LOCUS       KP063111              127624 bp    DNA     linear   PLN 10-NOV-2014
DEFINITION  Saccharum spontaneum clone SES-208_23k06 genomic sequence, complete
            sequence.
ACCESSION   KP063111
VERSION     KP063111.1
KEYWORDS    HTG.
SOURCE      Saccharum spontaneum
  ORGANISM  Saccharum spontaneum
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; PACMAD
            clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae;
            Saccharum; Saccharum officinarum complex.
REFERENCE   1  (bases 1 to 127624)
  AUTHORS   Zhang,J., Yu,Q., Sharma,A., Wang,J., Zhu,L., Li,L., Chen,Y. and
            Ming,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (27-OCT-2014) Center for Genomics and Biotechnology,
            Fujian Agriculture and Forestry University, Fujian Agriculture and
            Forestry University, Fuzhou, Fujian 350002, China
FEATURES             Location/Qualifiers
     source          1..127624
                     /organism="Saccharum spontaneum"
                     /mol_type="genomic DNA"
                     /cultivar="SES-208"
                     /db_xref="taxon:62335"
                     /clone="SES-208_23k06"
     gene            <3129..>3941
                     /locus_tag="SES23K06_001"
     mRNA            <3129..>3941
                     /locus_tag="SES23K06_001"
                     /product="hypothetical protein"
     CDS             3129..3941
                     /locus_tag="SES23K06_001"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AIW39757.1"
                     /translation="MESLSSVHTIMEIVQDILAAVETASQNKSRCRKVAERVRCLKDI
                     LEAAQDGTTTAAAVATDAAATRRLLDRLEEALGRALQVVRRCQRGSSSFLRSVIVVVA
                     GGGRMADPLDGVEAEIDRCILDLAVANSLRIARLETLLVRQQHTVAVAASTEAHSEKD
                     DENERKKKGSADESVPEKMMDHDNTTATTAIGVPVCTVTAAAVHEHEMVPPPSYEYGY
                     GYGYRSYHSYCRNHGCACDCGCWDDNAAFYHTQYSSYPSMFSDDNPNSCSIL"
     gene            <7840..>9034
                     /locus_tag="SES23K06_002"
     mRNA            join(<7840..8152,8247..>9034)
                     /locus_tag="SES23K06_002"
                     /product="putative histone-lysine N-methyltransferase"
     CDS             join(7840..8152,8247..9034)
                     /locus_tag="SES23K06_002"
                     /codon_start=1
                     /product="putative histone-lysine N-methyltransferase"
                     /protein_id="AIW39758.1"
                     /translation="MGAAGQLRRRTRARTPPGPRLEAAAAAGDDDDDVRCEACGSGEA
                     APELMLCDGCDRGFHIFCLRPILPRVPAGDWYCPSCRGPASSKSQSAAAAAHTVVAKK
                     PKQFPLVQTKIVDFFKIQRSPTPADASEELKKRKRKGGGTLVASKKKSRRLLPFIPSS
                     DPAQRLRQMASLATALTATGAAFSNELTYQPGMAPRSANRAVLEAGGMQVLNREDAET
                     LARCQRMMARGEWPPLVVAYDPVEGFTVEADRCIRDLTIITEYVGDVDFLRNREHDDG
                     DSMMTLLSAASPARSLVICPDRRSNIARFINGINNHTPEGRKKQNVKCVRFDVGGECR
                     VLLVANRDISKGERLYYDYNGSEHEYPTHHFV"
     gene            complement(<10757..>13970)
                     /locus_tag="SES23K06_003"
     mRNA            complement(join(<10757..10787,10875..11249,11386..11621,
                     11710..11822,12091..12105,12936..13042,13900..>13970))
                     /locus_tag="SES23K06_003"
                     /product="putative arginine/serine-rich splicing factor"
     CDS             complement(join(10757..10787,10875..11249,11386..11621,
                     11710..11822,12091..12105,12936..13042,13900..13970))
                     /locus_tag="SES23K06_003"
                     /codon_start=1
                     /product="putative arginine/serine-rich splicing factor"
                     /protein_id="AIW39759.1"
                     /translation="MRTPSRPFLLRETERPNPNFELSGMRPIFCGNLDYDVRISEVER
                     LFGKYGRVERVDLKTVERSGGFAFVYMEDERDAEDAIHRLDGIDFGRKGRRIRVEWTK
                     EDRTVGRRGSSRRSPTNARPTKTLFVINFDPINTRIRDLERHFDKYGRVANVRIKKNF
                     AFVQFEVQEDATKALEGTNGSHFMDRVISVEYALRDDDEKGERGNGYSPDRRARERSP
                     GRRRSPSPYGRGRERGSPDYGRSKERGSPDYGRGGRSPDNGRGVSPINGGRGDHGRGG
                     RSPNYDREHREASPRRERREASPGYDRSPSRSPGRDERD"
     gene            complement(<15787..>24498)
                     /locus_tag="SES23K06_004"
     mRNA            complement(join(<15787..15852,15941..16051,16211..16264,
                     16528..16580,17457..17541,17807..17902,17978..18070,
                     18345..18401,24026..24175,24262..>24498))
                     /locus_tag="SES23K06_004"
                     /product="putative dimethyladenosine transferase"
     CDS             complement(join(15787..15852,15941..16051,16211..16264,
                     16528..16580,17457..17541,17807..17902,17978..18070,
                     18345..18401,24026..24175,24262..24498))
                     /locus_tag="SES23K06_004"
                     /codon_start=1
                     /product="putative dimethyladenosine transferase"
                     /protein_id="AIW39760.1"
                     /translation="MVALSSLSPGPPRPSPSPATTRRRPPPPTPHVHTSSRLRGRTLR
                     AATAAATTPGADDYHSTIRSLNSRGRHVPRKSLGQNYMLNSKVNEELVAAAGVEEGDV
                     VLEIGPGTGSLTAALLQAGATVFAVEKDKHMATLIKDRFGSTEQLKVIEEDITKFHIR
                     SHFLPFMKEKYHATKKLAKVVSNLPFNVSTEVVKLLLPMGDVFSVVVLMLQDETAVRL
                     ADTSIQIPEYRPINVFVNFYSKPEYKFRVDRENFFPQPKVNGAVISFKLKNAEEYPPV
                     NSAFMGKRKMLRKSLQHLCSSSEIEAALDNIGLPVTARPSDLILDDFVRLHNHLTKV"
     mobile_element  19005..23809
                     /mobile_element_type="transposon:Mu"
     gene            complement(25892..32845)
                     /locus_tag="SES23K06_005"
                     /pseudogene="unknown"
     gene            <49960..>54501
                     /locus_tag="SES23K06_006"
     mRNA            join(<49960..49968,50137..50312,50427..50436,50746..50919,
