atgcgctcgt gctgctgtct tttttctgca
     4981 aaaagaacgg caataagcaa tgagtgttag atacttacaa acaatcctta tacacagata
     5041 aatgttttat tacagtcgag cgaagcaaac ccaaaggcag tgtttgttct ttgctcggca
     5101 accattcagc atagtgattc agcaaaacaa aatgcaagtt cattttcttg tcttggatca
     5161 attactaagg ccatttatca taatcttgtg catagcacaa aacctggtat gacctacaaa
     5221 cctcttgccg cgttgtatat gaaggtgata taagtcagtt ttttcagcaa gccatcgtaa
     5281 ttaggtcgta actaatagag cttgctctat ggaatcattt ggatggacct aactggtgta
     5341 ctaattaacg gagaacagaa cacaaacatc caaaggtatt tacctgaggt agaggtcaag
     5401 gaagaagcaa atagatacgt ggatgtgtta atgacctagt aacatcgaac ttgttcaatt
     5461 gataacaaaa atggtgtgag gtgcaaagga tccctgaact aacaaccttg cacaattgaa
     5521 gcttaatgtg aagggactcc atgcctggga ggcaagctgc aagcaaacct gagggaaacc
     5581 tgcataaacc taaatgacac tggtatttct atttttggac aaacaaataa aaaaagatgt
     5641 actccctcca tccctttaga tctatcgtcg ttggtgtgtg tgccacaagt ttgactcgat
     5701 ttataaaaaa tacgtgcaac atttgtatct ccaaataaat ttattaaaaa aattagattc
     5761 aaagatcttt ccaatgatat taattatgta ctataaatat tgatattttt taatacatat
     5821 ttagtcaaag ttgtttctcg gaaagcgcaa atgacagata tttagggata gagggagtag
     5881 attcagtaaa aattataaat caaaatttta atatggcctt aaactaaaat cctaaagtaa
     5941 aaacacaaag tatggttaac ctgaactaag tgttaacttt ataagttcta aaattctgta
     6001 taggaaaatc acatataccg atctgagata gcgtttatgg tagaatcaaa tatctgaata
     6061 tactgctcta agataggcac tcaatcgtaa atataccaag ggaagatcta gaaaatacgt
     6121 gttaatctat ggcaggaacc tctactgtaa ccccacaatt ttgtggttct gatagtacag
     6181 tgaccaaatg tcatgcaatc ctgcagtagc tatatgtagg ctgacccata tcaagttgca
     6241 acaacgaata tcatttgagt aaaaggagag aagcactgga aaataaaata ctggaaaagc
     6301 aaatataggt gccttgtatt acctggtaca ttctaaaagc agcaattcat agaaacagct
     6361 ccatccacta ctcctgacat tttgaaaaca aagaaacgaa ggttaatctc aaaatccgtc
     6421 agataaggca tagtggatgg aggaaaccct taagtttttt tattgaaaaa gggaggaaac
     6481 atgaaccggc tccacagccc aaaatctata aaaaagcttg gaagggaaga accaacaggg
     6541 ccaaaaaaaa cataccccgg cctgatcaat cacttctgct ggccattgat tgatgatcac
     6601 ttagcactct gttgttctag cccgaatgat tccatgtgga tacctgcatc gagcatcgga
     6661 actgagatgg atcggcaagt gaataaaaaa caatagagaa ggtagacaaa aatgccaaca
     6721 acctcaaata tcaagcaaag aggactcgtg gctgcagttg attgaaaatt tcgatccatt
     6781 ggaactatac gaagcaacag ccataaacta aactggaatt aaatacgaag agaacgattg
     6841 ataggctgcc taagcgccca gcaaaccatt ttgtgagcta aagtatataa ttcctacaaa
     6901 ttacaattac cagctgcaca ggcgcaacta caaaatcaaa acggaatcaa taaagcacag
     6961 gagataaaat gtgcatattc ctgttgggtt aggatttttt tttgttgtag agtatgatcc
     7021 atatctttct acagtgatgg aactaatatg acccatataa aattgtacgt gcataataca
     7081 gaggaccaag atatttcaac gtaagatcac aattagattt gagaggccta agaaaaaagt
     7141 gcaaaacaga aaacttgtac tttttctatt attatgacct tccgcacaag ctgctgcctg
     7201 ccaacggggg agaagcttca ccaacgccca gacctgcaac ggcagaagaa aaaaaacacg
     7261 atgcaccaat tacacgagcc atcgtcaaag ctcctgcttc gtctccgtca ctatcaggga
     7321 ggtgcacgat gatgaaatgc ctttttagtt tctcccctta aagtttagtc tctatcacat
     7381 tatatgtttg acacatatat gaagtattaa atataggata aaaataacta attgcataga
     7441 ttgcgactac tttgcgagac gaatttttta agcctaatta gtccatgatt tgataatgtg
     7501 gtgctacaat aaacatgtgc taatgacaga ttaattaagc ttaataaatt tgtctcgcgg
     7561 attactgagg atttgtgcaa tttgttttat tattactatc cgatcacccc atgtgacgct
     7621 cctaaacccc tggatttaaa cgccaccaaa gaactggcac atctactgtt gcacataggt
     7681 ttggtagcca gaagaacgaa cccgacatgg caacagcaga tccgcgcgtg caatcatggg
     7741 ccagcctcca acgcacaggt aagacaacag cctaatccac tgtggtggca gggaaaagca
     7801 cgaaggagag gctagggcag gggcacctgt ggcatagcag gggcagcgcc agcacgacga
     7861 gaggagacga gcgtccgcac cggcgagctt ccactcttga cgaggggcct gtgcgccgcc
     7921 tatgggcccg gccgaggtgg ggtcgccggt gccagggcta gattcccgcg tgggtgcgtc
     7981 acccatactt gggcgtcgga gccgctaggg caccctacct cgcccgcact ggccgcaggc
     8041 ggtacgggag cgcggaggag gcaggtacca cgaccgcatt ggccagtgca ggcggcggta
     8101 ggtccggccg ccgcatctgg cctcgtaggc accggggcga ggaagaggag atgacgcaat
     8161 tcgtccacgt agccaggcgg ccgcatccac gcgcgctact accgggggag aggaagcttc
     8221 gccggtcggg gagaggaaga cggaggtgac gaagcggggg gagcaggcgg agagcgcgcg
     8281 gcggcggccg aggagaggaa gggagaggcg accacgtggg tagcaggtgg aggcagcgag
     8341 gcgggtggag gggataagga taggaagaaa cgactgcgat tcaaaatggc aatgggtacc
     8401 cgaaacccaa gaacccgacg ggttttaccc gctaaggagg cgggtgtgga aggatttttt
     8461 tacccgcggg tacgttagtg ggtggaaagc tttacccatc gggtatgacg ggtacgggtg
     8521 tggatgtata ctacccatac ccgcgtaccc acgggtaaca aatacccgca aaaatgacta
     8581 aacagcctag tgattctagc ccatttagtt tattaaattt ggcccaaata ctcctagtat
     8641 atatacagtt caactctcct ggaaccctag tccacgacac actcactcca ctcccctatc
     8701 cctttcccac ctgcggcggc gccgcaacag cggacgcgca tcgcgccgcc ctctcccctc
     8761 gcgcgacgcg accgcgactc ccgtcgccgc gcgtcgtagt cgagtgttgg ggggtcgagg
     8821 ctcagtcacg ttggggatcg gcccaggcca ccgcagttcc tccatctcca gtcctccatc
     8881 ggccgtcgca caccatccgc agcaagtctg gcctcctctt cttccccttc ttcagctcgg
     8941 catcctcttc gtctcgtcgt cactggtagc catggtggag aactccagca taggacaaga
     9001 tgatagccgg tgatgctctt cctcatccct aaccttaatc cattgttgca gctcttcttc
     9061 ttcctctaga ccgtttgccg tgttctaacc ccacgccgtc ccgaagggac gccgtcctgc
     9121 acgcgccgga tccggaggcg acgacgaaga acggcgcatc tcctgccccg attcctgccg
     9181 tactcgtctt gccacctcct gcacgaatcg ttgttgcggc tcatgcacca ggggctgctg
     9241 cggctcgtgc accaggagct gttgccgctc gtccaccagg ggctactgcc gctcgtgcac
     9301 ccggcgctgc tgtcgggtaa gaatttgtat gtgaactcgg gtgtattgtc gggtatggaa
     9361 tacccgtcgg gtgctggtat ggaatgaatt ccgtacccgt ctgctttcgt gggtaacccg
     9421 atggaatagg tattgacctg gcgggtgcgg gtatgagtgg ccagtacccg tcaggtacgt
     9481 acccgttgcc attcctagct gcgatggatc caatgaaaaa actaaagatt tcatatgatg
     9541 taacatagta cgggttgtgg agacctagac aactcttatg tattgattgc ttgcgaagat
     9601 gaacgttgaa ctcgaacaga acacttggac cgagcctgag ggtgtcggcg gtgagctcga
     9661 cggttgccga gtatcgaatc aagagttccc cgtacggtta cacaacagaa aaaaggacca
     9721 cgaatgttta acacggccga agcttttacg tgtagaaata acatgccacg gttaacgaaa
     9781 tacaactcct tatttatgta aaaggcttat aacccggttt caaaatgttt cgttcgcacg
     9841 ttagtgttaa aaaataagtc gccgagaaag caacgttttc ttctcggctc agcaccccgg
     9901 ccagcacgac gcactgttta cttccgtggc ctctccgaat aacaacactt aggtactaca
     9961 accccggtta gaagcattct gttctaactc aaatttatct aaatttaaat agcgatatac
    10021 ataaaataaa acattaagat atactctagg taattatcct gttcgttgga tggtttctgc
    10081 tgctgataag tcgattgatg ctattttatt gtgagagaaa aatactgtac catgactgat
    10141 aactttaacc gaacatgatg aatatctaga acgaaaatct accctattaa tacatgtgca
    10201 gcaaatttgt tgctggtgcc tttcggggaa aaaagaatac ctcgaacgaa aataacaata
    10261 tactaagcaa aactgatgaa aggttgaatt atggcattta taaacaaaca aacacaatat
    10321 cttcgatcac atggaatact agtactttac tacaagtaac aagatccggt ttggcacggt
    10381 tccaaagcct gtaatccaat gaaggttgtg tttagttcac caaatttgaa gcgccaaaat
    10441 acactgtaga gatactgtat catttcgttt gtatttaata ataattatcc aaccgttgat
    10501 taattaggct caaaacgttc gtctcacaaa gtgcaaccaa actgtataat taatttttta
    10561 ttctatctac atttagtact ccatgcatgt atcgtaaatt tgatgtgacg gataatcttc
    10621 tttttgcata atgcattttt tttgagcaac taaacacagt cgaagtgacg gcgtgacggc
    10681 aagcgagagc aataatggcc ggggcaacgg cgaccgcgca agatgccccg tgccgtgcac
    10741 gcgcggtcca tgacacgaca cccagccccg accccgagct gagctgagac atgcgtgacc
    10801 tggcagaggc ccgtcccgtc gtccccgtgg cgaaaataaa aacttggcgg cacggcgttt
    10861 gggtgacgcc ccgcgcccgc gcgagccaca tgacatgatt gatttcattt cagcctcgtc
    10921 tttattttta aaataaatga cagcgacgag acccaaggct gcagaaggca aggcagccat
    10981 ccacaagcac aagccacccc gggctcaact cgagtccacc cgaggtccca gagtccccac
    11041 ccaccaccac cactcctccc ctcgccgccg ccagttcccg cccgatccgg ccggatcgcc
    11101 ccgccatgga ccaggtgagc gcgcgcgccg tctccaatcg ctccgctact gccgccttcc
    11161 cccttcccct ccctcccttc tcgacctgcc gcagttgcgg cggcgagcga gctctgtatg
    11221 tctgtctctg atgtgtccct gtaatgtaaa tgtaatgtaa cgcggccggc cggaaatggt
    11281 gggcgcagta cgagaagacg gagaagatcg gggaaggcac gtacggggtg gtgtacaagg
    11341 gcacaaaccg ccacaccaac gagacgatcg cgctcaagaa gatccgcctc gagcaggagg
    11401 acgagggcgt cccttccacc gccatccgcg agatctccct cctcaaggag atgcagcacc
    11461 gcaacatcgt caggtacttg ctcacttacg cgcatgccat gccagggtct gtttgcgtgc
    11521 ttggaacatt gccccggccc gggcgttgcc gttgacaagc tacccgctgc tgatgcgctc
    11581 gcgctgccgt gcaggctgca ggacgtcgtg cacaacgaca agtgcatcta cctcgtcttc
    11641 gagtacctcg acctcgacct caagaagcac atggactcct ccgccgactt caagaaccac
    11701 cgcatagtca aagtcagtct ctcctcctcc ctctcccttt tttgctttga atcgagccgc
    11761 cgtacgccac tgctggtgct gccgtaccac ctactatcac tcgacacagc ggttccgttg
    11821 acgaggctgt gactgcgaat gatagtaatt gcgagatatg aatgaaatgc aaattttaat
    11881 gccggaatat gctccctgtg ctgtgccgtg cagtcctacc tctaccagat tctgcggggc
    11941 attgcctact gccactccca ccgcgtgctc caccgcgatc tcaagccgca gaacctgctg
    12001 ctcgatcgcc gcaacaacat cttgaagctc gccgactttg gattggcgag ggcgttcggc
    12061 atccctgtcc ggactttcac tcatgaggta cgatttcact cacaccctca cgacatgctg
    12121 tcggtctggt agtacgctga cttaaggtgt ctgcgttagt caatccgcag tagctgcgaa
    12181 attgccatga catgttgtta gcgtattggg aaaggaatgc agttacttgc tcatgaacgc
    12241 cacaaaaaat gctatcatcg tcgcctttgt cgcacagaag tttgtaactg ttcaattcgt
    12301 taggccagat gcatatgcgt ttcttcattt ttagagaatg gaacaaggtt ccagcctcta
    12361 ccaacatatg cgttccttca tggcgtactg gtaccattat ctgaattgct tgcacgcttt
    12421 tcatattgtg caaactgttt tgtaactgcc agtaacgcca ttcccgcgtg cttttgtgta
    12481 gtgcgcctta agattgttta cctttgccgt ttgcatatga cagagaaact gagcaaacat
    12541 tgaagctaat aatggacaca tataaatagg cttttattta tttatataaa attggaaagg
    12601 ccgttacgaa ggagagctct aggacaataa ccgaatttgt catctgcttg gtgatagtgc
    12661 agtacgagac atcagcattc ttgggtaatt taaaattatt gttgcctttg gattggtgat
    12721 agtgctgact ttggattggc aagggcattc accattcctg tcatgacttt tactcaagag
    12781 gtacatttta cagctggaca acatgttatt tgtctggtac gctgacttaa ggtatctgcc
    12841 tgagttaagc catggcagat gaaaaattgt cttaccatgt tagcatcctg gcaactgtta
    12901 caaaatgctt tcgtcgttgc cttagttgca caactgtttg taattgttca gtttgttagg
    12961 ccacatgcat atgtatttcg tcatatggcg tactgatacc actgtctgac tgtcttgcac
    13021 gcttttcata tttgtgcaat gactacttgt aactgccagt aacactattt gtgtgtgctt
    13081 ttctgtagta cgccttcaga ttgtttactt ttgtcatgtg cacacaacag agcaagtatt
    13141 gtcgtattga agctaaaaat ggaaagagaa acggaacaca cacttatgca tatacatatc
    13201 taaacaggcc tttgtataaa ctggaaatgc tgttaaggaa gttctaaaaa aatcactcat
    13261 ctgcttgatg atagtgcaac tgtggtgatc attgttgcct ttgttgcaga acaaattgta
    13321 attgccagta cgttaggcta cttgcatatg attttcttca catggcgtac cagtaccact
    13381 gcctgactca tttgcgcacc tttcatattc gtgcgaaggc tatttagtaa ctgtcggtaa
    13441 caccattccc gtgtactttt ctgtagtacg ccttaggatt ggttactttg tcctgtgcat
    13501 acgactatta ccatgatgtt ctacatcttc tcctttcctt tttagcttgt catcatttga
    13561 ttggaactga actttttatt aggtggtgac actttggtat agagcacctg aaattcttct