                     52984..53147,53246..53333,53533..53586,54412..>54501)
                     /locus_tag="SES23K06_006"
                     /product="putative cell division control protein 2-like
                     protein 2"
     CDS             join(49960..49968,50137..50312,50427..50436,50746..50919,
                     52984..53147,53246..53333,53533..53586,54412..54501)
                     /locus_tag="SES23K06_006"
                     /codon_start=1
                     /product="putative cell division control protein 2-like
                     protein 2"
                     /protein_id="AIW39761.1"
                     /translation="MDQTEKIGEGTYGVVYKGTNRHTNETIALKKIRLEQEDEGVPST
                     AIREISLLKEMQHRNIVRLQDSYLYQILRGIAYCHSHRVLHRDLKPQNLLLDRRNNIL
                     KLADFGLARAFGIPVRTFTHEVVTLWYRAPEILLGARHYSTPVDVWSVGCIFAEMVNQ
                     KPLFPGDSEIDELFKIFRILGTPTEETWPGVASLPDYKSTFPKWPSVDLATVVPTLEP
                     AGIDLLSKMLRLDPSKRINARAALEHEYFRDLEHAY"
     gene            <57014..>60792
                     /locus_tag="SES23K06_007"
     mRNA            join(<57014..57082,57495..57552,58926..59139,59230..59555,
                     60072..60304,60431..60498,60582..60643,60731..>60792)
                     /locus_tag="SES23K06_007"
                     /product="putative shrunken seed protein"
     CDS             join(57014..57082,57495..57552,58926..59139,59230..59555,
                     60072..60304,60431..60498,60582..60643,60731..60792)
                     /locus_tag="SES23K06_007"
                     /note="similar to Sb04g001930"
                     /codon_start=1
                     /product="putative shrunken seed protein"
                     /protein_id="AIW39766.1"
                     /translation="MEAYKLWVRRNRDLVCSLESLANGLTWILPERFANSEIAPEAVY
                     ALLGVVSSVNQHIIDAPTENHSFASKEQSIPWGLVVSVLKDVEAVVEVAAQHFVGDDR
                     KWSFLAVTEAVKAGVRLAAFRESGYKMLLQGGEVANEEEVTVLENNYGVNGNGVPAIY
                     PMDGYAGNGHKAMTKGLDGKNGSVSKSLEKRAVAALNKFGENAKMMSDPMWIRRLQPT
                     PEPTVMVAEKPTLASIWSAKGGTGRLFVLGEVVHIFRPLVYVLLIRKFGIKSWTPWLV
                     SLAVELTSLGIHSHVTDLSHRLRKLKRRKMMWALYLMRDPFFASYTKRHLQKAEQVLN
                     PVPLIGFLTGKLIELLEGVQTRYTYTSGS"
     mobile_element  complement(65152..71816)
                     /mobile_element_type="retrotransposon:copia"
     repeat_region   complement(65157..65604)
                     /rpt_type=long_terminal_repeat
     repeat_region   complement(71366..71811)
                     /rpt_type=long_terminal_repeat
     gene            complement(<72414..>75395)
                     /locus_tag="SES23K06_010"
     mRNA            complement(join(<72414..72677,72957..73202,73280..73427,
                     73538..73688,73784..>75395))
                     /locus_tag="SES23K06_010"
                     /product="hypothetical protein"
     CDS             complement(join(72414..72677,72957..73202,73280..73427,
                     73538..73688,73784..75395))
                     /locus_tag="SES23K06_010"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AIW39762.1"
                     /translation="MTTAPPRPGPAAAAAAVHLADHLESATFAPPPPPPPPPSPTTIL
                     TAWSRLRDASTSPTDALAALETLHHHRRALRLSSAHASLLLPLLPLHPRLVAPLLAAA
                     PHLVPASVPASLPFAPRLLLLGARASAKDLPGHAGYGKPTSTAKNPAGSGEPADGHDD
                     DTVVAVSRILEDVERGDQSADDLDHLALTGVGYALVSADEVQFRRILVSLLRICGRTG
                     NLATGVRVLKLMEWLVMGFVEARKMRKVQVLFELISPETCEGEDYVLFPVVMAACGGL
                     RALRVASARYRLDFDPRLKEAPERTIQFVAERAVLEGRPADDQRILAQCVALGLTRCG
                     QITFHESVLRCVCMGLLKELLPLPDLLRMSVEKAEGNEFVKAQVNQHLDSILFKEAGP
                     VTGVLCNQYSYANDKAKSFVETCVWEYAQEIYCHLRAAVLLHRGKQDDLITAIDKIAE
                     ASFLVVVVFAAEVTKHRLNAKSSEGFQPEVAARILVAFSCVEHLRRLRLPEYTEAVRS
                     AVLAIQENAAATALFIESMPSYTELTSKPDLPALAGTTYIWHRDEVQTSRILFYLRVV
                     PTCVGLIPVHMIQDKVASIMFLYLQHSNEKVTSASHSVMVSFSSSGSDTDQDDRAALK
                     EQLTFYYIKRSLEAYPGVTPFDGLASGVAALVRHLPAGSAAILFCIHSLVVKAKDLCE
                     VAKVQNKSLWRSWEESTDPCKKMLDLLLRLIFLVDIQSFPYLLKELAEFVTLLPKEGQ
                     DALLDDMHAHVAESDDVTRKPVLVSWLQSLSYLSSQARSESHSKAKRADASVANDELA
                     LNRTMARL"
     gene            <77739..>79376
                     /locus_tag="SES23K06_011"
     mRNA            <77739..>79376
                     /locus_tag="SES23K06_011"
                     /product="putative tyrosine-specific protein
                     phosphatase-like protein"
     CDS             77739..79376
                     /locus_tag="SES23K06_011"
                     /codon_start=1
                     /product="putative tyrosine-specific protein
                     phosphatase-like protein"
                     /protein_id="AIW39763.1"
                     /translation="MAAKRRARRPRSDDSKELGRNGGYEGSDEEVEESGKSGETAISA
                     EPKEMQLKQAEQPSPLSTKDAGAQGSGEASPARSAPRGGVALKTKTTSKLAKNPPPAS
                     QEEDEAGDSGDASPARDPLPDDTADAGHNKRAVTPKRGPPPQQGEERPETVAASALQQ
                     LRKALTKPTSPPSSSDIAQEDEHHGREMAEQEQRNTSPSQDEHRAREELQQEKKITEQ
                     DHAGDTSPPHDKDKDKDMHKPRSAGDTSPPHDKDKDKDMHKPRSSETEKKPAVERSWS
                     YDDEFKILNALVVHAQSHNGALPDSSHLLANLTFDKIDATEDKLTDKIRKLRRRYCRF
                     LLQGCPSDDLSRRLFKLSEILWGQADEDERVEPTCRDFSVLSKLYPHLTKEVKAYAET
                     HSSGDLIMAMFMTIGDEKARDLDAKCKKQHIEAFKLELGQASLTNELLSALSSLTTKI
                     TDPSQATSCKRGAEKLEEPLDEQYLRRSKRVAGKTEGFKDKPNADDVFNPKPLAMVPT
                     PNSPAPHLTKDIGDGIATGFLQIHPRDVWRTDQAGHR"
     gene            complement(<81328..>85159)
                     /locus_tag="SES23K06_012"
     mRNA            complement(join(<81328..81558,81702..81921,82880..83012,
                     83086..83203,83739..83833,85009..>85159))
                     /locus_tag="SES23K06_012"