    13621 tggtgcaagg cattattcca cccctgttga cgtgtggtca gttggttgca ttttcgctga
    13681 aatggtgaac cagaagccac tttttcctgg tgattctgag attgatgagc tgtttaagat
    13741 tttcaggtct tatttacaag agttgttcaa gctttcttta gtctgttgca tgttgcagaa
    13801 aaatatctta tctgggttgt gcatcctctt ctgttcatgc agaattttgg gtactccaac
    13861 tgaagaaaca tggccaggcg ttgcttcatt acctgattac aagtcaactt tcccaaagtg
    13921 gccatctgtg gtaaataata aagtcctttt tattattgca aacagtgggg tagggttttg
    13981 agttgtgtgg atgaaaactt gtactgtgtt ctgctcggtt aatctgttac agataagttt
    14041 gggatctcct ttttgcttgt gtatgtgggt aattcaacat tacagtgata accatttttg
    14101 gctctaacac gaggttcatg ctgtaggatc ttgcaacagt ggtcccaaca cttgaaccgg
    14161 caggaatcga tcttctatct gtaagttaga ctcatgaatt ctttgcattt tctacttata
    14221 ttctccactt ttccttgctc cacaagatca ccttctactt tttccccatg ccattagttt
    14281 ttctaagtga atagatgaca tggccttctt tgtggattta tatgaaggct gaaaatctgt
    14341 ttgcatttga gtagcccaag gtttcatcca ctgggagaag agggaaatgg aaacctagcg
    14401 atatgtttgt accctttttt ttggtcatgt ctctatacac ttacaatatt gcattattga
    14461 ggctgcaacc tgcaaatgtt ttaacatgag gttaagccta atccgtgcac aaattccctc
    14521 ttttccctag catgtattgg ctatcttgga aacacctgca cttgtggggc tgcaagtgca
    14581 cctggattgt agcatttagg catctcttcc aatattggtt cagactcatg ttcccttcga
    14641 acatgtgcat ctaaatgcac aggggtcatt tttttgtcca ggtattgcaa tttgcctagt
    14701 ctaaggacag ttgtagcact atttacactg ggtaggggtc atttttgtac ctggaatctt
    14761 gaaattgcat tgctttttgt acaactgcca gtagtacatg attccctttc atgtactcta
    14821 cgacctgtgt tacaccaccg catgctgatt ttggtatatg tcaatgccgc agaacataat
    14881 cagactagac gattgcatta catatttgct cacgctagcc tttcatttca ctgcccccaa
    14941 attctgtacg attgtatcag tgtgcacgtt gacatctctg acttgacttc tccccaccgt
    15001 tgctcttgca gaagatgctg cggctagatc ccagcaagag aatcaatgcc cgcgccgcgc
    15061 tcgcgcacga gtacttcagg gacctcgagc acgcctacta gatgatggat gaaccattca
    15121 ttcccgtccc ttgccctgcc cctcttctgt aaattaaggt cgcaatgcct gggcccggcg
    15181 agtacccatt ttgtccgctg cgttaatcta tagtaaagac taagatggtg tgtgccttgc
    15241 tatcccgaca atgcaccttt ctttgatttt tggctgtgta gagaaatgag aacggtgatc
    15301 cggagatcga tccttgttcc acgggatccc tagctatgtc gtggtttcgc ccagttttgt
    15361 ctatctatct atatgtcgat gtcgacaccg gctggatggc cggatgccgg attccggtgg
    15421 aaagagagct tctctggatc aagttggtac acgggtatgc ttggctgtgt ctgctgtcac
    15481 cgtctgttag ccgatgcatg taatggtgtg tttctgatgc tcggtagcag cggtaagcaa
    15541 cgtggtcggt cgccatcaat gggatctgat ctgacgctgt gcccgttgat ccgtcgcctt
    15601 gagatcactg gttagcgatc gatctggtgc cgtcattttt gtaaccgaat tgacacgatc
    15661 tcgcctgatc ctgacatgaa tttgtctgtt gagaaatgcc attgttgggt acaccgtaca
    15721 cccgtgctct gctcacgcgc agacctcaca tgcgatgagg tgtggtgtgg acttggggtg
    15781 gtcgcagagt gagttcagtt catgtgcagt tgttggatat gcaatgcaaa gctgcagctg
    15841 ctgctgcagc atactttctc cgtccctaaa tatatattgt ccctaaatat atattgttgt
    15901 tgtgcatgtt acaagtttaa ctcgatttat agaaaatacg tgtaatattt gtatcatcaa
    15961 ataaatttat taaaaactag atctaaaaat ctttctaatg atactaatta tgtaccataa
    16021 atattaatat tttttaatat atatttagtc aaagttgttt tttcaaaaag tgaaacgacg
    16081 tgcagagggc cggccggatg ggctgagtgg tcactgcgac tgcgaattgg accgacccgg
    16141 accatggcac aggtgaaaca ggtgaacatc tttactagta gtagtacatg ttcctcaaaa
    16201 aaaaaaacac tagtagtact gcatcacatc gctttggttg ttggttgggc ttggtcaatt
    16261 tcgcatgaat tgcatgttag cagtacaaca aatcgcatgg cctggcctgg ttgtgttggg
    16321 tgttggtagc ggggcggaga cgatacaaga caaccaagta aaagcaggga cagcgacgca
    16381 gcatggcttc ttttgcaatt cgttacatgt acggtaatgg atggggtact aaactgctaa
    16441 ctgctaataa agcatcagct aattacattc cctagtccat accaaacttg accagagtta
    16501 cccatttctt ttacaccagc gcaattgtac agaaatttca catgacttag gctgtgttta
    16561 gttcccatgg aatgcaaaat acaaaaagct aactactttg gaatgatgaa atgcaaaatg
    16621 ctaaaatttt tatgggtgtg tttagttcca taaaaatacc aatttttcct agggtgggtg
    16681 agggcttttt gacttttggg tttttttcct cttgaggtca aaatccaaaa tgaagaatgg
    16741 ataccttttt gctaaaaatt ttgcatggtg tttaattcca ttttgcaaaa tgatggacca
    16801 aaacccaaaa atttttgggt gaaatggaaa actaaacaca ccctaaggct gtgtttagtt
    16861 ccccatagaa tgcaaaatgt aaaatgctaa ctactttgga acgatgaaat acaaaatgcc
    16921 aaaattttca tgggtgtgtt tagttccatc caaaatgcca aaattttcat gagatgggtg
    16981 agagcttttt ggttttttta gctttttttt ggcctcttga ggccaaaatc taaaatagag
    17041 aatgaatacc tttttaccaa aaattttaca tggtatttag ttacattttg caaaaataat
    17101 gggctaaaac ctaaaatttt ttaggtaaaa tggggaacta aacacaccct taatttattt
    17161 ttacgggaga aacacagtca acacgaaaaa tcgaaatcaa ctcccgtaat aaaaagcaaa
    17221 aagaagaaaa aggagcttaa aatcaaatcg aatccgctgc gcaggcggcc ccaccagtca
    17281 gaagcgaaca agtaccaggc tgacgccgtc acaggtcaca cgtctttact agagagagag
    17341 acggggagag ccaatcctcc cttcccatcc cgaccgccgc cccacctcct ccgcggccgc
    17401 ctcgcagtcg ccgcgattcc acccgccccc gactccgatc acaggggcat ccaactcact
    17461 tcctccgcca gctcccgctc ttccttcctc tcccggagct tctgcgttgg gggagaggcg
    17521 gtggcgccca aaccggcgtc gtcgtcgtcg acgccgctgc cagccgccat ggaggcgtac
    17581 aagctctggg tgcgcaggaa cagggacctc gtccgctccc tcgagtccct cgccaacgta
    17641 atccccccga tcccgcttcc cgctctgctt ccactccgtt ataaccattt tctgctctcc
    17701 gttggtcctg taagctttag tccgcgcgta tctcgtcgat tcgggggatg atgtgctcgc
    17761 ttcgggttcg ttgaacttga atcgcgcggt cccgtggttg gtcgctggct acttggttgg
    17821 ggcgtacgcg aattcatgtg attccgctcg tccttgcgat tctatatgcc ctgttcctca
    17881 ccacggatga gtactgattc cgcgtttcgt tggcaaattt ctcttggctc agctctacgt
    17941 tgctggtgct tgccttgggg ttgccgattt tgtaccgcag ctgctttagc taatcgatac
    18001 gaggcatagg agctgccact ttgcttatgc ttgcttcaac tcttttcagg ggctgacatg
    18061 gatactcccc gagcgcttcg ccaactccga gatcgcgccg gaagcaggtg ctctcaatgg
    18121 tccttccttc agtttggagt aacatttagt tccactctgt gacttttgct atctgtggtc
    18181 atgtatatgt ttactgtctc atagatttgg attttgagct gtatcagtgc cttatctttg
    18241 tcaattcaag cctttaagtg tcatcaaact gtgtgaactg gtaatgatat ggaaaatagg
    18301 agctgcaatt gccatgctgc aaatatattg tgagctgcta gaagtagaac atactgaaat
    18361 agttatgatt taagaggcat aggtcgtata tcttgtgagc attacctagt gactgttaag
    18421 atatatggat gcccagattt caaattatgg gcgggtaaag ttgacgagtg catgtctcat
    18481 gtggtttcac gtgtcaaagc cccccttttc ttccataatg attaataagt gacgttatat
    18541 agacaacaca tggcgacaaa aaaattgacg actgtctttc atattgggtc atgtttccta
    18601 tttgggtgtt accgttactg taactgcttt cctaggtttc tgcgatctca tgtctgcatt
    18661 cacggagtga tacatgagtt tttgtgctca acaccaaaat gtgatcaata tcgttgtgcc
    18721 caaataatct gtttgttaca ctaccaccca agtgcaaaat gcaaaccatc ttttcctgtt
    18781 tgatattgct ctaaaatcac caaggttcca gaagtccagt gtgctaccat ggtcgctatg
    18841 tgagttatct cataaaggaa ataaatgtta tttgctacta tcaggccatt tatttctatg
    18901 gaactcattt agtcatatac agctgcctag ggtggcctta gcactagact gattaagctt
    18961 atctcagaat ttgtgttcac atttttgtcc tggcatcttc cattgttacc taaaaagaat
    19021 cactggtgtt gtatgttcat tttgtgctat tcgatgtaag agaccattgg aatatgtttc
    19081 actgaccagt ctgaataagc cttagtgttt aatatttctg tattgagcat gcatgttttg
    19141 cttctaaggt attatgtatc agggaatcaa attctttgct attactaaaa atatataatt
    19201 gcatactgtt tgcacaacta ttttgatact aatctcataa tctgacataa gatattgcag
    19261 agcttagctc ttcaatttac tataatcttg tctaggtgac tcaatcccct atgcaataaa
    19321 tcaatatttt gttcagtttg taacatatgc atactgatat gataatgttt tcaagaatca
    19381 agacattgtt tacagttttg attgagagaa gtctgttttg agtgctatat gcttgattta
    19441 ttcacattaa ctcacacttc attgtccgaa cagtatatgc actactgggt gttgtgagtt
    19501 ctgtcaatca gcacataatt gatgcgccca ctgagaatca ctcatttgcc tccaaagagc
    19561 aatctatccc atggggtctt gttgtctctg tactaaagga tgtggaggcg gttgttgagg
    19621 ttgctgccca gcactttgtt ggcgatgatc gcaagtggag ctttcttgct gttatggaag
    19681 cagtgaagta agacacttac ctttttttcg gttagttgca tatctattgg cgttgttcat
    19741 agtcagacaa aatgataaca attatgcaat atttcagagc aggtgtcagg ttagctgctt
    19801 ttcgggagag tggatacaag atgctcttac aaggagggga ggtggcaaat gaagaagagg
    19861 tgactgttct tgaaaataat tatggagtaa atggtaatgg agttccagcc atctatccga
    19921 tggatggaca tgccggaaat ggtcacaaag ctatgaccaa gggtctggat ggaaaaaatg
    19981 gatttgtatc taagagtctt gagaaaagag cagttgctgc tttgaacaaa tttggcgaga
    20041 atgcaaagat gatgtctgat cctatgtgga tgcggaggct ccaacctact cctgagccaa
    20101 ctggtaatag attttaaact acgaagaagt cccattttcg gcctctaact atcatgatag
    20161 tctgattttg gtccccaaac tcaaaatacc acacaacttg gtccttcagc tgttttgaag
    20221 ctggtttttg ctgccatggc gatggttttg ccatgtagga tgtgtttata ttatgcacga
    20281 ctgtccagca ctagattgag ggaaaaaaaa aagagaacca aatttaatga tgaaaccatc
    20341 ctacgtggta ttctgaccta ctgctggcat ggtgaaacta tcaccacgtt agcaaaaaaa
    20401 ccagcttcaa aacagctgaa gggccaaaaa caaacggttt gaatagtcaa agggccaaaa
    20461 ctgcctgata tttgagtttg gggccaaaat tggaccctcg tgatggttca agggccaata
    20521 attgacttcc atctatttaa ttatcttgat atttcttcat gtacttctgg gtctatggtt
    20581 tttcttctct tatagcgcgt taaaccttct gtgttgtact gttgtgcagt gatggtggcc
    20641 gagaagccaa ctttggcaag tatttggtct gctaaagggg gtactgggcg cttatttgtt
    20701 ttaggggagg ttgttcacat attcaggcca cttgtgtatg tacttctgat cagaaagttt
    20761 ggaatcaaat catggacccc atggttagtg tcgctagctg tggaactcgc aagtctaggc
    20821 atccattccc atgtgacgga tctgagtcac agattaggga aagtgcatca gctcagttct
    20881 gctgagaggg atgaggcaag ttgatttcag ttctctaact agttaaattt tgtttcattt
    20941 tatcctcact gatgctgaac tagctattct ctggtttgat tccatcagtt gaaaaggcga
    21001 aagatgatgt gggccctcta cttgatgaga gatcctttct ttgccagtta caccaagtaa
    21061 tgaacaccct gtcctaagat gatcaatgct caattgaaat tgaaccttgt atgctcatgc
    21121 ctgcattgtg tcctgacagg cgtcatctcc agaaggccga acaggtgctg aatccggtgc
    21181 cattaattgg ctttcttaca ggtatgtatg ccttgttcac gcctttgatg tttttgtgtt
    21241 ccatgaaagc acattgcaat aagctctttg ttgcttgatt cattgcaggg aaacttatag
    21301 agctactgga gggtgttcag acaagatata catacacatc aggttcatag ggatggccag
    21361 tccgagtttg ctgcttgcct ctcgatttgc cctggaggac cggtgctttg tgcgagttgg
    21421 ttgatgggtt ctgttttaat ggctgagaac tttgcccaaa cctgaaacat gtactgccgt
    21481 ttctttgcca aatgtggcat ccttgtcttg tggatgcgaa gctgcagcgc agccacttcg
    21541 tgtatgacgg cagatgagag aattcagaat ctaagtatat agtaaatact ggtttaacgc
    21601 taagaattgg cgtatttacc atttatcatg aatgacttat tgccttgttg gaaaatagta
    21661 tgtctacaat aaatttgttc ttcaacagcg aaatttggat gccagtaagc ttagaggtaa
    21721 gtgatggtaa cactgattta tgcctgaatc agatcaggat attgaaagtt tatctgtatt
    21781 gctcattgtt aaaatgggat taggtagatc aagacccatc caaatgggca ttataaatac
    21841 cggagaacac aaggtttgtt tcaattatca ctgaaaaact tcgcatttta ccccaaaggc
    21901 aaccgcaatt tggcagtggg caaagcgaag gatcaacaat ccttgcaagg tgggtttttt
    21961 tttttgacgc aaggtcggct ccatttccat tctataataa tggaaataca attgttcaga
    22021 agtaatagaa gaaaggagaa tgaacacacg attcagccac atctggacca ggcttctgat
    22081 tcaaggaccg agccagatgt aaggcgaccg tgtacaggag aatgaacaca cgattcagcc
    22141 acatccaact caaacaacag ctcgaaaatg atccactact ttattacaca tatgtagttt
    22201 ccatcagaaa gcgcacaaaa ctttagacgc ccttcaagct tcagtggtgt ggcctaagga
    22261 tgcaagcggg cccgtctacg ggcgcccacc atgttcctgc aacaactgta tgcaaggatt
    22321 ggtcattctg caggagcccg caatcatgga gtagctgcct gcgtttaact gccagacttt
    22381 gcaggagaag ctaagcagga tacgcagacg ccgcaggagc ccgctggctc gcatcccgca
    22441 agctcggcga gaggaccctg ctacatagga agcatcctgc cgaggccggc gcccacgacg
    22501 agggtctatc cggggcgctg ctcgctgtct gcatgctgcg cgtgatgctg acgctccggc
    22561 cgcgccgccg ccgcaccatg tccagcgtcg cacaccacgc catagcggct ggatgcgcag
    22621 gagatgcaag cgatgtggac agttgcaggc tttgcaggtt cacctgcata cgtccagtgg
    22681 gctttgcaga ctaatctctt tatgcccgag cccgttcccc cgattctccc caaatttcac
    22741 tatgcaaaaa gaagatttcc tgtcacatca aaatgtcggc aaatgcatgg agtactaaat
    22801 gttgatgaaa tcaaaaacta attgcacagt tttgttgtac tttgcgagat gaacatttta
    22861 agcctagtta atcaaaattt ggataatttt taccaaatac aaacgaaatg ctacaggaat
    22921 tctgatacag tgtttttctt cccgattcac cgaactaaac gaggcccgaa acacaaatgg
    22981 caggtgtctg catggtccac taagactttt ttagcaggcg ggcctagcag cctgctagca
    23041 agtgcatccc tagtgtggcc ccggtcctgg caaccccgca cacacaccac cttcttcgtc
    23101 ctctttggtg cttccttcag ctgcaccttc tgtctttccg ggccgagcat tatgtccaga
    23161 ccttcaatta acatctctct agccacctcc aggtatatcc ctgtccagta tcaattaaaa
    23221 gcacatgcat aacacaacac ttcagcagga tgtttaatca ttttattttc aaagcaagct
    23281 ttatttcttg ttttccatat tgcccagcaa actgcagcaa tgccaaacac atggaatttg
    23341 ggagcatttg gggaaccatt tcttaggagg tgtttggttt ggggtgttaa agtttaacaa
    23401 acactgtagc attttcgtct tatttgaaaa aaagtttcta atcttagact aattaggctt
    23461 aatagattcg tctcgtaaat tactcctaat ctgtgtcgac atgcatgcaa ttagtctaca
    23521 tttagtactc catgcatttg agggaacatt gatgtgatgg aagttaaact ttaacaaaaa
    23581 ctaaccaaac tcgcccttag tccaagccca agcctgtttc acattgacag gtctgtcaga
    23641 tgccccaagt ctgaaagcaa taatggacca aataacttta gctaccaggc aagagaagaa
    23701 gaaatgagaa gaactttcct cctgatcacg gaaataacac gagggatctc ccttccattt
    23761 ccttttgagc atattgtctg tggttgaaat atcaatcctt gcaacatgca cctagtttac
    23821 tcatgcactt gcaacacgct tccgatttac agtattatgt actgctagtt ttacacgcat
    23881 ggcaagatgg tatcacaagc gtgccatggt tctgttcagg gctagctcat cgcttgctgc
    23941 agcactcttg gccttgccgt gagattcact tctcgactgc gagcttaagt aggagagaga
    24001 ctgcagccat gagacgagta ccggcttccg agtgacatcg tcagactccg cgacatgggc
    24061 gtgcatgtca tcgagcagca caccctggcc ttcctttggt agcagggtta caaattctgc
    24121 cagctccttc agcaggtaag ggaatgactg caaagagaag aaaatcattg aacaccttgg
    24181 ttttcagagt catcggaaaa caagccaagt taggctccat catcaccaac attcagccag
    24241 cacatgagaa atatttgaca cttctcttag ctactttagt atgaattatt gtcactttta
    24301 tgtttctaac attctgcaaa ctgacaaagc atacccccaa tgcaacaatt gagctagctt
    24361 tcagttttac agaactgttg ctctaaaact agaactacat gagaggaaaa gaacatgacc
    24421 atattccaac ctgaatatcc acaaggaaga ttagtctcag cagcagatcc aacattttct
    24481 tacacggatc tgtgctctct tcccatgatc tccacaagga tttgttctga acctttgcaa
    24541 cttcgcagag atctttagcc ttgacaacaa ggctatggat acaaaaaaga atggcagcgc
    24601 tgcctgcagg aagatgtcgt acaagtgctg caactcctga tgctaatcca tcaaatgggg
    24661 ttaccccagg ataagcctat taatgaacaa agtcagaaat gagtcatctt ccagttcaaa
    24721 atcaaataag gaaaatgatg ccgaatgaac tacctccaaa gatctcttga tgtagtaaaa
    24781 ggtaagttgc tctttcaaag ctgctcgatc atcctgatca gtatcacttc cagatgacga
    24841 gaacgatacc atcacagagt gtgaagcact tgtaactttc tcatttgaat gctgtagata
    24901 tcttttgcat gctaagggtc acatcatttt tagtactgaa agtcttgata aataaattaa
    24961 aagtaattaa taagaagaca aaacaataga atggaatgca aaaaaggata caagaacata
    25021 attgaagcca ctttatcctg aatcatatga actggaatga ggccaacaca agttggcaca
    25081 acccgcaagt aaaacagtat gcgtgatgtc tgaacctcat ctctatgcca gatatatgtt
    25141 gttccagcca aggctggtaa atctgcaaca caccaaacat gaatcttaat caacaattgc
    25201 tagcacatcc tagtagcaat cacaacatag cagcaagaga agtgtcattg aactaacctg
    25261 gtttacttgt caattcagta tatgaaggca ttgactcaat gaacaaagca gtagctgctg
    25321 cattctcttg aatgtcaagc acagcactcc ggactgcctc agtgtactca ggaagacgca
    25381 atcgcctaag atgttccaca caagagaacg ccaccaagat tctagcagca acctcgggtt
    25441 ggaacccctc ggaggactta gcatttagcc tgtgtttagt gacctccgct gcaaagacta
    25501 caaccacaag aaatgaggcc tcagcaatct tgtcaatcgc tgtaatcaag tcatcctgct
    25561 tcccccggtg cagcagcact gctgcacgaa gatggcaata aatttcctgt gcatactccc
    25621 acacacaagt ttcgacaaag cttttagcct tgtcatttgc atatgaatac tggttgcaaa
    25681 gaaccccagt caccgggcct gcctctttga aaagaatgct atcaaggtgt tgattgacct
    25741 gagccttgac aaactcgttc ccttctgcct tttcaactga catcctgagc aaatcaggaa
    25801 gcggaaggag ctccttcagc aatcccatac agacacaccg taacacagac tcgtgaaatg
    25861 tgatctgccc acaccgtgtc agtcccaatg cgacacactg aacaaggata cgctgatcat
    25921 cagcaggcct cccttctaaa acagcccgct cagctacaaa ctgaattgtc cgctcaggag
    25981 cctccttcag ccgtggatca aagtccagcc ggtatctcgc cgaagcaacc ctcaatgccc
    26041 gcaatccgcc acaggttgcc atcaccactg gaaacagcac ataatcctcg ccctcacact
    26101 tctccggtga aatcagctca aagagcacct gaaccttccg catcttcctc gcctcgacga
    26161 accccatcac cagccactcc atcagcttaa gcacccgaac accagtagcc agattcccag
    26221 tcctcccaca aatcctaagc aaggacacta gaatccttct gaactgcacc tcatcagcag
    26281 ccgccagcgc gtaaccaacc cctgtaagcg cgaggtggtc gagatcatcg atgctctgat
    26341 cgccccgctc cacatcttca aggacgcgtc tcacagccac aacagggtca tcgtcatggc
    26401 cactggcaga ctcaccgctg ccgggattat tcgcggtgga agcgggtttc ccgaagctgg
    26461 catggccggg gagatccttg gcggaggcgc gggcgccgag gaggaggagg cgaggtgcga
    26521 aggggaggga ggctgggacg gaggcggcga cgaggtgcgg ggccgcggcg agcagcgggg
    26581 cgacgaggcg ggggtgtagc gggaggagcg ggagcaggag cgaggcgtgc gcggaggaga
    26641 ggcggagcgc gcggcggtgg tggtggagcg tctctagcgc ggcgagggcg tcggtggggg
    26701 aggtggaagc gtcgcggagg cgcgaccacg cggtgaggat ggtggtgggg gagggcggcg
    26761 gcggaggggg agggggtggc gctaaagtcg cggactcgag gtggtcggcg aggtgcaccg
    26821 ccgccgccgc cgcggccggt cccggtcgcg acggagctgt cgtcatgctg gggtggggac
    26881 ttgagagttt gagacttgtg tgatgaagac tccgacgaga ccgtattcgt gtccactttg
    26941 gaaggataag tttgaatttt gaaatcttag tggatttttg caactgcgtt cagaaatgtc
    27001 ttcttgttcc gaattataat tcgttttagt tttgttctaa attaaacttg tctaatttta
    27061 actaaatcta cagaagagca tagatttaac aagcataaag ctaaataaat ctataactaa
    27121 gttatacatg atctaatatg tataaaattt ttaatatagt tcgagcatat aataattagt
    27181 ccaccataaa aatttcatca ctattagacc atggaagctg cagttataaa ttattctaat
    27241 taattacaga aaaacgtaga tctaaagcta caataaaaac tttgcactaa acaatactat
    27301 attatatatt gactgtgtag acctactcat gtggagttca acaaaattaa atttttcatt
    27361 taatgatttt tctgtgtttt actatgattt ttcaaagatt cagtgaaaat aaataaataa
    27421 aagacaaaac cactatcact atagcaaaat cattgtctaa aaccgtctat gggttatttg
    27481 accgattttg gaaagtacag ggggtaaaaa atcgggtttt ataatttggg agtgaagtag
    27541 tccaccataa atagttaaga gggttatata gatttttttt ccaaaaagat attgacatct
    27601 atgatttctg taagctaggt caaaactaga gaggttcgat gttgctaaaa caaattataa
    27661 tttagataga agaaggttat atggcacaaa gtatcgttga tggttaaaac ttgctaccgg
    27721 tgactttaat tttgtcaaca ttctaccgat ataaagagca tcatcaagag tcgtttgtaa
    27781 attcactctc caaattatca tttgaagagt gatttaaata aaaaaatttt atttatattt
    27841 tcacctccaa caattttaat atatcctatg cgcactctaa aaagtcaatc tcgctctcta
    27901 gctttatcta gcaagaaata caaaatggtg gatagcaata tttggagatt tgaataaaca
    27961 tattggagga catttttcac caaaatctct attcctataa aaaaaggcta tataaaggtt
    28021 cttggagttg ctctaagaat ttcaaaaaca ctgttataat aataatatat catagttcaa
    28081 caggtgccaa caagtagtag cgtactattt cgttttgaaa ttgtcatttt ggaattaagt
    28141 ttgtgcggga cattggtact accatcgttc caaaataact aatgttcaga gtttatccta
    28201 actcaaatca ttcatttatg gtactataat ataaaaatat atttaataat aaaactaata
    28261 atacttattt gatactatta taaacaattt gtatattttt catttaaatt taatgaaatt
    28321 ttaaatagtt tgagttttag gacaaatcta aaacattaat tattttgcga tacagaatat
    28381 ttcacctaag ttgtacctta agtttgtttc cacaccatat atatatcact ttaattcaac
    28441 tagatatgag catccacata taattctctg caagaagcat gagaccaacc gaacacgaat
    28501 ttccatcgaa attagcatag accttgttta gttacccctc taaaacttta tatccagtca
    28561 tatcggatgt ttggacacat gtatagagta ttaaatgtag actaaaaaat aactaattgt
    28621 acggattgcg tgtattttac gagacgaatt ttttgagcct aattaggccg ttataagaca
    28681 atgtcgtgct acagtaaaca tgtgctaatg atagattaat tagtcttaat aaattcgtct
    28741 cacagtttat ggacaagttc tataattatt tttttattaa catctgaata ccctttctaa
    28801 tatcacataa aacatccgac gtgacgttct aaaactttac gcctctaaaa actaaataag
    28861 cccgtaagta ttactaaagt attcagcaac ccacacgtgt tcctagggtt ccattcaagg
    28921 atgaaaacgg acgggatgaa tcccgtttcg tccgcaaccg tataccgttt tttcccgacc
    28981 gttttcgttt tttccaggat aaacggaaac gggaccgaaa acgggacggc ataaacggaa
    29041 acgggaccga aaacggtaga gcatttgtcc gtccgtattt gcggtatccc gtttttaacc
    29101 gggatatccc gtttttcgtc ccgtttttct tcaaaacggg atgggcctgt tgggcctgtt
    29161 tttttttttt gaggagatgt tgggcctgtt gggccatgaa agcacatgcc cgagttgctt
    29221 ttatttttct tttcatctgt gtggacatgt cacatatata ttaaagtcat catttttttt
    29281 gttttggtag agtgcacagc agtgtgatag tgtccgccct ttcatcatct gataattcat
    29341 tcatctacga gcgtatttat gtgtgggcac tgggcaatat atattttata tgcggcatac
    29401 atgttccggc ttaagtttcc gcttaccgtt cgtttccgtc tattttccga ccgtatttac
    29461 ccgttttcgt attaccgttt atcccgctac cgttttcgtt tccggctgtc cggctcccgc
    29521 tcccgtttcc gtttaaaaat ataaaaataa aaacggtaga gcaattttcc gttcgtttcc
    29581 gtccgctttc atcaccagtt ccattcatcc acccggccag ccccatctca cgccgccacc
    29641 tcgcctggcg cctgcgcacc tccacttcta ttgaacacct cactccatcc caacctcggg
    29701 catcaccgtg acaccgtccc accccagcca aaaaatccca aatcccttcc ctccgccgtc
    29761 gatcgggcct ccatggccgc caagcgccgc gcccggcggc caagatccga cgattccaag
    29821 gagttgggcc gcaacggtgg ctatgagggt tccgacgagg aggtggagga gagcggcaag
    29881 tccggcgaga ccgccatgtc cgccgagccc aaggagatgc ggctgaagca agctgagcaa
    29941 ccctcgccgc cgtccacgaa ggatgctggg gcccagggct ccggcgaggc ctctccagcg
    30001 aggagcgcgc cgcgcggtgg ggtcgcgttg aagaccagta cgacctcgaa gcttgccaag
    30061 accccccctc cggcgtcgca ggaggaggat gaggcggggg actctggtga tgcgtcaccg
    30121 gcgagggacc cgctgcccga cgacaccgcc gacgccggcc acaacaagag ggccgtgact
    30181 ccaaagcggg gtccaccacc gcagcaggga gaagagcgcc cggagactgt cgctgcttcg
    30241 gccctacagc agcttagaaa ggcgttgacc aagccgacgt cgccgccctc ctcgtctgac
    30301 atcgcccaag aagacgagca ccatggcagg gagatggcag agcaagagca gagcaacacc
    30361 tcaccgtcac aggacgagca cagagcccgt aaagagttgc agcaggagaa gaagatcaca
    30421 gagcaagatc atgccggtga cacttcaccc ccacatgaca aggacaagga caaggacatg
    30481 cacaagccac gcagtgccgg tgacacttca cccccacatg acaaggacaa ggacatgcac
    30541 aagccacgca gttctgagac ggagaagaag ccagcagttg agcgatcatg gtcctatgat
    30601 gacgagctca agattctcaa tgctttggtc gtgcacgccc agtcccacaa cggtgctttg
    30661 cctgactcat cgcacctttt ggccaatctc acctttgaca aaattgatgc caccgaggac
    30721 aagctcactg acaagatccg caagcttagg agaaggtact gcaggttcct tttacaaggc
    30781 tgcccatccg atgaccttag tcgtcggctg tttaagctat ctgaaatcct ctggggccaa
    30841 gctgatgaag atgagcgggt tgagccaaca tgtagggact tcagtgtact atcaaaattg