                     /product="putative NADP-dependent D-sorbitol-6-phosphate
                     dehydrogenase"
     CDS             complement(join(81328..81558,81702..81921,82880..83012,
                     83086..83203,83739..83833,85009..85159))
                     /locus_tag="SES23K06_012"
                     /codon_start=1
                     /product="putative NADP-dependent D-sorbitol-6-phosphate
                     dehydrogenase"
                     /protein_id="AIW39764.1"
                     /translation="MAAAKDAAVALSSGHRMPAVGLGVWRMDKPDVRGLIHAALRVGY
                     RHLDCAADYQNEAEVGDALAEAFQTGLVKREDLFITTKLWNSDHGHVLEACKDSLKKL
                     QLDYLDLYLIHFPVATRHTGVGTTSSALGDDGVLDIDTTISLETTWHAMEELVSMGLV
                     RSIGISNYDIFLTRDCLAYAKIKPAVNQIETHPYFQRDSLVKFCQKHGICVTAHTPLG
                     GSTANTEWFGTVSCLDDPVIKSLAEKYGKTPAQLVLRWGLQRNTVVIPKTSKLERLQE
                     NFEVFDFDISGEDMEKMKAVDRNYRTNQPAKFWGIDLFA"
     gene            <90447..>92282
                     /locus_tag="SES23K06_013"
     mRNA            join(<90447..91082,91180..91272,91476..>92282)
                     /locus_tag="SES23K06_013"
                     /product="putative endoglucanase 4 precursor"
     CDS             join(90447..91082,91180..91272,91476..92282)
                     /locus_tag="SES23K06_013"
                     /codon_start=1
                     /product="putative endoglucanase 4 precursor"
                     /protein_id="AIW39765.1"
                     /translation="MAPPMRRSSSTATVSRLALAAAILCLTAGGNTVAAFNYADALDK
                     ALLFFEAQRSGKLPAGQQRVTWRGDSGLSDGSAAGVDLAGGYYDAGDNVKFGLPMAFT
                     VTMLSWSVLEFMPGGAAGRAAVRWGADYLLKAAAAAPDALYVQVADPNRDHQCWERPE
                     DMDTPRDVYKVTPDKPGSDVAGETAAALAAASLVFRTCDPAYSSKLLQTAQKVFDFAD
                     RYRGSYSDSLSSVACPFYCSYSGYHDELLWAAAWLHMATAAAGNSSDVYLSYIYSNGH
                     NLGAEQDDFTFSWDDKRVGTKVLLSKAFLQGIGKGKSDDALRLYKAHADTYVCSLVPG
                     AAGFQQSQYTPGGLLFREGDSNMQYVTSTAFLLLAHAKSLASAGPAGVVSCGGGLVPP
                     SALVAVAKRQVDYILGANPAGMSYMVGFGARYPRHVHHRGASMPSLRDHPARIACDEG
                     FRYLHSSDPDANVLVGAVVGGPDGSDAFTDSRDNFAQTEPSTYTNAPLVGALAFFAAT
                     RHP"
     mobile_element  complement(110994..116621)
                     /mobile_element_type="retrotransposon:copia"
     repeat_region   complement(110999..111115)
                     /rpt_type=long_terminal_repeat
     repeat_region   complement(116500..116616)
                     /rpt_type=long_terminal_repeat
     mobile_element  125324..127624
                     /mobile_element_type="retrotransposon:Copia"
BASE COUNT        35670 a        28341 c        29435 g        34178 t
ORIGIN      
        1 ccacgagcga actatatatt agctcgggga gatcttgtgt acatacacta gataatataa
       61 gcatgttgga tggactggat caagagctct gctggtccgt gtccgcccac gtaacagttt
      121 gctgcaaaaa cttagccgag gtcagctaaa ctgctgcagc tgtttggtgc tgctgcagcg
      181 aggtgttgaa tgcggtcata tatggacaat cagacaatta attaattaat ggatgtgcgt
      241 cgctgtccaa ggaagcttct cagaaggcag cagcaccgga tcgcggccag gaccgcctgc
      301 cttatcgccg ccgccgccgc gcgctagcac catgcaacat ggagcggcac caaagtttcc
      361 gtagagaaac aactacggcc agctgtgact gcactaggcg gctctagatg caaaggtagg
      421 tttagatgag atccaagaag aaagtcttta cccgtttggg tcgttagaat tgaaatgtat
      481 tttaataatc ataatttaga catataatcc attcgtccta aaataactgt cgttttcgct
      541 tactgataaa taactttgac taaatatata ttaaaaaata ttaatattta tattacataa
      601 ttagtatcat cggaaagatc tttgaatcta gttttttaac aaatttattt ggaaatagaa
      661 atattgcacg cgttttctac aaatcgagtc aaacttgtag cacgaaaacc gaaaacgaca
      721 gttaatttgg gatggaggga gtactaatta agctaatatg attgcacatg gaatatattt
      781 ttatcctgct attagccata cgcaggagat gcttacgtgt cgtagatatt tctgtcgttg
      841 gccgcggagc gagtcaaaga gcatgctata agctacagag tagaaacata acatggtgat
      901 ctatagaatc aatttattac atctccacct tatgaatttg agtgggttgt caaattccat
      961 gctaaatagc ttagtctatt aaatatatat ttcaatttct ccaaaataaa acgattcaaa
     1021 cggcccttta aagttttttt ttctaagaca cggacgtgcg cctccgttcc aagaaatcgg
     1081 acgaacgggt tttttccttg tttgagaaag aaaaattccg ataagacggt tcgcataagg
     1141 taaccatggg cacctatcat gaattgacga aatatatgtg tgcgcatgta aaatcatcca
     1201 atatatagtc aggtactcaa aatggcttgc cacgtcggca attatatgct aactaactat
     1261 atttgatctt aaaaggtcat attatattca tgatgacgca agccgggcta gatccagact
     1321 ggactaccga aacttaaggg ctgtttggtt gaaagattag aaaacatgaa caagtgaact
     1381 cagtcgcaga gacgagtacg tgagtgcgca atgggctaat ggccggtgct ttgctggctt
     1441 ctggagtaag caggccaaaa gactattggg ccatgagaag gggggcggga gcccagttta
     1501 aactccactg gcctccgccc tgaaatcacc accccttatt acttggtgca cggtgacctc
     1561 catttcccat atacgtacca aataaaagaa aaacgagaac gaatctacct attcttttaa
     1621 accagatact ctatatgaat ctatgataat cttatctaga aaacatacgg accagcccca
     1681 ccctatacca cctgccacct ggtcctcaaa ccaaacaaac acgtacgtgt gccaatggca
     1741 caccaccact gcgggggtac taggtccaaa ccatattcta atgagtgttg atttgcgtac
     1801 ttggcatcta cttcctccgt taaaaaaaac aattctcatt tctcgacgaa ttaaagaact
     1861 ttaaatttaa atttgaccat atctaaaaca aaatatatac taatatttat aacaccaata
     1921 agtatcacta aataaattat agaatatatt tttatagaaa ccatatttaa gtacataaat
     1981 gttgatacta tgttaaactg caagttgtat taaccgagat actacctttc attccaaagt
     2041 atatgtcgtt ttggtttttc tatatacata acttttatca tatatctagg tgcacgacaa
     2101 aagctatgta tctaaaagaa ccaaaacaac ctataatttc ggacaaaggg tggtaatggt
     2161 aacactacca atttgttgct taaaaaaatc cttgccagaa tgctgaaaaa aacgaaatgt
     2221 attttcttga gataatagaa gtcataaaac tatgcgtgta attgaatgga aggacaaaaa
     2281 actggaccac actcctgacc gcacaatatc gtaccacgcg acacaccaga atggtgaaaa
     2341 tcagcaaatg tcccctgatc cccttttttt ttcagttttc acagaaacct cgtttccatc
     2401 tgctgtgttt ttttttttca aaaattttgc acacgcctcc tcgctcacgc agggaagcgc