    30901 tatcctcacc tggccaaaga agtcaaagcg tatgccgaaa cgcacagctc gggggactta
    30961 atcatggcaa tgttcatgac cattggtgat gagaaggccc gcgatcttga tgctaagtgc
    31021 aagaagcaac atattgaagc attcaagttg gagttgggcc aggcaagcct aaccaacgaa
    31081 ttgctctctg ccctttcaag tctgaccacc aagatcacag atccctctca ggccacacca
    31141 tgcaagagga gggccgagaa gctggaagag ccccttgatg agcagtatct aaggcgcagc
    31201 aagagagttg cagggaagac tgaaggcttc aaggacaagc caaatgcaga tgacgtcttc
    31261 aacccaaagc cactggcaat ggtcccaact ctgaactccc cagcccccca cctcaccaag
    31321 gacattgggg acggtattgc cactgccttc ctgcagattc atcctaggga cgtctggcgc
    31381 actgatcaag ctggacaccg atgaaggaaa ggcctaaaag ttggcggcac cttgaactaa
    31441 tcctagggat agtttaattt cagtttgaac acttttggtt catgtcacct gtctctctag
    31501 ctttgtctgc gagcaagcat gttctatcaa aagagaaaca gcagcttgtt ggcaaagagg
    31561 caggtcccag ggttcagaaa aaaatgggct gttcatatgg aacagccgtg ggtatttgtt
    31621 acgaattcat cacgtatatc tatgctcagt tatccaacga ataaaatttc taactactgg
    31681 tcttgaattt atacaacaat ttcattcatt tggtgattag gcatacacat aggagtatat
    31741 tgtcttcctt actgattttg tttttttttc cagtttcaag atactccaat gaaattaata
    31801 ttctttccat tccgattagt atgaaattgc tgttccataa gcggtgtgca catgcatgca
    31861 cattagttaa gttatcataa acaaaatgtc agttgtcttg tttgacttcc aattttactt
    31921 ttttaaaaaa aaaatcacgt ctcggccatt tttttaaaat gaaatctcgg ccaatttttt
    31981 ttctgtatga tttgtttaga tttttttatt attattgaaa gaacatgaga gacgaggccc
    32041 ctactgaaaa acaaacaggt tacagaagtg caaaacaagg ttaagagaaa aaacagagaa
    32101 agtaagcaag attacacaag attctctagc catgaagaaa tcagaggcaa aaaaacgttt
    32161 ttttttgccc taagaataac tagagcaaac atggacttga agataaactt gcagcgagcg
    32221 agtgcttctc ctttgaagat gaagttgttt ctgatcaacc aaatgctcca acataataat
    32281 aaaataaaat gataagctcc acaatgagct gagagctgaa ccttgaggct ttccaaaact
    32341 tcaaagggtg aggagtcttt aggcaaacac aacttgtgtg cagattattg atttagtact
    32401 cgttgcctct ctgtagaagc taaaaccaaa tcttcagatg tcaccaaacg aaccaaacga
    32461 cctgttccta catagttccc ttctttctaa caaacattta cctccttgtt attcgcccgt
    32521 gttctagtat cagactcaat acaactgttc gtattttcaa ctatttattc agttatttag
    32581 tgctaggcat ctatgacgac tttgctatcc aagatgtgcc aacgcgtggc ggtgtgcatg
    32641 tgtaattgtg tctactctat cttacttgaa aaaaatatca taaaaaatta catatttttg
    32701 gaaaatatca taagaaatta catatttttg gatacctttt gttacgatcg gcgatagtat
    32761 ttgtggaatt taggtagtag catacagaat ccaatatagc agtaaaggat tggagcaggg
    32821 gaagggaaag cagagcacaa ggttgggttt agaggaaggc ttgcaggagg ggcaaggcag
    32881 tagttgtaat gttcctcccc tctctcctca cgcctgttac aataagtaga ctaagacgag
    32941 caggtgactc aagctgggac ccagtcttcg gccgtcacac gcgtgctccg cgtccttggc
    33001 ctggtggacc tcctggctgg ctgcggccca ggcccaagag ttgcttcctc atcttctgtt
    33061 gtcgggtgct ggatagtagg cgccgtaata tcccctcccc cttgcgcgcc aggccggctc
    33121 cagatggagg cgcgaggaaa ctgctgcttg aggaactcca aatcttccca ggtagacaat
    33181 gaggaagaca gattggacca tttgatcaaa ccttgggtga tagagtgcgt acccttgaaa
    33241 atggtacggg tccgcagaat cttttccggc acgctccaga gtacagcttc agatggaaga
    33301 tgagctgtga ctgagtggtg agcacccact gatttcttca actgcgaaac atggaaaatt
    33361 ggatggacag atgaagaaac cggaagctcc aaccgataag cgacagttcc cacccgagcc
    33421 agaacacgat agggcccaaa gaacttgaaa gaaagcttct gattagtgcg ctgtgccaaa
    33481 gatgactgaa tgtatggctg aattttgacg aaaaccaagt cacccatttg aaactggcgt
    33541 tcggagcggt gctcatctgc ttggcgcttc atgcgctgct tagcgcgatt gagatgatgg
    33601 cgaatgacat ctgtcataag agctctgtca gacaaccagg aagccaaatc agtgattgga
    33661 gtatcaggac cagtggcaat gccgaactgt cgaggaggat aaccatatag gacttcaaag
    33721 ggagaccacc ccagtgctga atgccagtta gtattatacc agaactcggc ttggtccaga
    33781 tatgtacgcc attgcctggg acaagcatgt gcaaaacagc ggagaaaggt ctcgacacac
    33841 tgattaactc gctccgtttg cccatccgat tgtgggtgat aagctgtgct catccggagt
    33901 tctaccccag ccaacttaaa aagctctcgc caaaagtgac tagtgaaaat tttatctcga
    33961 tccgagacaa tagcttgtgg tagaccatga agcttataga tatgagacat gaatacctgg
    34021 gcaactgatg cagcactgaa gggatgcttg agcggtagaa agtgggaata ctttgagaaa
    34081 aggtcgaccg ccaccaagat gcaattgaac ccaccagaaa ccggcaaccc ttcaatgaaa
    34141 tccatggaga ccactgccca agcacgatca ggcaccgata acggctgcag gagaccaggc
    34201 aacttggatc gatcgggctt cgcttgctga cacacaacac aggcagaaac aaatgactgg
    34261 accgctgttt tcatgccgtg ccacgcaaac atttgcttca gacgcctgta agtgacggca
    34321 atgccagaat gtccaccaat aggtgaggca tggactgcag cgatgagctt ctgatgtaaa
    34381 acggtatcct gtccgaccca aacacggttc atgtaacgca gcagaccatc acgcagagtg
    34441 aaatgaggca ctgcagtcga tggggtggag agcttggtga gcaattcttg tgaatgcgca
    34501 tcgtgaacat aggaagccag tacttcatct aaccattgtg gttgacagac agaaacagct
    34561 gcaacgtgag cactggggca acgagacaaa gcatcagctg ctccattatc tgaaccctta
    34621 cgataaacga ttttgtactg gaggccaacc agtttggcaa acactttctg ttgccatggg
    34681 gtgtgaagtc gttgctcagt gagctgcaca aggctgcggt gatccgtgat gatttggaat
    34741 tcagcatgtt gtagatagct gcgccactgc tcgagggcca acaaaattgc catatactct
    34801 tttttgtaag tagagagtcc cacggaacgc ggacccagag ccttgctgag aaatgccaat
    34861 ggatgaccac cctgcgtcaa cacagcgcca atgtgaaagt cctatgtttg gtgttgtaat
    34921 tagtgacaat gcctaagtac taatcctatg cctaagttgt atgtagcata tgaggattag
    34981 tacattctaa ggttggtggc aagatggaca tggtgatcat gatggccaca cttggatttg
    35041 gatgcaaccc tacgtgatca aggcaaaggt atatgcttaa gggttgtatt ttagtaacca
    35101 agacacctag tgggtgtggt tacattatag gatagatacc cgtactataa agtggggaat
    35161 gacgcggcta ttgaactcct aagtgcctct agatgtgcat ttcatgatca tatgcatttg
    35221 gatagaacta atatcgcctc gaaaaatgat tgtgaaaatg ctaacacact cacacttgac
    35281 gaagatcact tggtggtgtt agcacgtttg cgtaggcggt ggagtttgag cggtagagag
    35341 ggtttgggat cctctctccc tcccgccgag cttgcgaggc gggattcagg cgttttcgag
    35401 gagttgaaac gaattttttc cactacgccg aaagtccgga aaagaaacgg aggcgaacag
    35461 aggtcacaga ggtgaccgga cgctaaaccg gacgcggtcc ttgcatgacc ggacgcgtcc
    35521 ggtcagtgtt cagtgtctgc gcgtttttca gttcgatgat cggacgcgag gcgcgtccgg
    35581 tcactgatga tcggacgcgt ccggtcgttc agggagctta ctggactcta accggacgct
    35641 ggcactgtcg cgtccggtca tgtttcttca gcgcgtccgg tcactgtttc gttgagcgct
    35701 gctcaggcga ccagcgcgtc cggtcattct cgggaccagc gcgtccgatc attcgcagcg
    35761 cgtccggtct gcgcgtcaag cacgtccggt cgttgctttg caactagccg ttgtgcgacc
    35821 ggtgcgtccg gtcatttgga ccagcgcatc cggtcagtac ttcacgagtt agcccttggg
    35881 cgaccggcgc atccggtcag ttggaccagc gcgtccggtc agcacgattt cggctgttta
    35941 agtttctaac ggctatattc gaaggggtac gtctatatat acttgttggc cggctcaagg
    36001 ctctctctct cgaacatttg acatacttgt gagcactttg agctaagcaa ctcccctccc
    36061 actcatctct cttgcttctt tgcaaattcg aagtgagatt gagtgatcca agtgcatttg
    36121 tattgtgaga ttgcatctag ttagcacttg gtggttgatt tgctgtggga ttcttatttc
    36181 tcttggtggt tgccgccacc tagacggctt ggagcagctt ggaggcgttg gcaagagttg
    36241 gtgattgttc ttggccacct ccggtgtttg tgaggggttt gtgcctacct cggcgaagcg
    36301 ccaaaggcaa cattagtaaa ttgctcgtgt cattgcaacc ttttgccgtt tggtaggttc
    36361 ttgtggcgcc ttttgagagg ctcggtgtga ggccgattag ccaccgaacc acgtggtgaa
    36421 gagggacaca acgggaacta gcgtgccggc aagcacgtga acctcgggat aaatcttcgt
    36481 gtcatcattc ttattgtgtt tgatcgatcc cggtggttgt atattgtggt attcatctct
    36541 tgatcatatt gattggttgg ctcaatactt cgcccctcgg tgatatcctc ctaactctct
    36601 cttgtattaa tttcttagtt accttgctag cttgttagtg taactcttag cttgtgtagc
    36661 tagctagctt tagttgtagt taaattgtgc ggtttgactt gtgcggttga gtgtaattac
    36721 tagaattgtg aattggttag gtggcttgta aacaccccgt aggctaagca aaactcgcat
    36781 ctcgctattt gttatattga taaacttgtt tagcttgtct ttgtagaaag ttttaaaagg
    36841 ctattcaccc cctctctagc catcaagacc tttcaagtgg tatcggagcc gtggtcaccg
    36901 tttgtaaggc ttaacaacct cggtgtaaga tggctcaagt tatgttcaat catgtaaatg
    36961 gcaagcctcc attctttgat ggtgtctctt cctttgatca ttggaaaagg aagatgaagc
    37021 aatatctagg caatatacat gagaaggttt gggatgtgac caaagaagga tacatcattc
    37081 ttgatgagga aaacctcact cccaatgacc gcatcaacaa acaatgcaat acggcgacac
    37141 ttgacacaat ctaccgtgcc attgatgaca aagtatttga gcaaatcaag gatcttgaaa
    37201 aggcaaatga gctttggata aggcttgaag aaacatatga aggcacttca acggtaaaaa
    37261 gtgccaaact atatatgctc aaggataagt tctccacatt caagatgaag gatgatgaat
    37321 ccatcccgga gatgttctat aggctccaag tcattgtcaa tgatctcaag gggcttaggg
    37381 agaagattga ggacaaggac ttctcacaca agttcttgat gtgcttaccc aagaagtttg
    37441 ccaccttgag aagaatgata tttagagagg gattggacaa ggtcaaacca accaatgtgc
    37501 ttggagatat aatgaccgat gcccaataca atgatgatga agatgaggta gaagagaaga
    37561 aggagaccaa ggtcaagcaa gagaagccca ttgcattcaa ggcttcatcc tctaagggca
    37621 agagcaagga ggagagtgat gatgatgatc cattcgatga taagaccatg gccctccttg
    37681 tgcacaagat gggaaggttc atgaagaaga aaggatatgg ggcaaggaag aggagagaca
    37741 ctataaaggc aaagaccctt tgctataatt gtaatagccc cgatcacata gtggcggatt
    37801 gcccctatga agataagaga ttctataatg gggacttgaa gctcaagaag aacaagaaga
    37861 ataagaaaga gaatgagaag aaagcaaaga agagcttcac attcaacaag aagaagaagg
    37921 gtggtggtca tgtggtcact tgggatagtg acaactctga taatgatgat gatgaaagct
    37981 ctagtgatga tgagaggacc actcgacgag ccattgcaaa catcgccctc tccaacaagc
    38041 catccatctt cgacactaca tcaacatgcc ttatggccaa gcctacaaag gtaaaatatg
    38101 atgatagtga tgatgattct tgtgctagtg atgattgtag gagtaatgat gaggaggatg
    38161 aggactactc caaggatgat ctattgggca taatagatca aatgagcaag ggctacaaga
    38221 ggacaaccaa gaaatacaaa atcttagaat aagagctcat tgccaagagc aatgaaaacg
    38281 atgccttgat ggaggagctt attgctctta aaaagagtaa ggagtgcaaa ggaattgaac
    38341 aagagctcaa agctcttagg aaatcctttg atgagctaga ggcttctcgt gagtgtctaa
    38401 aggaagacca cgaggatctt gaaattgctc acactaggct taaggaagcc cactccactc
    38461 tacttgagct catcaaggaa aaggacctca agttggagaa gctcatgaag gaagctaagg
    38521 aggagcaagt gattgtcact tgtgatattg gactaacatg tgatattatt gatgattctt
    38581 tatttgttag tcctactaat gtttcatgta gctcatcatc atccaccaca accaactcta
    38641 cctctactac tagtgattca tcacttgtgg ttgagaatga gactctcaag agagaggtgg
    38701 atgatctcac ccacgcatta ggcaatgcct atggtgggga tgcccgcttg ctaaaatgct
    38761 tgggtagcca aaggttctct cttaacaaag agggtttggg ctatactccc aagaagggca
    38821 aggcggcctt tgctactcca aagtatcgct ttgtgaagat taatggtcgt tattgcaata
    38881 gatgcaagca agttgggcat ctagagatta attgcaacaa aatgaacaag aacaagaaaa
    38941 atgctaatgt accttacatt ccttttgatt cttgttatgt gcttaccaag ggtgagaaat
    39001 gtgtgcatgc taggtttatt ggtacaccaa ttgtgggccc aaagaagaag gctatttggg
    39061 taccaaagag cttagtgact aacctccaag gacccaaaca agtatgggta cctaagaaac
    39121 attaaattat tttgtaggta aattacaagg ccggaggaag gcattgggtg cttgatagtg
    39181 ggtgctctca acatatgacc ggtgattcaa gaatgttcaa ctctctcaaa tcaaatgata
    39241 gtggcattga tagtatcaca tttggtgaca atagcaaggg tgatgtgaag gctcttggaa
    39301 ggattgcaat ctcaaatgat catagcatct ccaatgtgct actagttgaa aagctcaatt
    39361 tcaacttgtt gtcagttgct caattgtgtg atctcggttt caagtgcata tttggtgttg
    39421 atgatgtgga gatagttagt gttgatggct ctaacttgat cttcaaaggc tttagatttg
    39481 agaatctata cttggttgat ttcaatgcta gtgacactca acttttaaca tgcttgctca
    39541 ccaaatcaag tatgggttga ttatggcata gaagacttgg tcatgttggc atgaagcaat
    39601 tgaacaagtt agtgaagcat gacttagtta gaggcttgaa ggatgttaca tttgagaaag
    39661 ataagctatg tagtgcatat caagccggaa agcaagtagg caacactcat ccattgaaga
    39721 gcattatgag tacttccaag gcatttaagt aaagtacatg gatccatttg ggctgactac
    39781 atacacaagt attggtggca acaagtatgg ctttatgatt atggatgatt tcactagata
    39841 tacatgggta gtctttcttg gggacaaaag tgatgtattt gacttattca agaagttcat
    39901 caagagagta caaaataagt ttgaaaccac aatcaagaaa gtgagaagtg acaatggaag
    39961 tgagtttaga aacacaagag ttgatgagct atgtgatgag cttggaatca aacatcaatt
    40021 ctcgaccaag tatacacctc aatcaaatgg cttagttgag aggaagaata gaactttaat
    40081 tgatatggca agatcaatgt tgaatgagta taatgtgagt cattcatttt gggccgaagc
    40141 aatcaacacg gcttgcttct atagcaaccg cctctattgc cacaagttct tagagaagac
    40201 accatatgag atcttaaatg gaagaaagcc taacattgca tacttttgag tatttggttg
    40261 caaatgctac atcttgaaga agggtactag attgagcaag tttgagaaga aatgtgatga
    40321 aggcttcata cttggttact caactactag caaagcttat agagtttgga atttggctag
    40381 tggtttactt gaagaagtgc atgatgttga gtttgatgaa accaatggtt ctcaaaataa
    40441 agaaaataac ttggatgatg tgagaggaac tcaattgacc aatgctatga aagaaatgga
    40501 tattggtgat attaggccaa agcaagtgat taatgtggat gacaacaaag atcaagtgct
    40561 ccaaagtcca attacacaag ctagtggttc tctaatgcaa aatcaagcta gtacatcatc
    40621 tcaagtgcaa caagatcaac aagtggctag ttcatcatct ccaactcatg atcaacatca
    40681 acatccaagc aatcaaatcc aagtgcttca accaactagt attgcaagag accatccttt
    40741 ggattccatt attggtgaca tacaaagagg agttcaaact agatcaagat tggcatcatt
    40801 ttgtgctcac tcttcttttg tgtcaatgga agaacccaag gacattgata aagcattaag
    40861 agatccggat tgggtaaatg caatgcatga agaactcaac aacttcaaga gaaatgaagt
    40921 atgggatcta gttgagaggc ctaaggatca taatgtcatt ggaacaagat gagtctttcg
    40981 caacaagcaa gatcaagatg agatagtagt aaggaacaaa gcaagactag tggctcaagg
    41041 ttacacacaa atagagggtc ttgactttgg tgaaacttat gccccggttg caagattgga
    41101 agcaattagg atcttacttg cctatgcttg tgctcacaat atcaagctat atcaaatgga
    41161 tgtgaagagt gcatttctca atgggtacat tcaagaggag gtgtatgtgg agcaacctcc
    41221 cggttttaaa gatgacaaga aacccaatta tgtctacaaa ttgagaaaag ctttgtatgg
    41281 attgaagcaa gcacctagag catggtatga aagattgagg gacttcttgc tatccaaagg
    41341 atttgtcatg ggcaaagtgg atactactct cttcaccaag aagattggga aagacttgtt
    41401 tgtgttgcaa atatatgttg atgatatcat attcggttta accaatcaag attattgtga
    41461 tgagtttggg aaaatgatgg caaaggaatt tgaaatgtca atgattggtg aacttagttt
    41521 ctttcttgga cttgaaatca aacaaatgaa ggaaggaaca tttgtgagat aaaccaagta
    41581 catcaaagat atgctcaaga agtttggcat ggaagatgca aagggcatta caaccccaat
    41641 gagcacgagt ggaagcttgg acagtgacaa gagtggcaac atggtggatt aaaagctata
    41701 tagatcaatg attggtagtc tactctatgt gacggcatca aggcccgatg taatgtttag
    41761 tgtatgcata tatgcaagat ttcaagcctc accaagagaa agtcatttga aggcaacaaa
    41821 gagaatattg aggtatttga agcatacaca agatgttgga ttatggtatc ccaaaggtgc
    41881 aagctttgag ctagttggat attcggattc cgactatgcc ggtgacaaag tggagagaaa
    41941 gagcacttcc gggacttgtc aattattggg aagatcactt gtctcatggt catccaagaa
    42001 gcaaaatagt attacactat ctaccgccga ggccgaatac atcgccgcgg gtagttgttg
    42061 tgcacaaatc ttgtggatga aggcaacatt gaaggatttt ggaatcactt tcaagaatgt
    42121 gccattgcta tgtgacaatg aaagtgccgt gaagctaacc aacaatccgg ttcaacatta
    42181 aagaacaaag catattgatg ttcgctatca ctttattaga gatcatcaac aaaagggtga
    42241 cattgctatt gagagtgtgg gcaccgaaga tcaattagcc gatctattca ccaagccact
    42301 tgatgagaag agatttcaca agctaaagaa tgagttgaac atacttgact tctccaacac
    42361 gagttgatgc accccatata tgacatgcct ctccttcgag ccccaaggta taattggttg
    42421 acatgtcata cattctatgc taaggacatg tttagtgcat ctagtcataa tttacatgtt
    42481 ctaggctcat tcataaaaat caaatgaatt tgaagtttat atggtaccac tattgttttc
    42541 atgacttata tgatctagtg gtagcatata acttgtttaa gtagcttgtg atcctaagtg
    42601 tttaatctag aaaacttgtc taaatatttg cttcaacatg gtgcatgata acccttctag
    42661 ggaggtgtga agaagcttgc ccttggatca aaccgaagta ttttatttat gcaagcaatc
    42721 taggttgaag cataaacttg atcctcaccc catatttcaa catgataatc tatctaaagt
    42781 ttgctccttg tggtcaattg gtgccaaagg gggagaaaat attgttcaca atgatagaac
    42841 tcaaagagga agaagcacaa agggggagaa ttgataaaag aaggggatca actaaaattt
    42901 tgagcacaca agtaggggga gcaagctctt aaacatgaat gttgcatttc catgtgcaat
    42961 tcatatgtat gatgcatagt tatgcatttc tttttctccg atacattgct tgtgtggtga
    43021 cttgctagta taatttaaat ggtgtattga ggtactagca tgaataggaa gtagttagat
    43081 ttttcttgct tcatgttttt tcacagtggt actagagcct tgcttataat gttgatctca
    43141 cgaggtttct agttatgatt gtgtttttac aagtggtatc taactacaca aggtgctaag
    43201 atggtgttta tcgctactcc gatggtatca cgcttcaaag gtctatactc ttaaacactt
    43261 agcacctatt ggtagtcaat gctcctatac tttcctatct aacatgtatg cttccaaaat
    43321 ccaatcatat agcatacatg tagggggagc cattgctatc aatttgaatt catgatcaca
    43381 tgtccataat tcttacacat ggtaatatac ttggacaatg tgacatgagt tcaatcaaac
    43441 ttttatcata atatctttgt gaaaggtttg tcaccaatta ccaacaaggg ggagattaaa
    43501 agtcctatgt ttggtgtcgg taattagtga caatgcctaa gtactaatcc tatgcctaag
    43561 ttgtatgtag catatgagga ttagtacatt ccaaggttgg tggcaagatg gacatggtga
    43621 tcatgatggc cacacttgga tttggatgca accctacgtg atcaaggcaa aggtatatgc
    43681 ttaagggttg tgttttagta accaagacac ctagtgggtg tggttacatt ataagataga
    43741 tagcagtact ataaagaggg gaatgacgcg gctattgaat tcctaagtgc ctctagatgt
    43801 gcatttcatg atcatatgca tttggataga actaatatcg cctcgaaaaa tgattgtaaa
    43861 aatgctaaca cactcacact tgacgaagat cacttggtgg tgttagcacg tttgcgtagg
    43921 cgatggagtt tgagcggtag agagggtttg ggatcctctc tccctcccgc cgagcttgcg
    43981 aggcgggatt caggcgtttt cgaggagttg aaacgacttt tttccactac gccgaaagtc
    44041 cagaaaagaa acagaggcga acagaggtca cagaggtgac cggacgctga accggacgtg
    44101 gtccttgcat gaccggacgc gtccggtcag tgttcagtgt ctgcgcgttt ttcagttcga
    44161 tgatcggacg cgaggcgcgt ccggtcactg atgatcggac acgtccggtc gttcagggag
    44221 cttactggac tctaaccgga cgctggcact gtcgcgtccg gtcatgtttc ttcagcacgt
    44281 ccggtcactg tttcgttgag cactgctcag gcgaccagcg cgtccggtca ttctcgggac
    44341 cagcgcgtcc ggtcattcgc agcgcgtccg gtctgcgcgt caagcgcgtc cggtcattgc
    44401 tttgcaacta gccgttgtgt gaccgacgcg tccgatcatt tggaccagcg tgtccagtca
    44461 gtacttcacg agttagccgt tgggcgaccg gcgcgtccgg tcagttggac cagcgcgtcc
    44521 ggtcagtacg atttcggctg tttaagtttc taacggctat attcgaaggg gtacgtctat
    44581 atatacttgt tggccggctc aaggctctct ctctcgaaca tttgacatac ttgtgagcac
    44641 tttgagctaa gcaactcccc tcccactcat ctctcttgct tctttgcata ttcgaagtga
    44701 gattgagtga tccaagtgca tttgcattgt gagattgcat ctagttagca cttggtggtt
    44761 gatttgctgc gggattcttg tttctcttgg tggttgccac cacctagacg gcttggagca
    44821 gcttggaggc gttagtaaga gttggtgatt gttcttggcc acctccggtg tttgtgaggg
    44881 gtttgtgcct acctcggcga aacgccaaag gcaacattag taaattgctc gtgtcattgc
    44941 aaccttttgc catttggtag gttcttgtgg cgccttttga gaggctcggt gtgagaccga
    45001 ttagccaccg aaccacgtgg tgaagaggga cacaacgggg atagcgtgcc ggtaagcacg
    45061 tgaacctcgg gataaatctt cgtgtcatca ttcttattgt gtttgatcga tcccggtggt
    45121 tgtatattgt ggtattcatc tgttgatcat attgattggt tggctcaata ctttgcccct
    45181 cggtgatatc ctcctaactc tctcttgtat taatttctta gttaccttgc tagcttgtta
    45241 gtgtaactct tagcttgtgt agctagctag ctttagttat agttaaattg tgcggtttga
    45301 cttgtgcggt tgagtgcaat tactagaatt gtgaattggt taggtggctt gtaaacaccc
    45361 cgtaggctaa gcaaaactcg catctcgcta tttgttatat tgataaactt gtttagcttg
    45421 tctttgtaga aagttttaaa aggctattca ccccccctct agccatcaag accattcaca
    45481 atgcctgtac cgctagcatc tgtctccacc gaaaacggct tgctgaaatc agggagagcg
    45541 agcaccgggg ctgtagtgag tgcctgcttc aaggtttgaa atgccaattc ctgaacatca
    45601 gtccagacaa atatagtgcc cttgtgaagc aactcattcg gtggacgaga gatgatgcca
    45661 aaatttttga caaaacacct gtaatacccg gccaacccca taaagctccg aagctcctta
    45721 gcggattgcg gggacggcca ctggacaaca atctgaattt ttgttgggtc ggtggcaacg
    45781 ccggcctcag agatgacatg cccaagatag tggagttggc gctgagcaaa tacacattta
    45841 gacatcttca cttgccactg atcccgctgc agtaactgca acaccagcct aagatgctcc
    45901 agatgctctt catatgtgcg actgaaaatg agaatgtcgt cgaaaaagac caaaacacac
    45961 ttccgcaaca aagaccgaag ggttgtgttc atggctttga gaaatgttgc tggtgctccc
    46021 gtaagaccaa acgccatgac tctgaactcg tactggcctg aatgtgtttg aaaggcagtc
    46081 ttgaactcct cgcctgactg cagacgaatt tagtgatacc cagcagtaag atcaagacag
    46141 gagaaccaag aggcatttgt aagctcatcc aacaactctt caataacagg aactgggtat
    46201 ttgaccttgg cagtgatagc attaagatgt cgaaaatcca cacagaaatg gaaagtgccg
    46261 tccttcttct tgacaagcaa aactgatgaa gaaaatggac tggaactatg ttgaatgata
    46321 cctgattgta acatgtctgc aatttgccgt tctatttcat ctttgatcgc taggggataa
    46381 cggtacggcc gaactgaaaa gggaccagct ccagggagaa gaggaatggc atgatcacag
    46441 tctctggctg gagagtaccc cgttggcgga gcaaagaccg actggaattc agttaacaat
    46501 gcaaagactg cagacggcaa tggatccgga ctgggaacag tgtcatctgg caaaatagat
    46561 gatatttgca caacagagcc tgccggcagg gcaaacaagg atccttgcaa caaatgctga
    46621 tccagacctt gcgatataag tagccactta tgctgccaat ctatctgcat agggctgtaa
    46681 gcggcaagcc aatccatacc cacaatcaac tcataggatg acaacggtaa caccttagcc
    46741 actgaaacaa actcacattc ctgaactgtc cacttgagct gctgaaactg tgaggagcaa
    46801 agtaataggg agccatcggc cactgtaacc ttgagtggtg gagagaaagt agacatactc
    46861 tccagcttat cagcaagtga tgaactgaca aaagtgtgag tactgccgaa gtcaatcaaa
    46921 atccgcactg gatgacccta aatccggccc atgaactgaa tagagttaac tgacaacggt
    46981 cccccagatg ctgccataga gatagccata cacaattgag ctgcatcagc accatcttcc
    47041 tgccattcat caggacagac ttcatgacag tcttcagcaa agcaaacatc ccagagctcc
    47101 tgcagaacat gcagttggat agcttcaggg caccgatggt cacgtgacca tttctcacca
    47161 caccggaagc agaggccacg agcgcgccgg taatcccgca gagtggagag tttgtcgtcg
    47221 acgccgtgcc cacgccgatc agggcccagg ttcggaggca ccggcctgtc ttggcgttcc
    47281 tgccatggcg gaacatgcga cagaggtccg agcccacgca ccggagcctt ggcaaaggtg
    47341 aacagttcag gtcgacgaaa atccttcttc cggacaggct ccaccaattc ctcctgcaac
    47401 agagcaagga cacaagcagt atcaagattg tctggacgct gcatatgcac cgcagcacga
    47461 atgtcggcac gcaggccatc aacaaagcgc atagtatagt aaagtggatc agtattgcgg
    47521 ccataagcta tgagctgatc taccaaacca gtgtacttat caatgtactc ctgcacagaa
    47581 cccgactgat ggatgtggaa caaatggcga atgagcaact cgtgctgatc tttgccaaag
    47641 cggttcatga caagctgaca aaaatgctcc caactacccg cacggacctc atcttctact
    47701 gactgcagcc aacaagcggc ggcccctgat agatgcatgg tggacacttt gatctagcgg
    47761 cggcgcggca caaggtacat ctcaaaataa tctaagcagc gccctagcca taacttggga
    47821 ttagcaccat cgaatggagg aaaattgatt ttaggcaggt ggcgatttcc cccatcccca
    47881 tcttcataac aacggtgatc tggtgaccca tgcaccccac ccgaaccacc atgaatgccc
    47941 gcttcgagag cacaactgga acaggatcga tgtaacttag gcttgggatc gggatcgggc
    48001 gaaatgaacg tacccttgac cggggatcga gttgagaact caaatccccg gtggcttaat
    48061 tcctcgtggg gccctaacgg gctgaagtga gtccagccag cgggaatcga cgctgcggac
    48121 accttgggag gcggcagaac gccggacggc gcagtctgcg tggcgtcgag gacggagcgg
    48181 ttcacagact tgcgcagcgc ggtcatctcc tcccgcatcg tctctagctt ctcctatgtc