     2461 gtgcactatc ctagcactac tctatacata catgacccag cgctgaagct acgcgtaata
     2521 agctacgtgt tagcatcctg cagttagtcc acgcgggcag tatttgtaca gttcatgcgg
     2581 gactaattca aaacggcact gccacgaaac tcacgagtca cgaatctatg ctattattgc
     2641 cttaattaat cttgcttcat atagagattg tgtagcaatt accttaaatt tgcactagct
     2701 aatgataaga gaaacttttt tatactacta ctatatcatt ttgccattat ttcttgctta
     2761 catttgaacg tgttgtcttt ttcttcatca gttagatata attatagctt caatataatt
     2821 tagcgttgtc cttgataaca gaaatgacga aagacaaagt cgcgcatcga ttttgaaaaa
     2881 catatccaga aaactacctg tctacactca ggtgcagaca tgttacatgt atgacgcagg
     2941 gaaatgacga agcacatgca cgttgttacg tggtattttg gttcacgcgg tccgtactca
     3001 gcaatgctct actattccgt gcaagtaaag caatttgatc agactttatt atatacatag
     3061 gagaacatga tggcccagtg tgatccaaaa tccccccgag acccacgaat tactaggcct
     3121 tctacgcgat ggagtcgctg agcagcgtgc acacgatcat ggagatcgtg caggacatct
     3181 tggcagctgt ggagacggcg agccagaaca agagccgttg caggaaggtc gccgagcgtg
     3241 tccgttgcct caaggacatc ttagaggcgg cgcaggacgg gacgacgacg gcggcggcgg
     3301 tggcgacgga cgccgcggcg acgcggaggc tgctggacag gctggaggag gcgctgggcc
     3361 gcgcgctgca ggtggtgcgc cggtgccaac gcggcagcag cagcttcctt cgtagcgtca
     3421 tcgtcgtcgt cgccggcggc gggcggatgg cggacccgct cgacggggtg gaagccgaga
     3481 tcgaccggtg cattctcgac ctcgccgtcg ccaactctct tcgcattgct cgcctcgaga
     3541 cactcctcgt tcgtcagcag cacaccgtgg cggtggcagc cagcacggaa gcacacagcg
     3601 aaaaggatga tgagaacgag aggaagaaga agggctctgc cgacgagagc gtccctgaaa
     3661 agatgatgga ccatgataac accacggcga ctactgcgat tggcgttcca gtctgcacgg
     3721 tgactgctgc agccgtgcac gagcacgaga tggtcccgcc gccgtcgtat gagtacgggt
     3781 acgggtacgg ttacaggagc tatcatagct actgccgaaa tcatggctgc gcctgtgact
     3841 gtggctgctg ggatgacaat gctgcgttct accacaccca gtactcatcg tacccgtcga
     3901 tgttcagcga cgacaacccc aactcctgct ccatcttgtg agctcctacg gaacatcaga
     3961 atagcaaagt acaggaccag atcatacgta aatgttgtat taggcctaaa gcatgatttt
     4021 atggaagtgt acattcacaa taagatgata gtggggtttt gaacgaaatt gttacattaa
     4081 caaagagcac gcttatatat tctttagttc ttaaaattga catgttatat agttaggtcg
     4141 gccatagaca tgtttgctgt tttttttttt tgaagggaaa ttgcgatttc cattactcag
     4201 acaatgctaa atcgtcagca attgcaaact gaatacataa agggattgaa cctagaatca
     4261 gttcatcatc caaagaactc atcatccaaa gaacaaagag taccaagagt agctagctcg
     4321 tgcgccacct tgttgctcat ccgggacctg tgttggattc gccatgaaat gacaggagac
     4381 agctccgcca caatatgtgc cattgcacta aactcatagg cattcgagta aacagcttga
     4441 accatatata gccatggcat tggtctcaat gatcacctga cctacacctt catcgatagt
     4501 agcttgcacc ccttgaatac aggctatgat ttcgccctgt aatggttcca ggagtgcctc
     4561 cagtcttcca cggcgaacag acaccacatc gccatctgag tcgcgtagaa tgcagcccca
     4621 cccgcctgaa ctcatgtgcg ggtcgaaagc cgcatcacaa ttgaccttga catgatctgc
     4681 agctggtcgc tcccacgatt tcctcgccaa caagtcatta tgctgcgttt gagggcccct
     4741 actgcaccaa gctgtcatat agacttgaat agcatgtgcc aggctgcttg gatctctgcc
     4801 ttgctcgcca tcacggattc tgttcctctc tgtccagtag taccagagag tgaggcaaca
     4861 tttcagtttc gtgtcctcct tcatagccaa cactgcttcg atcacctctc gtgctgagtt
     4921 catctctgtt agcctgtatc tttcttgctc caggccaaga atacccaaac tctctcaata
     4981 gttttgcatt tgaaaaataa atgtgcccca tcttcattca gacgtcggca gactgcgcag
     5041 gttgtatcta aatccattcc tcttcgcttt aggttcatac gttggtaaga cccaaattaa
     5101 acatctcccc tcccccctca acattagtac catgagtaga acctgggcgt gtttgataag
     5161 gggctttggg gtggccctgc gccctccagt tgcaaccagc ctttttgatt cacttggccc
     5221 aggttccagc cccgctcgcg gcgtgcgaat tcccctctct tctgcatccg gggaaatgca
     5281 aatcatctcc gttttttcac tgcctggctg agtaaagcgc caaagcccaa gttcgcatca
     5341 cctcccacgc tcccatatct ctcacccacc ctccctttct tctccgttgc tgcgtgtggt
     5401 tgccgctctg gccacctccg ccgagccagc cctccgccgc cgcgtcgagc cagcgtgcac
     5461 cgagccggcc gcgcacgcgc gtgcggtgcc tgaggccgcg tccaccgccc cggcgctgga
     5521 gcagtagcag tagccatggc gcaagcagct ggctaggacc ttcacgtgca ccgtcgcatg
     5581 tcttgtcgcc ccgacgctag aacagcagca gccatggcac gagtagtagc agcagccatg
     5641 gctagcgctg cctgtgttgg tcgccgtggt ggcaacggcg agtggagggc agccccagcc
     5701 gcacgggagg aagcctccga gtcgcgccta gctagctggt tgtgcgcgca gtggtgcctc
     5761 cgccgccatg gcaagaccgc ctctgcacct gaatctgcca gcttctccat tcatggcgct
     5821 ggactagctc gcgtccatga cctgcttaat gaaatgctac tgaggattgc tgagaagaga
     5881 actagtggta aggctaccac atgcttgtgc aagataccca tactctttct gtacaggaaa
     5941 acaaacacat tctcaactcg gctcggctct gctcggatat ggaatcaaac acggtcacat
     6001 gtaccgttta gaccagtctc tggctggcca tagccaggcc agctgggcag gctggcctga
     6061 gcaatgatat caaacacacc ctttgcacat ctcaaatatt aaacactcaa acatgccttg
     6121 tatgtggtgc caagcacact gttggatata tgcccaagag gtaatcatcc atattcatac
     6181 cacgctaatg ggcctttagg gtaaaagccc atttgcggtg gtctgtatat agaaggcgaa
     6241 aggggcaagg gttgggtgac actccacgcc atacaaccaa gccaccgctg ccgcctctct
     6301 ctctgtctcc ccaaggctgc gggcgctcaa gctgtcacca ccgtcgttct tccactcgtt
     6361 gcacacgcag tgctagcaca ccggtgtcgt ggcgttccat cctcgcatgt gtggatgtcg
     6421 tggagacgct gctgctacgg tgaacgtgag gtgcacggtg aacgtgtacg gctacttcca
     6481 ctacatcgac gagttccttt tccactgcgt tgcgcgtcta gtggtaacaa tccatgatcc
     6541 tctactcgca tgttatcttg ggtgaacgtg gtagatgtgc tagcgtgtac tgaacccgtt
     6601 ttccaacaca cgcgctttcg tggcttctcg agctcctttg ctagcaacgc ttctgccaca
     6661 cccgcaacag acacgccgca ctaggctttc accagtggct tcaccaccgg gaacagcggt
     6721 gcccgcgaca gcgaaggcaa agcagatctc ctctccccgc atttggatga gctttgggct
     6781 tcagcgcagc cttcccgacc actaccgtgg acgccgccac gccggtggtg tcccatggtt
     6841 gtagcaaccg ttggaccgcg gcgccggcag ctacagccat gccaccgcat ttcgcctcca
     6901 tccccatcag cctgaggctt cgaatctcaa ttgggaatga tttggttgga tggtaaggaa
     6961 ggaggcgtcg atgatgacga gtttatttgt tgcgatttgg tggattgtgg gattggagtt
     7021 ttgaactact ccctccgctc cattttatct ggcgcaactt agaatgacac ggtcttctag
     7081 attacacttt gaccattcat ttgctttaaa ttatattact tttgcttata aatttataat
     7141 cattggatag tatatttcct ttcaaatcta atcatataaa gtttgtatta taatagttga
     7201 aaattattag cttaattatt ggtcaaagtt tttaaagttt gaatcttgat atgcgtgtgc
     7261 gccagataaa atggaccgga ggggagtagt aaggtaggag agccatggtt tgaaataaac
     7321 cgtctaacgg ctagtttcca tctctttttt tgtatagata gacagagaag gctagtttcc
     7381 atctactggg aaggaaagaa cgtgtcacgt gcgactacca aaatgtccat gaaatctctt
     7441 gtccaggccc attcagcgac ggaatgaatg gcccaacact ggagtcgcac cacaaagggc
     7501 catccaccct cccacccacc ctcgtgacgc aggccgggtc cgggtccggg tccgggtcgg
     7561 ggtcgggttc cggtccgagc cgagccgggc cgggctacca aaactttatt acttggcgcg
     7621 cgctgacctc cgttcccgcg aagccgaaac cccgtgcgcg ccaaaatcct cagccctctc
     7681 ccgccgccac cattgctatt tacccaccac ctccccatcc gtaccccacc ccacctgccc
     7741 ctgcggtgcc gacggccgac gcgcacacct ctccactcca ccaccaccag cctcctcgtt
     7801 ccccccgcca tcaatctcgg atctcgcgag cgcagacaga tgggcgccgc gggtcagctc
     7861 cgtcgccgga cccgcgcgcg gacgccgcca gggcccagac tggaggcagc cgccgccgcc
     7921 ggcgacgacg acgacgacgt gaggtgcgag gcgtgcgggt ccggggaggc ggccccggag
     7981 ctgatgctgt gcgacgggtg cgaccgcggg ttccacatct tctgcctccg ccccatcctg
     8041 ccgcgcgtcc ccgccggcga ctggtactgc ccgtcctgcc gcggcccggc ctcctccaaa
     8101 tcccaatccg ccgccgccgc cgctcacacc gtcgtcgcca agaagcctaa acgtgagttc
     8161 ccgcattttc attgcggttt cagttgcaat tagccatttg cgcctctccg ctcatccatc
     8221 agcgatttat gtatgtcctg tcgcagagtt cccgctggtc cagacgaaga tcgtggattt
     8281 cttcaagatc caacgcagcc cgacgccggc cgatgcgtcg gaggagctga agaagcggaa
     8341 gcggaagggc gggggcacgc tggtggcatc gaagaagaag agtcggaggc tgctgccctt
     8401 catcccgagc tccgacccgg cgcagcggct gcggcagatg gcgtcgctgg cgacggcgct
     8461 gacggcgact ggcgccgcgt tcagcaacga gctgacgtac cagccgggca tggcgccgcg
     8521 atccgcgaac cgcgcggtgc tggaggccgg cgggatgcag gtgctgaatc gggaggacgc
     8581 ggagacgctg gcgcggtgcc agcggatgat ggcgcgcggg gagtggccgc cgctggtggt
     8641 ggcgtacgac cccgtggaag ggttcacggt ggaggcggac cgctgcatcc gggacctcac
     8701 catcatcacc gagtacgtcg gcgacgtcga cttcctccgc aaccgggagc acgacgacgg
     8761 cgacagcatg atgacgctgc tgtcggcggc gtcccccgcg cggagcctcg tcatctgccc
     8821 cgaccgccgc agcaacatcg cgcggttcat caacggcatc aacaaccaca cgccggaggg
     8881 gaggaagaag cagaacgtca agtgcgtgcg gttcgacgtc ggcggcgagt gccgcgtgct
     8941 gctggtggcc aacagggaca tctccaaggg agagaggctc tactacgact acaatggctc
     9001 cgagcacgag taccccacgc accatttcgt gtgatgaatg tgaccacaac accaagagcg
     9061 gcgaggcgat cggagtccgc cattgccaca gctccagctc tgatgtggct gccaaaattg
     9121 gaccttcaaa ctggccactg gggaaaggaa ttggaattgt aatgtcagag gtttcctgtt
     9181 gtacatcatt ctggatcgct tttggatgaa ccggcatcat cagtgttttg ggccagtttg
     9241 aattagctag ggctagttaa tagttgaagc tataaattag cctaaattag ccaaggttag
     9301 ctagctagtt ggctaacaac tagttgatat tcccttgttt ggatggatta gagctaaaaa
     9361 attagctggt tagcaattag ctctatgcat ccaatcaggt cttatgaaag caatggcaaa
     9421 ggccaagaag ttcaccatct cataccttgt ttcatctgtt tccagtgttc ttttatactt
     9481 ccaaatccac agtaaaggta aagagaagcg aaaaactggc ttacatattg gccctgcagt
     9541 cacataggtg atgtgttttg ggtatcaatg tctctgaaca tgtttttgct gtgctatgtt
     9601 tacaagacag taaaaataaa ctttgtaaaa ctactttttc aagcaaattt actcgtatca
     9661 ctttcgaaca taaaaagggg ctactaagct ggaagttgtt gactgcactt tatgcatcaa
     9721 tagtcttgtt gcgtcagctt ggaagttgaa acggtaaagt caaatttatt agttgagcta
     9781 aaaattagcg taaatttatt agttgagcta aaaattagcg taaatttatt agttgagcta
     9841 aaaattagcc taaattagct agctagttgg ctaacagcta gttgaaggct tgctaaaaaa
     9901 actagcacat caattaatcc cttgtttggc tgggtaacaa tgagctatat gcatataatc
     9961 agctaacaat taactatatg catataatca ggccttatga aagccaaagg tcagcaagtt
    10021 tgcccagctc attccttgtt tcatcttttt ccagtgttct tatactgccc ctgcagtcac
    10081 atacgggaga cgcgctttgg acaccaatca tcgtctccaa aacatgtttt tgatgtatat
    10141 atgttatgtt tacagacatg ataaaaatgc acttttgtaa aactactttt cgcaaactca
    10201 catgacatta tcaaacataa taaatgactg taatttgtaa taaaaagtct aaagctattg
    10261 attgcaccgt caatagtctt gttgcgtcag cttggaacta gtctcaactg aagctccaca
    10321 tcgacaagtt gatacgtact gtacatgtac agtaaccaac attgcctttg ctgtaggaac
    10381 ataacttcga ctcttgtata acagcgcaac acttgacaga tgaagcaatc tagagagatt
    10441 catcagcata acggcacaat aaggtagctg gaaaataacg ccaacaaatg ttcaaacgag
    10501 tactgaaggc taccattcaa tactacaacg ccaacaaagg ttcaaacgag taccattcaa
    10561 tcctacatga gttacattct ggagtcgctt catactgaaa tgggaaatga taagctaact
    10621 tggaaagtca acacgagcta acgcacatag tacacgggtt ttcctgctgg ctaacattac
    10681 caactttaac ataacatcac ttgcacattc atctgatgcg ggaggcttga tgcttgaaca
    10741 caggcatgga acgcttctag tctctctcgt ccctcccagg tgagcggcta cacaatgcaa
    10801 acaagtcatt aatcactgtg acacattatc gcaacgtgca aagatacgag atgacaccaa
    10861 agggtattgc taacctgggg gacctgtcat agccagggct ggcttcgcgg cgctcacgac
    10921 gagggctagc ttcccggtgc tcacgatcat agttggggct gcgtcctccc ctgccatgat
    10981 cgcctctgcc cccattgatt gggcttactc ccctgccatt atcggggctg cgtcctcccc
    11041 taccatagtc tgggctcccc ctctccttgc ttcttccgta gtctgggcta cccctctccc
    11101 gccctctgcc gtaaggacta ggagaacgcc ttctacctgg ggatctttca cgagctctcc
    11161 tgtctgggct gtatccgttc cctctttcac ctttttcatc gtcatcacga agcgcatact
    11221 caactgaaat gaccctgtcc atgaaatggc tgccacaaga ataccagatt caatcaaggt
    11281 gtaacatgca gacacaaatt caactaaagg tggcgcagca aaccatgaat aaaatatcat
    11341 ggctaaaata ttctgaataa gtaaatgaca agcatgagct agtaccttcc attagtaccc
    11401 tccaatgctt tagtagcatc ctcctgtacc tcaaattgga caaaggcaaa gttctttttt
    11461 attctaacat ttgcgaccct gccatattta tcaaagtgcc tctccagatc tcgaattctt
    11521 gtgttgatcg ggtcaaagtt gatcacaaac aaggttttgg tcggtcttgc attggttgga
    11581 gatctccttg agctgcctct tcgtccaaca gtgcgatcct cctgaaaaat aatggatatg
    11641 ataattcagt aaaacaagac taagttatca agtgctaatg ggtcaatact cttttccaca
    11701 tctgctcacc tttgtccact caactctgat tctccttcct tttctgccaa aatcaattcc