    48241 ttccggaacg cgccaatctc cgcgcacagt tgcgccacgg aggcgtccat cttcggcttc
    48301 caagcgtcga acaccttggc ggcgtcctcc agagagccga cacgagcgcc gatggagtgc
    48361 tcgaccgcgt cgatccggtt ggtgaggttg gattgcacgg acttgagctc gtcgaggatg
    48421 agtttggtgt tgggatccat ggcaccgagc tgcttgcgga aacgggtgaa atggtcgtgg
    48481 tcgatgtgat ggggctccag ggtggatcgg attccggcga tgggctccta caccgatcag
    48541 atcagcctcg gcgcggacct acgggttcat caactcgatg ccgaacaacg aggacgatca
    48601 ccagacgtcg ggggttacga tccgatatca agatgcagga aacaaaatcg accaaggaat
    48661 cgatggctct gagtaccaat ctgttacgat cggcgatagt atttgtggaa tttaggtagt
    48721 agcatacaga atccaatata gcagtaaagg attggagcag gggaagggaa agcagagcac
    48781 atggttgggt ttagaggaag gcttgcagga ggggcaaggc agtagttgta atgttcctcc
    48841 cctctctcct cacgcctgtt acaataagta gactaagacg agcaggtgac tcaagctggg
    48901 acccactctt cgcccgtcac acgcgtgctc cgcgtccttg gcctggtgga cctcctggct
    48961 ggctgcggcc caggcccaag agttgcttcc tcatcttctg ttgtcgggtg ctggatagta
    49021 ggcgccgtaa cacctttgtc ttataacact aacatggttc gatgttttca cctctacagc
    49081 tgaaactaat gcaattgatt gggggataca cttcaaagta atcgagggga tctgcaatgg
    49141 actaggcttc cttcataggg ggatgcgccc attattcaga tgtgtattca tcccaccgcc
    49201 atattgttgg acgataattg ggtgccaaag atttgtgatt ttagtttctc gagacaattt
    49261 ggtgatgaac agagccggac taatacaata aatgttgtgg gagtaaagta agatgaaata
    49321 agctgcataa tatgagtatt cttttttatt cgcagaatat attgcatttg aatcccctaa
    49381 aactgttcca ggggatgcat ggctccggaa tatctataca gaggtgaaat ctccaccaag
    49441 tcagacatat atagcttagg cattctaatt atcgtcgtcg cgactggaga gatctatctt
    49501 ggtggtacag acagacctga aggcaaactt ctagataatg taagatgatt ttatattatg
    49561 attggaagtt gaaaaatcta cttagaagtg gtacattcag tttataaatt accattaagg
    49621 accataattc aattctgcag gtacgtcaga attggacaca agaagacttc gtcatttcca
    49681 agtacctaat actatgtcga gatgacctca tggaagtaca ggcgtgcatt gatattgggt
    49741 taaggcgtgt ggaggttgat cagtaccgga ggcctcccat aggcctcggc ctggtttagt
    49801 tgccaattca ggtgcctaaa ttctactatg caaaaaggag attctctatc acattaaaat
    49861 gtcggcaaat gcatggagta ctaaatgtag atgaaatcaa aaactaattg cacagttttg
    49921 ttgtactttg cgagacgaac attttgagtc taattaatca atttttggac aattttttgc
    49981 actaaaaaac aaaacgcgct acagtattcc gactggaaca ctgtagcgcg tagacgccga
    50041 atcggcgcgc caacttcgca tctaaacacg acccttgttt agttcccaaa tttcccccaa
    50101 atttcactat gcaaaaagaa gattccccgt cacatcaaaa tgtcggcaaa tgcatggagt
    50161 actaaatgta gataaaatta aaaactaatt gcatagtttt gttgtacttt gcgagacgaa
    50221 cattttgagt ctaattaatc aatttttaga caattttttg cactaaaaaa acacgccaca
    50281 gtgttccgac agctgtagcg cacagtgccg attcggtcgg catctaaaca cggcgcttga
    50341 caggctccag ggaagacgtt ctttctagat gaaagactag gtatgaacac tggggacacc
    50401 gatgtgctct gttagtatga tttggtttta ctatgttgta ttgtgtactg tgtactgtgt
    50461 atgaggctga caagttttca caaatctaga tctagcgcaa gcaacaggac gcctatgcca
    50521 tcttaaatgc tgaatgccac taaaattatg tagtatggtt tagaaaatag tagttataat
    50581 aatgggtaca aaaaacattc aaaagtaaaa gatttaaatt cacatttcac atatcatcta
    50641 atgatatctt aaacattcaa atggctactg ttacacatgc ccgaaaacaa ggattctatt
    50701 ttgaaattct tcaaacaatt tcagaaattt catagactaa atgcacaaaa gttaccatat
    50761 attttcatga ggtttcatct tatttttttc caactatatt atatcaaagc caaagaagct
    50821 ccatatggtt tgcgtgcgat gaaactttgc atatcactta ttgacagagt tttggcctct
    50881 gattttcagc atgattttac acttttactt gtttccataa gttattcatc cttaccacgt
    50941 ctgttacagt aatggtccag catctccaaa tcatagctac tgttctgtgg tgcggacagg
    51001 ctatttggaa tttcagggtg cccatttcca gcctgcttga agcattgacc gttcaaggcg
    51061 atattgatgt ccaagatgat ataaaacatg ctctattgtc aatagagcgc catgaacttt
    51121 ctttcctaaa tgagaccctt ttttatgata taaacatgct ctgtattatc aaaaaattcc
    51181 tggtgcagct gatggtacca actttcttta cttgatattt actttttgaa aatcattaag
    51241 tttgtgtgga acgttggtat ttcatatcag ttttacaagt ttcatgaagt tataagtttg
    51301 tttccacacc atatctctct atatctcaaa tagataacga gcatccaact aattttcccc
    51361 aagcaacatg agaacaaaaa gaacagcagc attaaacata ggtattttta tatcagctat
    51421 ttaaatgtcc agcaaaaacg cagaacatga gctcacatgt agaagtacaa aatcccatat
    51481 aatataatcg atgtctgata gcattcagaa acgaacacac tggggaatat aatcatgaga
    51541 cgagactgca agcaaaccag gtagcaacta gcaaactagc taagcataga tgtcgatacc
    51601 ccagaacttg gctggctggt tggtgcggtg gttcctgtcg atcgccttca tctccttcat
    51661 gtcctcctcc gagatgtcga agtccaggac ctccaggttc tcctgcagcc tctccacctt
    51721 ggacgtcttg gggatcaccg ccgcattcct ctgcagaccc caccggagga ccagctgtgc
    51781 gggggtcttg ccgtacttct ttgccagctc ctgccatgga tcattcgcag ctcagccatt
    51841 ttgtttgagc aagaatgcaa atcgccatca caaatgcagc gatgcacggg gcaagatata
    51901 ctcaagctga atgttcatga tcaaatgtac gagcataaaa ctttgacgac agtgcgattt
    51961 aaaactgatg aagatcgatt tggaatgaca accaccttga tgacaggatc ttcgaggcat
    52021 gagagcgagc caaacagctt ggcattggca gtgaagccac cacccaaggg tgtgtgagcg
    52081 gtgacacaga tgccgtgctt ctggcagaac ttgacgaggg aatcacgctg gaagtaggga
    52141 tgcagctcta tctggttcac ggcaggcttt atcctggcgt aggccaagca gtctctggtg
    52201 agtaagacgc cgtagttgct gcacaaaaca accgtagtgg ttagatcttc taaagatgac
    52261 ttcctgtgca agatgcaatg cagttgtttt ggttgttctg aacctgaatc atctcaagta
    52321 acttactcct aagtcaaaat gatttccagc atatacatag gtagtaaagc aataactgtc
    52381 atcagaaaat tataataaga ttataccgag tcattgacca ttttttttta catcaacgga
    52441 ctaatggagc cacatgatat acaagacagg ttaatataaa cataccaagg tcaaattatc
    52501 cccaagttcc agaagtgaac aaaacaaaga actgcgaacc agtcccatag aaacaagatc
    52561 ttccatcgca tgccatgttg cctccaacga gatagtggta tcaatgtcta gcacgccatc
    52621 ttcaccaata acgctcacgg ttgcgccgat ttctggagat atatatagtg caaaaggagt
    52681 acatgagaca ccgaacaaaa tgttctttgc tccatgttat ctaaataaaa tatactaaaa
    52741 ggaaaggagt taccagtgtg ccgagtagcc actgggaagt gaatgagata gaggtcaagg
    52801 taatctagct gtagcttctt caagctatcc ttgcaggctt caaccacatt cccatgatct
    52861 gagttccata gctacaatca taacaaatgt atgcacatca atctcatgac tgtggaaatt
    52921 taaaaaaaga gaggctgtgg tggaatagag agtacaccac atgagctgat taagaacggg
    52981 gtgttacatt ggttgagttg gaatcgttcg agaatccagt atcaagatgg aatttcatgg
    53041 tttggtacaa gccagcattg gtgttttgta tgtcagacag tctagtgact tgacagattt
    53101 actaagacat gcaaagctca gtcactatag ggaccatacg attgtatggg tgtgtttaga
    53161 tgtgtaaaaa ggtgtaaaaa aagtactgta gcacgttttg gctttatttg gcaaatagtg
    53221 tccaaacgtt gactaattag gttcaaaacg ttcgtctcgc aaagtagaac caagttgtac
    53281 aattagtttt ttatttcatc tacatttagt actccatgca tatatcgcaa gtttgatgtg
    53341 acggggaatc ttttttctgc acagtgtttt tttttgtgga actaaacaca gcctatgtat
    53401 aaaattcagt gtaaaggctg cagaattttt ctgaggagat ttgtgtgtgt agcctgtagc
    53461 gttcaatcct agggtctcta acccagctca atgcacatat atataattaa cttacaatgg
    53521 tccctcctgc caatatttcc acaagaaaca aacaaaaaca aaagaatcca atgctatgga
    53581 ttttccagta gtagagtaag aaaaacacta ggggtagcat cattgcattt tgtgatgtgg
    53641 aggataagtt aacctttgtt gtgatgaaga ggtcctccct attgacaagc ccggtctgga
    53701 atgcctctgc aagcgcgtca ccaacctcgg cttcgtttcc gtattttgct gcagaccacg
    53761 aaataaacag aagacggtca gtaacccgat gatacaacat cctgaacacg ttccttccat
    53821 gaataaacac agaaatggaa gaacacgccc ttcatcacat cacgttgaat agtactacaa
    53881 cacaaggggc gccgtgcgga ggccggaggg atagtgaggg tggggcggcc ggcggcgcac
    53941 tgcctgcgcg ctcagcccgt ctgctcgtgg ggcgcaggtc ggccggccgc cgtggccgca
    54001 cgccgtccgc cgccgccgtg gcccgtggcc gctggtgctc gctgggtgag ggcctgaggt
    54061 gaagcggcgc ggcgcggcgc cgtggggaag ggctctggcc tctgagtagt gggccgctga
    54121 gcgtgggctt ctgggcctag ttacttcgag cagctggcgg gctgcttgag cgatatgggg
    54181 gctactgggc tcaaacgcca ttctgtgtgc cttctagcag tatttctctc tacagatata
    54241 tactcctact ttaatgattc cccccccccc ccactggaat gatttttctt ctgatgttac
    54301 atccgaggtc caagcaactt tgttccacgg ataagaaaga ataaaagttt caatcaagag
    54361 gaaaaatggc tctctagaga tgtctcagtt acaagagaaa agtttgataa taaagaaaaa
    54421 gaatggctct ctagagggtg aagctagcta gtatgtagct gttcctagat ccagcactga
    54481 gctctagcga cgggatctat ggcaatgtgg cctaatcttc gaatcaattg ctttcatata
    54541 tactctctct ctctaaaaaa agatacaatt ctcatgtttt gatgagtcaa acaatgttac
    54601 ctttgaccgt ctctatacaa aagttaatac ttacattttt tatatcaaat aagtatatag
    54661 attgattatg aaattttttt atagtaaatc tatttaaaga cataaatgtt catatttttt
    54721 tctatataaa ataggtcaaa ctaaaaagtt tgactactct taaacctaaa attgtgttat
    54781 tttttagacc aacggagtac cgatccgcga tagatcgatg tgttttatct gaaagtatgg
    54841 ttgtatccat aaccatctga gtactaactc agcaggatat tagatgaaaa taaatctcgt
    54901 aaacacgttc catgcacctt attagcttaa tattcggaca tgtactactt tactgcatga
    54961 ctgcatgcat gcacacagga cgtctatgtg agacgacttg gagagctctt ttggcgcggt
    55021 tccaccctac tccctccgtc cctaaaaaaa aaaagagtcg ctatagaaat cgtgttggac
    55081 aaactttttc aactttaact aggtttgtat aaaacatgtg caacatttat atctccaaat
    55141 aagtttatta taaaaataca ttcaacgatc tacctaatgg tactaattat gcaccataaa
    55201 tattaatatt ttgttaaata tatttgatca aaattaaaag ttattctttt tttttggaaa
    55261 gtgtgaatga ctctttttag ggtgaagtct tttttttctt cagctccata gacaactccg
    55321 ttggtaaagc tggaacaact ccacgtctag agttttttaa aacatactct cacgaaactc
    55381 catgcagagt ccaccagaac gaggtgaaac cacttttttt ttgctccata ttgtatctca
    55441 aacctatgtg agagcgtgat ttaagggact tcttagatga agccattttg aatttgaccc
    55501 cgtttggcac gaaatgacac taaatgactc tgaagccggt agaaaagtca tgccacacga
    55561 ggctgtatat actatatagt tccttcctgg ctataactat cgatcatgag gcaggcaggc
    55621 ataccggcgc agtcgaagtg gcggtagccg ttgcggatgg cggcgtggat gagacggcgg
    55681 acggcggtct tctccatccg ccacacgccc agccccaccg ccggcatccg gtgcccgctg
    55741 ctcagcgtca ccgtcggcac catcctacgg ctgtgcccgt tcaccgccgc cggcaccgcc
    55801 accaccctgt ggctgtgccc gttcaccgcc ggcgccacgt ccttcgccgc cattgtcgtc
    55861 tctactccct cttattactc cgcccgtccg ccggctggtg ttgcattgag gcttgattct
    55921 tgaggccatt ttatacagga gtacaccctg actttttctc gacatgcatg cagcggcagg
    55981 ccatgctgga atgcatgcta ccgtagaatg acttcgaccg cctacctagc cccatttatt
    56041 cagaaatatt ttatttagga atctacatat ataccacaaa tgaatttctc aaatataata
    56101 ataatgctgc caagtctata cgtatctgtg acactgtttg tagcagctac tagctagcaa
    56161 cctttagcta gctaggccgt tcccgttcct ttcggtatgt atgctcctag atgacatgta
    56221 tatatggaac cctttaccta ctagctaggt cctcctcctc ttcttctttg gtccacatgt
    56281 acaagctaag gccatgtttg gttctatgta aatagtaacc gtctgttaat agtaatctct
    56341 tttcgatcca aacaaatata gataatagac tagttaattg ttagttggac caaatcaaat
    56401 aatagcagct aatagatgga ccaacaaccc agtcttatca attagctgtg tatcaaatat
    56461 cctcctagat aataggtagc tagacaaagt tagctaacta atattagcta tatattagct
    56521 agctaactac ttcatgtaat ggatccagac aaggcctaag tcctgcattc atctacactg
    56581 catcatcctg cttgtttgtg gtgtatctat ctcctttttt gattggaagg agaccaaaat
    56641 gcactactaa tacaaccgac aagaaggcca tggataacaa aatcaccaac taatgaattt
    56701 gtttccctct cgaaaactag tttgatcagg tagaactagt tattagatag gtctaaaaat
    56761 ttagaggatt agatagctag ttagctaata actaactaaa gccttagcat atctattagc
    56821 cttctattcg ctaccgcaca cacgattttt agggacggct cacaaccctt tgtagggacg