    11761 atcaagtcta tggatagcat cttcagcatc acgttcatct tccatgtaga caaatgcaaa
    11821 cccttcatgt tgaacacaag ataaaaggag aagtgactgg ttgttcaaag aaattgcagt
    11881 atggtccaag acgtaaacag aaaaggcaac aagatgaatc atgatgcagt ctctgctgga
    11941 aacttttcta agatcacctc gcaaaatcta cagtctgata cactagaata aacaggaaca
    12001 gaccttgtat atgttgaact aaatgatgtc agagtagtag agtatgacaa tccaaacatt
    12061 cgtggtacat caaagaattg gtggtgcaac ctccacttct ctccactctc cagccggcca
    12121 tgagattggc atggttggat tggcgaggaa atggtgatga ggcgggggag gaggatgcaa
    12181 tgttgatcgt aaaagtaaga catcggtcac gaggtggtcg tttccatgtc aacagatgcc
    12241 atggtggact gtgaactcct ggagatggac aaggcatgag gtgggggctc aggcagaggc
    12301 agtaaaggta gagccagtcc atcaaccagg aagagcacat atgctccatg atattcctgc
    12361 ggcaaagaaa taattgagta ccggacctaa attttaagaa agaaactttt tttttctcta
    12421 aatttatcct gatacacact tgtccaatga cttataacaa caaaacataa acataatcag
    12481 attttgctga aactcctttg gctttcgcat cggatgaaca acttggtctg tttgcagctt
    12541 cgtacaccag gcatggctga aggaagatcg acaatctctg ccacgtcatg gtgatagtag
    12601 tttccacgtg aagatcacat tcttcgagga gttatgtgaa gatcacgtat ttgtgatgat
    12661 taaaccaata ttgcaaataa aacggtaaaa attaaaattt aaacaaaggc atcgttatgt
    12721 ttttgggtgg cattgtcttg caaatatatt cagtaatgct tcagtatcta aattaaagaa
    12781 acaaaacggt tcaaagctgc agctgctgac actggatgta attcacttgc tgaaataaag
    12841 cactgccttt gaccaaaaac aacatatagt tgcagcagca gttgttgttc tcctaacata
    12901 gatcataaag tctgagaaca gagtaacaga ctaacctgtc ttcagatcca ctcgttccac
    12961 ccttccatac ttcccaaaaa ggcgctcgac ctcagagatg cgtacatcat agtcaaggtt
    13021 cccacaaaaa attggcctca ttctggtcaa aattgtattc catgaatcag tacaagagta
    13081 ttaaaaagca ttagtttggg aatacaatac agtatctaac atttagcaag ccaaacagca
    13141 ttaacagcag atgcttgcag tcaatcaacc gacttcatcc tttaagatca ggaatcatac
    13201 catcttatta caaaaatcac acgacaatga cccaaatgag tttactacac aactcttaac
    13261 tcagaggaaa attgagaaat aagcacatca ctttcaactt tacgaaaaga tcagcacatt
    13321 tgtgccacct tcgtaggata caagatatgc tgcctgtcta aacactaata aggtgtccaa
    13381 caggacaggt ctttcgaccc gaagacggtc aactctagta cacagtatac ctgtctaatc
    13441 taaacaaaca aacattgaca cttacaatct gttttgagaa tatgaaccaa ttacaactcc
    13501 aatttttcac aaattccgca ttgggttatt tcaaatggga gcaaaggaaa ctgagcgaaa
    13561 cttccaatat acacagtagc aaaacaagtg ggcagaattg cagaaaccaa tgcatactga
    13621 aagatatagg tgggaggacc catggtgtac acatgttcac ccaataattt tggcccaaaa
    13681 aaatcgaaga tagtaggcat aatacatgta tacactcgca actaaatcag atccaaatac
    13741 aaacatccaa atagcttagg ttagggttcg gacaggggcg cacccagcaa aggacatggg
    13801 catgcacgtg taaacccaac aattcttgca gaaaaataga agatagtagg cacaatacat
    13861 gccgacgctt gtgactagac cagatccgaa tacaaatacc cagatagctc aaagttaggg
    13921 ttcgggcgct cggtttcgcg cagcaggaag gggcgagaag gggtgcgcat acctgtcggg
    13981 tactcgtcgc cggcgaagac ctggcgaagg ggccggggaa gacctgggca cctggggggg
    14041 cggcggcggc gggtcgccct gttgtcgccg agagcgagag aaagagggag agggggagag
    14101 caggcggggt aaacggatga agaaaaggca gggttgaacg gaccctagaa atttggatgg
    14161 gcctgcagcg ggccggattt tgccttgttt tgatcccgac actccgacag cgcgtctagg
    14221 cccagttgtt ttaacacagt ttgtcttttt taaacgaaaa aacagattgt cttgttaaac
    14281 cttataacgg agggtagtat ggtctttcgt ttgccacact aatctgtcta gatctctcag
    14341 gaattgaagc tttcatggac agatggagta ttagttaata gtaataactg ttgctcaaaa
    14401 aaagttaaca gtaataacta gcataataag catacatgtg ccggtgaaat actaaaattc
    14461 tgttttattt taaaacaaaa accacgtagt tttatcttaa tagtaataac ttgcataata
    14521 aaagcgatgt atctagaaaa gctatacatt atgttttgct catctcgata cagatcaatt
    14581 gaaaaagggt aaagagatgg aggcaaatat ggttgatcta gaccaagacg aagacgacga
    14641 agcgtgctga cgagaatgtg atggcgatag ttgagaccac aaatatgaag gcatcgcctc
    14701 gatataataa aactaagaag gcaaacaatg caaaggtcat aaacaattat gccttgttat
    14761 aaataagtgt tttccggatt atatacatgc tcatatataa ttgtgtgaaa gttgagccat
    14821 ggaataaata ttgccgtttg gttgttctca tgtgcatttc tgaaatgaag ccaggacgtt
    14881 atcacaggca ctatactagt aatttagaac ggatgggttt tttattatta ttgtttggcc
    14941 aaaaaagttg tgtatttgga aaagcaatga ggtgaacggg ataaggtgat atgataatac
    15001 taaagaatag ccgcctccca ttgctttgct actgtataag tgttgaaaca ttcaggccgc
    15061 atgcgcaaca gagtagaatg agattgcctg gaggaatata actgcgtctt gcattggtgc
    15121 tcgcatggag aaaaggaagg caaagaagca gaaggaaaat gctaccaatc ctctaaattt
    15181 cctctcattt caatggggcc taaatatttg acgatgtcac gtactcagag aacaaaggtg
    15241 tccattcagt agagtttccg attgacgtct acgcgcaaaa tacaacaaaa cctctctatg
    15301 tatatctatc aatacgtgct acgcaccggc aaaccatctt tgatatgcct tcgcattgct
    15361 ccagcatctt tggctttctt tactttgcga agggatgaac tagtagatcc cgttgtgtac
    15421 atcatagatc gtgaactgta aatacgcggc acatgtagcg cccttctttt cttgacgatt
    15481 ctgcattttc catggcatag aaatctattg gtttgaagtt ggaacatgac caactacgca
    15541 ggagaactgc agcctgcatg ccagaatacc aaacctgtgc tgcggcagct tagctgaagg
    15601 cacctgtaat ccatgtggca attagcagaa gctcaaatgt cgggatcaga aaatctgaac
    15661 tcaagcaggt cgcgagatcc tgtcttttta cctgcagagc aactctcagg cggtcggtca
    15721 ggcctaagtt acttcaacac aatgccaaca agcaattcct taggcaattt gaaggggact
    15781 ttatagtcat acttttgtca gatgattgtg caatctcacg aaatcatcca aaatcagatc
    15841 agaaggtcta gcctgccagc agttgacaag tgagcacaat agcacatgga cacagagaga
    15901 gtgggaggaa gggatacaga agaagggagc gacagcttac tgtaactgga aggccaatgt
    15961 tgtcaagagc agcctcgatc tcagaagaag agcataggtg ctgaagagat ttcctaagca
    16021 tcttgcgctt ccccatgaaa gcagaattca cctggaaatc aaggatatga gccaatctta
    16081 atggtagtta caaacatggg gggattaatt tcaaccacat aaagcaattc agatttggga
    16141 caagtttctg cacatcatgg ccccatggcc cactactcac cattgaaaag aagcttttgg
    16201 gggaactaac tggtggatac tcctccgcat tctttagttt gaagctgata acagcaccat
    16261 taacctgcga atggaattgg ccaagaacag tatagacttg aaataaggtt catgaaactc
    16321 aaaccactgg gaaacaacaa aatgttattc cccaaactaa gtcacacatg taggccttgt