    56881 gttttgccag ctacccctat gaaggggttg ctacaaattg ctgatttgta ggggggttgg
    56941 cacctacaaa tcggattttt agaggcggct caagatttat agataaagag ccgctcctac
    57001 gaaccaattt tccagaaaat aagaaattgg cccaaaaatt agcaattttt ttaatccgag
    57061 gaggccccca ccagtcgacc actcggcaca agtcgcacgc ttcaccgccg ccggggttta
    57121 aactcacaac cttgggcttg catgttcctt cctctaacca ctccacccat cactcacttg
    57181 tgtctataat ggatttttgg ctccccacat atcatgctaa acagagttta aattgattgt
    57241 ttgaggccct aaaggaattc aaatgaaaaa gttatcaact acaaaatttc ataacttttc
    57301 aagatctaca acttttattt tagtagttta tctatccgag gtcgttcaca aaatttgaat
    57361 ttcaaatttg agaaattcaa acatagtttt ccttaacaag attatttcaa atgaaaaagc
    57421 tgtcaactac aaagtttcat aacctgtcga gatctataac ttttgttttt gctgtttgtc
    57481 catccgaggt tgtttaaaaa attcaaattt caaatttttg gatattcaaa cgtagttttc
    57541 cttgacaaga tgatttcaaa tcaaaaagtt gtcaactaca aagttgtata acattttagg
    57601 atctacaact tttattttgg ttgtttctcc atccaaggtc atttaaaaaa ttcaaatttt
    57661 aaatttgaga aattcaaacg tagttttcct taacaaaatg tattcaaatg aaaaagttgt
    57721 caactacaag gttatataac tttccgagat ctataacttt tattttggtt atttggtcat
    57781 ttgatcatcc gacacagtgg tagtaacatt gtttataaat tttacatatc cctcttatag
    57841 tttatggaac agtaagagag atgtaaattt tatgaacaat gttactacca ctttgtcgga
    57901 tgaagaaatg accaaaataa aagttgtaga tattgatgaa ttctataact ttcatgttca
    57961 tgactttttt tcagctaaaa tcatttaatg tttcaaaata acgtttgaaa ttgttatttt
    58021 ttgaaattca aaattcaaat aaataaaaca cagtaacatg aaaagatgga caaaatgata
    58081 gctgtaagaa cacaataaat ccatagagca caaatttaga aaattttagg aaaaaaatca
    58141 tcaaatttaa agttaatatg agggagaaag actagttaca agttttagtc agggattaaa
    58201 aaaagaaata agtattcttc actaatttta aaattaaatt tcaaataata ttttgaagca
    58261 gtaaatgatt tcaaatgaaa aagttgtaaa caacaaagtt tcataacttt ttgagattta
    58321 caacttttat ttttgtcatt tctccgtccg agatcatttt aaaaaattca aattttagtg
    58381 cttaattttt attattcggt gtctatttgt atgtgcggct caatattcag ccgcccctac
    58441 aaatctgatt cgtagagacg gctggatata gagccgcccc tacaaatcaa gtcatttgta
    58501 ggggcggctg ataacactag tagctctgac aaatagattt gtaggagcga ctcgtttgga
    58561 tatcatttgt aggggcagct caatatcgag ccaccctaaa aaaaaggtga cgttgctacg
    58621 aatccttttt taagtagtga tttggatgag acatggctaa aagttagcac tgtgcatcag
    58681 ataggcccta aacagttgga gtacacgcaa ttatttgcag tacatctggt aattagctag
    58741 tttgctatat aggcaatatt tgttggtaaa tgtagtaata aaacaatcat ggatgatgat
    58801 agaactgtgt cgagctatgt atagcactca aagaaaagta agagactaag acagtcgacc
    58861 gtaacctaca tatggtgagg ccaacctgaa aaagagaggg gaaaaaagtg gtgataacaa
    58921 gcgctacatc aacctcatta ttgatattat aatatttatt atgtgatgct gtcagatccg
    58981 ggccccaggc aagtgatggc aaaaatgctc tgaattggtc ttcaatttaa agaggcaata
    59041 tggttacgta cacacataat tctttttaaa atgtgttgag cacagtaacc tctatcaaca
    59101 agcgtacatc tgcaacggat ttcaagagaa tgagctaaca aatcttaata aggttaataa
    59161 aagtcaccgg ttatgtcaag gataggcggc atattttctt cggatgctcc tccgttgctc
    59221 agttctggga tgaaaacgga tcggatacgg acggatatca ctgatatcgt atttgttttc
    59281 gtatttatgt ccggattcgg attcgaatac ggatagtata aaaaatgacg gatagaatac
    59341 gattggatat cgacatcata aatatgtgat ttaaatattc ggatacggat acggtatcgg
    59401 atgttaaata tccggactcg gatacggacg gattaaaacc cctctaaacg gattcggtct
    59461 cgaatacggt cggaaaatat ccgtaccgtt ttcatccctg gttctggccg atgttgggaa
    59521 ttgtatctga acgattgtaa acactccgct cttgtacccc ctacgcccta tataacaacg
    59581 agttctgtaa cgactttctg atcttgggtt aataaaattt tccaggtggg gatccttctg
    59641 tatcgctgcc tatgcatgaa ttattgaaat aatctctaca cctaaaaata cctactgcta
    59701 tcgtctgcgc acaaaaccat cgccccgtct caccttgcct ggcgagcgat ccgcgcgcac
    59761 cacgcaccac caactaggtt cctcacgcct tgcgtccggt cagaactctt ctttattacc
    59821 caaaccagaa ttacttttaa tcacccaacg tacaggacat aggactcttc atagcctgtt
    59881 cggattatag aaaaagaaac ggaaggagta tcatcatgca tggcaggcca gagtcattaa
    59941 acgtgcatcc atggctaaca caattttcaa attaagcaat tataatgata catgcaatat
    60001 aatttatgga aaagaaaaaa taataaaagt aaaactaaaa aaagagtgat aaactcctta
    60061 cgtgacaaaa taaatcaact tcctgaaaaa taaaaaaatg gcttaagtat gataattagt
    60121 gcaagtattt tccttcgaat tttgtatgtc cgtgactgat tatttagttg ttttaatctc
    60181 atcacagata aatagtatgt cagactaaaa gaagttcacc ttaggatccc atagtcatcg
    60241 gtagaaaata atttcctcaa gttcacttag atagttttga tgaacaaagt tgttacacta
    60301 tgaactagat tattttgatt ttacatgatc acatcaaaac ttgaattgca ttctaattga
    60361 acatgaatca taaggacaga tctagctaca aatgtaatgt tgtgaatatc taagtatttt
    60421 ttggtaatat gataacacac acagttaaat ttaaactatc gtggtaattt taattcccgt
    60481 gcaacacacg ggcatgattc tagtatttat taaaaatctg atcactgctg acaaagacat
    60541 ataatgaaat aataattaag taaatatacg atcatcgctt gtgtacttct agaccattta
    60601 ttgtgatcgt aagagagaat tggatgttgt ttccaatata aacagggggg attgaggtat
    60661 tccttaattt ggtcgaaaag gttcagctgg accacgtgat gtttctttca caaaaaaaaa
    60721 cataagtaca tgatgtcaat ttgggatgct tttttctgtt tagagaggaa aagataaaac
    60781 agtatgtata taacaagacc gaaagtatta ccaatagtcg aactgataag tttctatgcc
    60841 tcttgatagc aaaatataag tgatggcttc gtcgatctca agatttggtg gttcagtctc
    60901 ggcctctcga gaatagtcat atggatagca aaaatactca caggagtaga gtatgtgcat
    60961 actgtcctta ggagtgagtg gcgtctctac catgattcgc caaaaaaaag accaattgaa
    61021 aacagaacgg atctcttcct ctcgtttttt caacaggcca gtgattttgt aatattttgt
    61081 taaatatcta ccacaacaat gggtaattag tttcttatga tcaatattgt caatatttac
    61141 ttcctcttaa tgaaaaacgt ggaacaccac tgtcaccaaa aatgttgtta gtaatttgtt
    61201 aaacctacca gtaaagatat gtacggcatg taagaaaaac tgtaaataat catcggcaaa
    61261 cggtgtgtag tttacatggt gatgaagcag agctgaaaga gcaaggtaca tgtcgggttg
    61321 acaaacgccg agcccgttcg ctttgctgaa aagtcatggc tgaaaatact gttcgttgat
    61381 ttgttgtaag agaaaaacac tgttccagct acaaaaacaa gctaaaaaat acggattata
    61441 aagcgaacgg ggccgacatc aaccacacac actgtcacac acgtgatgta agagatgagg
    61501 atcgaagtcc tcattattga tgctgtctgg gccctgggag cagcagatgg agcaatgatt
    61561 caggaataat gtccacaccg taccacacat atgggaggtt gaggctgaga ctgagatgca
    61621 tgcagctgaa ataagctaag caaacaggtc gatgccccag aatttggcag gctggttagt
    61681 ccggtagttc ctatcgacgg ccttcatctt ctccatgtcc tcgctggaga tgtcgaaatc
    61741 gaagacctca aagttctcct gcagcctctc caacttggag gtcttgggga tcaccaccgt
    61801 gttccgctgc agaccccagc ggaggacaag ctgcgccggt gtattgccgt acttctcagc
    61861 caagctctgc aaattgtatt gtagccacaa tgccaagtta gcagatcaca ttggcaccag
    61921 aattgatgat attgcaaggt aaccaaataa aatgtactcc tatgttaaac aaggatgatg
    61981 atgtaatgga gatttgaaat gacaaccacc ttgatgacag ggtcgtcgag gcatgagacc
    62041 gtcccgaacc actcggtgtt ggcagtggag ccacccaagg gggtatgcgc ggtgacgcag
    62101 atcccatgct tctggcagaa cttgacaaga gaatctcgct ggaagtaggg gtgcgtctcg
    62161 atttggttca ctgctggctt tatcttggcg taggccaagc agtctctagt gaggaagatg
    62221 tcgtagttgc tgcaccagta aatcgataat tattagtatt gttattattg taaaaaaagt
    62281 gacttcctcc agcatgaaaa agtagactga aaatctccga gcatgtaaaa agtggcaaca
    62341 agaaaatttt agtgtaagct ttattatatt cgaattcagg ctattttgaa actaaactac
    62401 tctttcaaga ccagcaatat tcctagtaca aaagggctgg caaagactgc tcaatgtctg
    62461 caaacaaggg attagggcaa aacaacaaac atgatattgg actgcatagc cgacagccat
    62521 ttttacaggt ccttgaagac agacaaacaa gatccaacac cctaacagag ttcccatttc
    62581 cccaaagaaa gaactaggga tcaatgaaag aacataagca aatattaacg gaaactgaaa
    62641 tttgtaatga aggcagcaac ctaaacttta gtttaacatg attaatacat tcatgattct
    62701 gcttaagcat ggaccaagga aatttacaag aaaagcatgc gcttttcact agaaaaggga
    62761 tggagataaa gtggagggtg acaagagtat ggaatgagtt tgcatgcaac catatgcaat
    62821 gaaactgaag agagaatctg gaaggaccaa accattctga acatgctgca gttaaaagga
    62881 acatgtagat caagcaagtg tttgcactgg aaaatttaag ggaacacata tgaactaaat
    62941 gttcctgtat gtgcaaaact cttgactaca gcaagatcat atttatctac tacttcctcg
    63001 caaaaaagaa aaattatcta ctactttgtc aatgtaatga attataatac aaagggaagc
    63061 ttgccaagac taataaatat ctcaaatgtc aaatggtgcc aacaaaacaa agaaaaatgt
    63121 tggttcggtt tacctgattc caatgctgcg caccagtccc atggaaacaa gttcttccat
    63181 tgcatgccat gttgtttcca atgagatagt ggtatcaatg tctagcacac catcatcacc
    63241 aagggcgcta gaagttgtgc caactcctgc agaaatacac atatctgtga ggtacccact
    63301 gaatctttct aaatattatg caaagggcaa ggatattacc tgtatgccta gtagctactg
    63361 ggaagtgaat aagatagaga tctagataat ccagctgcag cttcttcaag ctatccttgc
    63421 aggcttcaag cacatggcca tgatctgagt tccacagctg caatgagaac agatgccaac
    63481 tttagatcac atgaagatca tggagcagaa tggggcaaaa aaaaatgcag tggaatggaa
    63541 actcagaaat ctgctaatta aaagacagtg acatcctggt tgagtcaaaa tcaggtgttc
    63601 cagtttaaga caagacaact ttagtttcat ttgagtgata tcagggttct gatgacacta
    63661 catgctggcc ataacaccat aacaattcca aatatgctaa aatgcagagt aacaattgga
    63721 attaagtatg actgactcat tttcagtagc cgctgaatgc taaaaatggt tgggaaacca
    63781 accgctgcaa tcctttcaac caattcatcg ggcataatct taatggtcac attcatttgg
    63841 aaagggcagt tttccagaat acagaaggta gcattctgta atttagataa ccttggttgt
    63901 gatgaacaga tcctccctct tgacaagtcc ggtctgaaac gcctctgcga gtgcgtcacc
    63961 tacttcagct tcattctggt agtcagctgc agagcaagtt accaaacaca gagacagtaa
    64021 atcaccaagt agaaaaagga aaactcctgt gccgacacta gtagttgaga ccatattagc
    64081 gtactccaca attgacaaag aaatctaaat catggacagc acagtgcggt gactaagcat
    64141 gcctgcatca ttcatactat gaatcaagtg tttatcaaga caaacagaaa agtgattatc
    64201 taattgacac atagacactc atgtggcact gaaagaaaca ttcaataatt tgattgtaac
    64261 attcagacaa gcaaacagac ctagtgtttg tctagacaaa aggaagattg atggacacgc
    64321 aaacactcac gaggcatcga aagaaacatt catcaatttt gatcggtaca gtacacagac
    64381 caagagtggc aaagaaatca tgctcatcta ataagcaaca caacacaccg tgtaaccacg
    64441 cctgagccat cgataatgtc agtcagtctc tcagacaact atgtacaaat ctgcgagtat
    64501 ttgtacctag ttgtctgaca gaattaccaa attcatttat gtagtcagct ggagaccacg
    64561 gtagacaaac ccaacccaat agtgaccgtc tgatcggcac acaaacacac tcatgtggca
    64621 gtgaaagaag cactcagtaa tttgatcgtt acagtacagc acacaaagat cgcgagagaa
    64681 acatcgccat tgatagttag cattattggc aaaggaatcc cggtcatgta acgtacgaca
    64741 tggaaagcgt gctgtcttaa taagcataat aagagtgtac tgcttgactc gtcaaaacaa
    64801 aaaaggaaaa cgaagagcgc tcaacacaca agtacaaaca gtcagtgttt tggatcggta
    64861 cagtacaaca gacgatgatc gcgaaagaaa tcccactcat ctcatctcat cagaatcagc
    64921 aacgataggg cactgttaag cacgcctgca tccagctcga gacaaggatt tggcacttgc
    64981 caggacaaga gcgcccaagt gactgagaga cgcgaactgc tacggcgtcg agcgaaacac
    65041 gggggccctc gacctcgacc caactatcca tccgatccgt acgctgatgc cagcacggac
    65101 agggccggcg attcgcggtg ggtgggcggt cgggtaccgg ggggatttcg cttaccggcg
    65161 cagtccaagt ggcggtagcc gacgcggagc gcggcgtgga tgaggccgcg gacgtcccgc
    65221 ttgtccatcc gccacacgcc cagccccacc gccggcatcc ggtgcccgct gctcagcgcc
    65281 accgccgcgt ccttcgccgc cgccatggcg ccctcctctc aggccctcac ctccccccgc
    65341 gcgcggatgc tgctggattg ggcggccgct tcgcctcgct cgttggcagt ggcagtggga
    65401 ctcttaagtg tttgcttctt ttggttttta ttcgttgttg actttttaat actcctactt
    65461 ggatattccc gcttgacgtg gcgtattctg aaccattaca gtgggccggc cctggccagc