    16381 ttggatgcac atgtatccgt ctcaatccat gtgtgttgcg gtgggttggt gtggaactta
    16441 aactaaattc cacaccaatc caccccaaca cacatggatt gaggtggata tatgagcatc
    16501 caaacaagcc cgtaagaaat aaattacctt tggctgaggg aaaaaattct ctctgtccac
    16561 tctgaacttg tattcaggtt ctgaaaagaa gaaacaaaat atattcctgt caataaatgc
    16621 aagctaatga ctgtgaatca ctggctaggc atgctatagc taaacagtca aaactagacc
    16681 aaatttcagg tgattgcatg atatataagg acattgatta atagctacac aaacctgttc
    16741 gctttgctga aaagccaggc tgaaaagtac tgttcgctga tttgttgtga gagaaaaaca
    16801 ctataccatg gctgataagc caagctgggc tatgtggctt gcatttcaaa atattttgat
    16861 caatctcttt aagtagaata ctaagataat gcactctccc aacttaccta tgcaacatta
    16921 atgtgtactg tatctacatg aggaacccct aacaaacaaa actaaatgtt taactgtcat
    16981 agtaacggac ctgatcaaat gtacccaata taactagaag actgataaaa gtgcacttca
    17041 aggcagacag agtgatacaa cataagattg ttgtcatcag ctgcagggca ggatctagaa
    17101 taagtgtaac tagcagatct tcatgatgaa tctattaaat gtagggcgtg aactagcagt
    17161 tgtagaagat gtatctcgac tgttgtcttt aagtgacctc cattgttcta tgggcaacat
    17221 agaagcgaac tttacagcac aatttaatta aaccctttaa gacctgaatt tttttttcag
    17281 tttttctatt tttgctctcc tctgttcctc atacttttca ctgagagctt cctttattct
    17341 cctcggtaaa aagggatact cagaagcctg gctatttata tgaaacaaat agataagtgt
    17401 aaatatactc tcaacactaa tcaaagtccc tcaacatgtt ccatacaaaa acttacttga
    17461 gtagaaattc acaaacacgt taataggtcg gtactctgga atttgtattg aagtatctgc
    17521 aaggcgtacc gctgtttcat cctggaaatg aggatacagg aatgaagtat aatgagtcaa
    17581 taacaatatc aaaaattaat tcattcaaca agagagtgga ggtaaaataa gatggatcga
    17641 aatggcccct taacaaaaat gggtagtgtt tctaaaatcg aaatcacaca gaaatacatg
    17701 atagtcaaaa gttctatatc ttctgaaatc tggaccacca ctggctcatt attaactgtc
    17761 tgcaacatta gccattgcaa aagtgaatgt aagagctgtc tcaaacctga agcataagca
    17821 ccacgacaga gaaaacatcc cccattggga gaagtagttt gacaacttcg gtgctgacat
    17881 tgaatggtaa gtttgataca acctgcaaag tagaaactgg aacatgatca caaaaacaag
    17941 ctccaaatag atttctgtgg atgagcatca agctcacctt tgcaagtttt ttggtggcat
    18001 ggtatttctc cttcatgaaa ggaagaaaat gggaacggat gtgaaatttt gtgatgtctt
    18061 cttcgatgac ctgccccaga tttgtactat caacacagat cgagtgcaag gtaactgtaa
    18121 gctttactaa aagcaatatt gttgatacat tttgagcttc tgatttccta attatttgat
    18181 ggaattattc atctgtaatg aatgatgaca gatagaaatc ttaggttgtt taaaggtcat
    18241 tactcattag tgtacatctt gatgtcctgg agagcaacaa gagaatattg cacatcctat
    18301 ttcttaagga agcacagcat ttcaaatgaa gaactagatg ctaccttcaa ctgttctgta
    18361 gatccaaacc tatctttaat gagggtagcc atatgcttgt cctgctacca aaaaagaaca
    18421 gaacatgatg atgcaggtta tggttcctta atagaaataa tttctagact tcaactgtta
    18481 atgctcccaa aataagaaga aaattacagc tactttctcc aacccaaaag gcaaacacaa
    18541 ctgggcaata ttatcaagac gtccgactaa tcgcgattag tcgggcttat cggtgccatg
    18601 gcaatcaata atgcactacg agtagtcatg attagtcgcg aatagtcagg gactcagggt
    18661 gatcggtgcc atggcaacta ggatcgatta gacgatttga taacactgca actggaatat
    18721 caagggagcc actactattt ggatggatgc acctcaagtt caggttcaac ttataatgcc
    18781 atgctcacgt ttgactctat aataagtgtt ttcaggaacc aaaaaaactt atattagaca
    18841 gacaacttac aatcttttgc aagtaactga aaggccacac tatcggcaca tcatccacaa
    18901 ctcagtctca agtgtcaaag acgagcatgg tctcagttag aggtcccagg tcccaattaa
    18961 taaaaggaaa aactactcat actcgaagtc tgtagccaca tacccatcca aacgagaaaa
    19021 ttgctaaaat aggactctca aacatgtgtc tttattaaaa taggactcct aacgttggct
    19081 ttgctcaaat aggactcgaa acgttgtcac tttgttataa tgacatttcg acaactttta
    19141 atcatatttc aaaactcaaa tacatgtatt ttctcatatt gaccgtattg cccttctgaa
    19201 attctaatct aaaaagtgtc gactcattgc ctcatccatc ccatcgctcc tttctgttag
    19261 tacgtgaatg agctcctttc tgttagtacg tgaatgagct cctttctgtt cgtacgtgaa
    19321 cgagaaacct gccagccgcc gccgcccgtt cttcatctcc tacgccgcca gccatggatg
    19381 gagaacctcc gcccaccgcc cctccttccc tgcccgacca agctggttcc atggccgcgg
    19441 cgtcgcgtgg tgccctagcc gcggcgttgc ctggtgccct agctgcggcg tcgcccggtg
    19501 ccctagccgc agcgcctgct ggcctgcccg acggtgttgg ttccatggcc gcggcgtcgc
    19561 gtggtgccct agccgctgga cagcgtcgcg tctctgatgg ccaagctgcc caggctgggg
    19621 cagccgatgg actgcagcca gcagttgagg cctccatcga tgctctagcc ctagcaaggt
    19681 catttcttcc tactgctcct catctgacaa gagagtgcaa cattcctgtt gttcaagtgc
    19741 aaaggtatat attgcatcca ctagatcttt tatttttttc aataaaagta ccgtacagaa
    19801 ataaaactag gtttggtttg tttataggtc cgaagtgaat gatgtggaaa ctataggaaa
    19861 agttgattgg gcaacattac aaattgtgga aacacatgat gatgaaggtc gaattgaagt
    19921 tatgagcgag agccgaatgt gtgagttttt aggcttgaca gaagagggca caacaaatga
    19981 gtcaacaaat gtacctacac aaggctttgg ttgccgaatg gatgaacaag tgaatgatac
    20041 tgcgcttggg caagatattg atgctgccat ccctactagt gatgccgtac ctggtgagat
    20101 ggtcattacg tatgataaga agaacccatc aatggaggta gggacaatgt acccaacaat
    20161 ggaggagttc aagctggcag ttcggcaatt tgccatcaat gaggagttcc atttacgagt
    20221 agagaagtca actaagacgg tatatagagc ttactgcaat tccggtgatg aagatcgccg
    20281 ttgcatttgg aggataaatg gcagaaaact gcaaggcagc gctacaacgg aggtatacag
    20341 ggcttatatt tcattaattc tacattgctt gtgtgttaat tgcctggatg aaattttttt
    20401 actgctgtgt atatatacat atatgcctct gtacgatatc atatgcctct gtacgattct
    20461 tttggtaagc tgtaatcaat ttggtaagtt gcattacaat ggcaaaatca actagcaaca
    20521 ggcagtagta ctacttgatt ggccggacgt gtagtactat atatacatat atgccatatc
    20581 atatgcctgt gtacgattct tttggtaagc tgtaatcaat ttggtaagta attttggtaa
    20641 gctattaaat ttcaagtagt ctaatactag cagctgttaa attttactaa actagaattc
    20701 ggatcgtttt ttttagctgt attacaatga caaaatcaac tagcaatagg aggcagtagt
    20761 actacttgat tggccggacg tgtgcatgct cctgtgcttg attgtctact ttgctacatg
    20821 ctgtgaacgt gcattatggg catgtgtgtc tatatatgac tgagaagtcc ttgatttttt
    20881 tctgtgctat atatgatgca acagtacata tgtgtgtcta tatatgatgt agcagtacat
    20941 atgtgtgtct atatttgatg caacagtaca caatatatct cattgattta ttttttcttg
    21001 caggttaccg tcttagtcaa tgaccataca tgtgtgtcta gcatgaggat ggcaactaca