    65521 aggaggctgt gcagcctgcg agatcaatta ggcctcgttt agattccata attcacccta
    65581 aattttacta taaaaaagga gattcctcat cacatcaaaa tgtcggcaaa tgcataaagt
    65641 actaaatgta gatgaaatca taaactaatt gtacagtttt gttgtacttt acgagacgaa
    65701 cattttgagt ctaattaatc aatttttaga taatttttta taaaaaacaa aagtgctaca
    65761 gtgttcaaag atgatactat acaaattcgg ccatcccgaa tcaggtaact aaacaaggcc
    65821 ttagtttaat tgggccggcg gcaggatgtt ccgtgaataa caatatctcc attcggtttt
    65881 taacacttga agggtgtcgt gtagtgccta ctgcctatga atctatgatg ggagttggaa
    65941 gggacagaga attagacttc ttcagaatga aggccctgtt taagacattt tttattttca
    66001 aattcaaaat agctctagct tctagagaat attttgtatt gtagcaagaa attgtttttc
    66061 tctatctcca ctacttcata aatgatttta agagacggtg cccaaatatt aacggaggcg
    66121 ggcacaaaat tcaaacgcct cctaaaatat taggctatta acgtaggcgg ttaattttat
    66181 ttaccgaggc ggtcactttt gcctgcctcg taaaatcgat taacggagat gggcctccta
    66241 aaatagattt acggaggtgc atgccatttt cgtaggcgag cctctaaaaa ggccagcctg
    66301 ggaaaataca catgaggccc aacaaaaacc cattgctaat acatctatcg ggctcatata
    66361 taaatagaac ttagggtttc attgtaacag aaccgatcaa ttatacgaaa ttaagtaaga
    66421 aaatcatcta tcaagcagac gatttagcaa acttaagccc gtataacccg gtagtccgtg
    66481 aaatcacgac ggatttcaaa ccaacttaca taccagccaa gatcgtaata agtttagcgg
    66541 ccaccatcac aaattacata gaagttcacg tcgcagatac atcggagttt aaacatagtt
    66601 attacaaacc aagttcaaat aaaagtagcg gaagcattta gttcaaacca cacacactca
    66661 cacagagttc gaaataaatt gccaactgct gatcatctcc aacaaaagca tcagacgaga
    66721 agtagggaat gaccactccc catggtccta agcttcaccc atcgtaggat aaaaggcagt
    66781 tgatacagta gccgtaatac atctgcccat ccgcaacaag tgggaacaaa accctgagta
    66841 cgagaaggta ctcagctaga cttacccgac ataaccaaaa ataaaatgac accaaggatc
    66901 atgacagact tcttggtagg gtagctgact catttgcaaa aagacatttt tagcatttaa
    66961 ataatctttt ccataagctt ttatatcaag ttaaatcttt attaacctgt caactacatt
    67021 tacacctgta ctagagtaac atataattaa aagtaaggat aaccaatgat tattaacaac
    67081 tctcatcatg tcatatttca tataactgtc caagtgttcc atcaatatta ttacgatgaa
    67141 gtaactcaag tcaagtgttc actatccagt gaacgatggc gattcgaatc gattattaac
    67201 cagctgataa tttattcctc acacaaacct cactcacccg ctaaagtgag atattggtca
    67261 ccgagtcaac tattcaggta aagtatcgag tttgccagga accacatgta cccgggggcc
    67321 gcccgactgc tctttggcct tatcatcgcg cccccgtgtc ctaccacacc tgctctagta
    67381 cagtgcgttg cgagcaatcc actcggcccg aataatcttc tagcttcgcg gtcgaaaggt
    67441 acattattcg gccagctaaa tgtaaggcat gcgttcaaca tgactcgagg cccaacaacg
    67501 gtcggttctt aaccgacaca gacagaaaac actacagtct gaaaccctgc aagtctccgt
    67561 tcggtctcaa tttcacatta acacttagtt attctacgat gacatactta ttcaagcaga
    67621 tccaggcaac cacctatagc tcgcaggtga caggaaatca ctcgacttct actggtctaa
    67681 gcaagctaag catttcttca ctgtgaatac caatataaca aggatatggt agaacaaggg
    67741 taaacaaggt ataatgcagc aatggttgca aacaactcct aaacgtaatg catcagttaa
    67801 agtaaagcat taataaaata tttgcaaacc gggagagaaa tgctccgggg cttgcctctt
    67861 tcgaaagagc tcgggcggtg gtcggggcac tctgcaagat cctcaccgac ctcctcgtcg
    67921 gcttcgggca cctcctgctc ttgcacctcg ggctgctctt ccggctcctc ggaaactgct
    67981 gccggagtta cttcttgtga tcctgtatga tgcaaatgta taagtgctca tgcctaggtg
    68041 cattgcagag atgacatgta atgatcatga tgaatgagat gtagatgaac atgtttactt
    68101 tattgcataa agtaggaata caactcttct acaaggtagt ccacatcatc taagaacatg
    68161 tactcgtata ctactacaaa cattctctac catgccaagt catcctagaa atctaagatg
    68221 ctttaaagat acaacaaagc aaatcttatc aaataatctt gtattaataa ggttaattaa
    68281 accctagttg acactatgtt tgaatagcaa tacttctttt ggtagcatag aaaaatctga
    68341 taaaattaca gtagcttgct agcatctaat ctagcatgcc acaaaaattt cattacattt
    68401 ggagtactag aactgcctac acaaaaataa caatctaagg cctaaaaatg agcataaaaa
    68461 tactttacac tatgaaaagt atcaaacaac agatttagca tttttcctac attctacaca
    68521 ataaacaatc actatagaaa aattattgta tgcatgtttt attcatattt ttctctctat
    68581 caaaattaac aattattaac aataataagc acttgtacta cacatcaaaa tttttctaca
    68641 taacatgcgt ggcacatatt ttttatgcaa agcacatcac aaaagaagac taacaaactt
    68701 ggaaccatat ttttctgata catattatat ttattataca ttttctaaat aattagcaat
    68761 tacaaggatt aaataaaact ctacagaaaa gtatcacaaa atcaacatgc aatattttat
    68821 gctatagatc tagtcatgag gaacataaca aattttgttt cacttgattt ggagcactgt
    68881 agagcaatct gtgatttttg gaagcattta catgaaataa acaaaatcat ttctcttttc
    68941 tgatctgaaa aacccaaacc caaacccctt actgggccag cccacggaag ccagccgacc
    69001 cacggccgct ttcagcccac gaaggaggca gagcagggga ggggacggcc ccgcggcgaa
    69061 gctcgctgtc ggcgaggttg ccggcgatag ggtcaccacc tccgtgctca gcacgagaag
    69121 gcgaaccgac cgaggtagaa atggcagcgg cttgcacggc ggagcgcgct cgccggtgac
    69181 aacggcgggc gacagcgcgt ttgcatggtg gagcagagaa attctggcga accgggtccc
    69241 cgacggcacc aaaagctaag gcttcagcct cgcttggacg aggcggagcc gatgcgcacc
    69301 aaacgggaga gagaaagggg atggagccgg ggtgtccatg gcgagcacga gctcggccat
    69361 gctccgacga gcggcggtgg aagagaacgc ccaatagggc ctcacctcgg cttaaacggt
    69421 aaaaccgccg cgagcaccgg gtgtctaaga gggaggcgga gacggagccg agaccaatcg
    69481 gccggaggcg agcggtggtg gccggaacga cagtggcgag ctccggtgcg gtggcgaggg
    69541 aggggctccc gctcgggatt ttgaaacggg agagcaagag ggagaaagag cgagagtgga
    69601 gaaagaggct cggacagagg tgctttgaag gcggggcgaa gccggtcgga acgggcaggt
    69661 cggtggcgcc gcacggcgag ctcgccgtcg catggccgcc acacggctcg cgcgttctgg
    69721 cgcggtcgga gcatgggcac gctcgcgcgg tgaaagtctc tagtttggtt ttggctaatt
    69781 gatgaaacct aggactaacc tttgtatcta agtggatgat ttagataaag gtggtcattg
    69841 catatgagac atgacattga ctcatgtgac taagatgatg aagaccaaga tgaggcttgg
    69901 ctcgatggac cggttgtaga gggtgaaggg caagttgagg cttcgaagtg agggaccatg
    69961 cgatggtgaa gcttgagcaa gacttggcgc cgacggaccg atgcaacggt gaagagcaag
    70021 taaagtcaag gtcgatggat cgagacggtc atgtgatgat atgaagtgga tcatatcatt
    70081 tggagaaaca aaatgggctc aaggcaaagg tataacctta gggccatttt gttttacact
    70141 caagacacca tagagggtgt gagtggttta ggatcgatag ccgaactatt aagaggggaa
    70201 gtcttatcgg ttattcgatg cacgggtgcc actaggtgaa ttcatgaagt gcattgcatg
    70261 tagggcctag tgagctaact ggaaaacctt tgaaaatgat tgtgaagatg ctaacacacg
    70321 tacacaaggt ggtgatcact tgttggtgtt ggcacattta cgtaggcgtt gaagtttggg
    70381 tggttgagag ggtttggggc tctctctccc tcccgccgag cttgcgagcg cgggattcag
    70441 gcgttttcga ggagttgaaa agcctatttt ccactacgcc ggaagtcgga aaagaaacgg
    70501 aggcgaacgg ggtcactgag gtgaccggac gctgcaccgg acgcggtcat ggaatgaccg
    70561 gacgcgtccg gtcagctgtc aggcgcgcgg gctagggttt gcaaccggcg cgtccggtca
    70621 ctcgcgagac cggagcgtcc ggtcatgcgc ccagaaggaa ctaaggttca cagaggacga
    70681 tcggacgcgg ggcgcgtccg gtcacacacg atcggacacg tccgatcgtt gaaggagctt
    70741 actggactca aaccggacgc gggcactgtc gcgtccggtc atcgcaagga gcgcgtccgg
    70801 tcgttgcgtc gcgggcgcgt gggtcagtgc gatcggcgcg tccggtcgtt cgacaggcgc
    70861 gtccggtcat cgggaccggc gcgtccggtc gttcgaagca gcgcgtccgg tcgttgccta
    70921 gggcgcgtcc ggtcgttggt ttgaccgttg agggtcagtg accgttggag gatcggacgc
    70981 ggttgagcgc gtccggtcgt tttgagaggc gcgtccggtc atggggtttg accgtttgcg
    71041 cagtgaccgt tggaggatcg gacgcggttg agcgcgtccg gtcagttatg accggagcgt
    71101 ccggtcatcc cgacagaacc cagtgaaggg gtataacggc tctatttgga ggggatactt
    71161 ataaatactc gttggccggc ccgtggggag gtaactagtg atttctaaca ttcttgtaca
    71221 tcctttgagc tagagcatct cctcccactc atctctcttg agtgattgca aatcataagt
    71281 gagattgagt gatcccaaag tgcattgcat agcttgaggg catctagtgg cacttgtggg
    71341 tggtttagcc ggtggatttc ttgttactct tggagagtac cgctcctagc cggcttggag
    71401 attgttggag gcgttggcaa gagaaggtga ttgttcttgg ccacctccgg ttgattgtaa
    71461 gaggttcgtg tgctttcctc ggcgggacgc caaaagcaac tctagtaaat tgcgcgtgtc
    71521 attgagttac ctcacttgag agtggtgtct tgtggtgcct tgcggggcgt gccttgaggg
    71581 gcaagtgact tgagggtcgc accgaggaac catctaagtg ttggtcgaca caaccggtga
    71641 cgtagcttgt cggtgcacaa gtgaacaccg ggtgaacaaa atattgtgtc tcttgtctcc
    71701 cggtgattgg tctccatatt gtgttgttgt taatattgat tgattgtata tcatcttggt
    71761 gattggcaac atcttcactc caccgtcggt ataagattca caatcctatc tcttgcattt
    71821 acttttacta gattatcttg tgtaagctct agtggtagcc tttgctagtg ttgttagctt
    71881 gctcactagt gtaagtttag tgacatagct cttgtgtgaa ctagagatca taatctacta
    71941 gacttgtgga taggaggctt gcatcacaac tcttggctaa gcaaaactcg ctttacgccg
    72001 tttgttattc taacaagttt gcttagtggc ttgtgtagaa tttttaatag gctattcacc
    72061 ccccctctag ccatctagga ccttacaagt ggtatcggag ccgtggtcac cgttttaatc
    72121 aaggcttaac atccttcggt gtgaaaaatg gctcaaattg tgttcaatca tgttgggggc
    72181 aagccaccgt tctttgatgg tgttagttct tttgctcatt ggaagagaaa gatgacaatg
    72241 taccttggtt ctattcatga gagagttttg catgtcaccg agaatgactt tgctatcatt
    72301 gatcccgatc atctcaccga tgaagataga gcaaatagaa catgcaatag aatggctctc
    72361 aatacacttt accatggtat tgacacaaaa gtgtttgagg gcatcaagga cttagaattg
    72421 gcatatgaag tatggacaag gttgagtgaa acatatgagg gcactaaggt tgtgaagagt
    72481 gccaagctat atgggctcaa gagtgatttt gagaacttca agaaaaagga tgatgaaaca
    72541 atcattgaaa tgtttcatag attgcaagta attatgaatg atctcaagag cttagggcat
    72601 aagactcaag accaagattt ttgccataag ttcttgttga gcttacctag aagattcaag
    72661 atgttgatca tgatgctaca aagagatggg cttgaaacaa tgaagccaaa tgatttgctt
    72721 ggagaggtat taacctttga caagtatgat caagatattg atgagaagga ggaagaaaag
    72781 aagaagaaga ccgtggcatt caaggccatc tcctccaagg gcaaagctac catcattgaa
    72841 gaagaagaag acaatgatga agatgaagat tatgaaattg atgatgaggc atttgctttt
    72901 gtagtcaaga aaatgggtca catgttcatt aagagaagag gcttcaaaaa gagaaatgac
    72961 aatttcaaga gcaatgagca acaaaggaag tgcttcaatt gtgatagcac cgaacatctt
    73021 caagtcgatt gtccctatga caagaagaaa aacaacaaga ggggcaagtt tgagaagaaa
    73081 aagaaagaaa ccaagataac attcaagaaa ggcaagaatg gagtctatgt ggccacttgg
    73141 aaaagtgatg atgatgaaga agaagaagaa tcatccaaca aggcttttgc ttccattgct
    73201 atcaacaaga agctctcact atttgattca tcctcttcat gcttcatggc caaagaagct
    73261 aaggtattat atgatgagag tgatgatgaa agtgaaatgg aatatgttca tgatagtgat
    73321 aatgataata ataatgataa tgaaaatgat gatgatgatg aaccaactaa agaacaacta
    73381 tatgacttgt tgcaacaaac tagagacata gctattgcca agaacaatga gtgcaagaag
    73441 ctttcaatga aagtagcaat acttgagaaa gttcttggtg agcttaagac cactcatgag
    73501 agtctagtgg aagaccatga ggatcttgat aaagctcatt ccaagcttga aaaagctcac
    73561 tcattgctac ttgagcaata agcaaagaag gaggttgttg tatcatgtga tataggtgtt
    73621 acatgtgata taattgatga atctttttat aaacctatca tcatgtcaaa tgctaaccct
    73681 tcttgtagct cttcatccac caccaccaac tctacctcta ctactagtga tggtttcact
    73741 tgtgatgcct cactaatggt tgagaatgag actctcaaga gagaggtgga tgagctcact
    73801 cacgccctag gcaaggccta tggtggtgag gcccgcttgc ttaagtgctt gggtagccaa
    73861 aggttctctc ttaacaaaga gggattgggc tataacccca agaaaggcaa gtcggccttt
    73921 gcaactccaa agcctagctt tgtgaagagc aatggtcggt tttgcaatag atgcaagcaa
    73981 gttgggcacc tagagcataa ttgcaataaa aagaaccaaa gcaagaacct tattaatgct
    74041 ataccttatg attcttgcta tgtgcttacc aaaggtgtga agggtgtgca agctaagttt
    74101 gttggtacac ccattgttgg cccaaagaag aaggctattt gggtaccaaa gagcttagtt
    74161 actaacctac aaggacccaa gcaaaaatgg gta
//