    21061 actccaaatt gcaagtaggt agctctatgg gcagcgagta tacttagagc tgaaccaaat
    21121 attggtgcta gagaactgca aaagaggttg gagacagatc acaagtgtca aattgcatat
    21181 gacactgtgt ggcggggtaa agcaaaagct cttgatgaga tttatggcaa atggtcagag
    21241 agttttcagc tgctatatag gtggaaggcc gaggttgaga agcggagccc tgggagtgta
    21301 gttgagattg atgttcttga ggtggatggt gaggtatatt ttcaccgttt tttttgtgct
    21361 cttaaaccat gcattgatgg tttcttagaa ggttgtaggc ctcatttgag catagatgct
    21421 acagccctta atggaaggtg gaatggtcac ttggccgcag ctgtagcagt tgatggtcac
    21481 aattggatgt atccagtcgc ttatggcttc attgcttctg agacaacaga caactggact
    21541 tggagaatgc agtgaagaat gtattgcagt gaagaatgta ttcccaaagg cttagagaat
    21601 gcagtgaaga atgtattccc aaacgcagag caaagggaat gtttttatca tctagccaga
    21661 aacttcaaaa agagatttag agggtttatc cagatatatc ctgctgcaag agcttacaga
    21721 gaggagattt tctatgaaaa tttagcaaaa atgctaagtg aatcatcaga agcagtgcaa
    21781 tggttatagg ccaatcacaa gcttctatgg tataggtgtg gtttcaatcc agacataaag
    21841 tgtgactaca taactagtaa cattgctgag tcatttaata actggataag agaccataag
    21901 gacctacctg ttgctgacct tgctgataag atcagagaaa tgatcatggt actgtggcat
    21961 aagagaagaa ttattgcata caggctacct gaggggagga ttctcccagc tattatggtt
    22021 cagctaagag caaatactag aggtttggga cacttgaaaa ttgtgaaatg ttctaattgg
    22081 agtgcagagg tgtgggacca tagcagcggc gtttctgtga gacacattgt caagttagag
    22141 caaaggactt gtacttgtca agaatggcag cacactggta agccatgtca gcatgtattg
    22201 gcctatgtaa cccgccaaag gggaattgac ctagaacagt ttgtgcatga ctactactcg
    22261 gtgaataggt ttagggcggc ttatggaaga gagattgagc cgatgacaga taaaacacaa
    22321 tggccaaaag tcgacctacc ttttttagtt ggtgcacctc tagctaaatt acctcgtgga
    22381 agattgagga aattaagaat caagggatgg atggaaggtg gacacaagaa gaaaggttcc
    22441 aaagatgcaa aatttactaa tgagatggag ggtgagaagg gatgtgacaa tgatactgct
    22501 ccaacaaatg caaagggaaa gaagatgatc agaggaccta tgacttgcaa aaaatgcgga
    22561 gaaaaaggtc ataggcaagc tagttccaag tgcccgctca atgggaccgc aaaaaagagg
    22621 taaatagttt gtacattcca caactttgtt tttttatggc tgaacacaaa ctgcaatatc
    22681 agtatgttta ggcaagtttt ttttccctta ccgcccaatg catgcagtac attttgcttg
    22741 aacgatgttt aggcaagttt ttttatggct gaacacaaac cgctcaatgc atgcagtacg
    22801 tatatatatg cactctgaac tttgctttgc ttgcattatt gcctctgtag catgtgagaa
    22861 gtcgttgatt tttttctgat taacttggat tgctcaagtt tgtgattgtt atcttcgatt
    22921 gtctagaaag cgtaggcaac caaggaaaaa tgttacaata gagccatcgg aacctagcac
    22981 tccacggagg ctgactagag aagaaattct acgtgatagt ccaggaaggg tcacaagaag
    23041 gtaaaaatta tgaatataga aattgacata tttaccatac actatttttt cgatacatct
    23101 aattgtcgta ttgaatttat gtgcagcatg cttgtgacgt tattagggga gggcacatct
    23161 tcacaagttc acaccaatag tcccgtgagg atgcctaccg ctacagcacc caaaaagatg
    23221 acaccgaaga ggaagctaca cattggatga attactttag ttgtgtgatg agatgtaaac
    23281 tgctcatgat ttatttcatg acttggatct tgttttaaac aaaattatag tcttatgcga
    23341 tgaacttgta accgctagaa tcatggtttt atgatatgaa gttgtttctc ctaaattcat
    23401 gtattttata tattgcttgg atcatcattt tcctatttca atattgtgtg tgtgtatata
    23461 tatatatata tatatatata tccatacatg tagtacgtac gtactgtaca ggagtggcca
    23521 gcaagcccag gcggcagcca ggcaaggcat ggccagcggc cggccagcca gccagggagc
    23581 ggccaacagc ccacctaaac acacgtttta aaggcctagg gacaaaatag tcaattcaag
    23641 gcaaaataca tgtatttgag atgacaaatg tgattaaaag tgtcaaaata tcattataac
    23701 agagtgacaa cgtttcgagt cctatttgag caaagccaac gttaagagtc ctattttaac
    23761 aaagacacac gtttgagagt cctattttaa caattttctc catccaaaca tagctacatt
    23821 ttgaggcatc aacaacagag acaccgacga tagtatcaca tcacccactg gaaatgaacc
    23881 aacaccttcc ttcacccaaa cgcgctgaac catttcacac aattccaaat tcgtttcagg
    23941 agctctcttt cactttcagc agtcagcagt cagcagtcag cacagagccc agctacggaa
    24001 caccacgcac agcaacgtta cggaccttct cgacggcgaa gacggtagcg cccgcctgta
    24061 gcagcgcggc ggtgagcgag ccggtgcccg ggccgatctc gagcacgacg tccccctcct
    24121 ccacccccgc cgccgccacc agctcctcgt tcaccttgga gttgagcatg tagttctgcg
    24181 gagagacgag agccgcgtgg gtacgtggtg aatggtgagc ccgtctttgg gtagcgcgga
    24241 ttcggggttg agtgggagga cctgcccgag ggattttcgg gggacgtggc ggccgcggga
    24301 gttgagggag cggatggtgg agtggtagtc gtcggcgccg ggcgtggtgg ccgcggcggt
    24361 cgcggcgcgg agggtcctcc cgcgaagacg tgaggaggta tggacatgag gtgtcggcgg
    24421 cgggggccgg cggcgagtag tcgccggaga cggagaaggg cgcggtggcc ctggggataa
    24481 ggagctgagc gccaccattt tcgaaggttt tcagttttcc tcgccctttc gttttttctc
    24541 gtagacgttt tctctttttt ttattaaaaa aaggcgctgt tatggtgtgc cgggccgggc
    24601 cggcttcgta cctgttattt tcctcaaaca gtatcaattg atgggctttt gcaaattttt
    24661 gtagcttttt ttttaaaaaa aatgtttaga gcttgatcaa gcttccactc aaagtttgag
    24721 tgttattggt aaatcaggct tgatttgccg gattagccct cgggcttaga tgatgtgggt
    24781 atataattta caaaaaaaaa aagatgatgt gggttatata gtacgtagag cttatttaga
    24841 gtttggcaca aactccggtt tatgcagggt gtcaagaaac tccagtttct tctttgtaaa
    24901 agaaacaacc aaacaaacaa acaaagaaac ttcagtttca gagacagcca gacaggaatg
    24961 ctcacgggaa ccgtcatctg tggttgcttc aacacccaac cacgcccata tcacaattat
    25021 tgttaatcgc ccccataatc tgcaagaaat gatcttgtac tgtttccaca tacgctgccg
    25081 tggagcatcc atccagtcag cgcgatgagg atgaggatta tcatcggcaa agcaaaacaa
    25141 aacaaaaagg atgacgatgt acgcaagcaa ctgcgcgcaa ttaagctgat tattatattt
    25201 atattcctat tcctggtaca tgaaatcaca tgaaacgaca gatgctgatg ctaatttatt
    25261 gtgagagaaa aacactatta tttcgctgaa acggtacagc taagcgaaca tagcctaagt
    25321 tcatgcgagc tcagatgaat gaatggtgct gctgccgcct gccagtgcta tccatatcgc
    25381 ctccacgggc aactagagaa ctggacatgt atcatgccat tgcacatttg cactgtaata
    25441 gcttcattca cacgataaat ctactcccat gtcacgagaa atgccatcat atcaaagctg
    25501 gagaagaatg aagatgcatg cttggcaact cattaactca agcatatgtt ggcttgctca
    25561 aaagaacaaa aggaatacgc acgaccttac atgcatataa cctttcaata gcttatctca
    25621 aattgaagga atatatatgc accactggca ggtgtccacc ctggttactc tctacattgt
    25681 tagccattta acctgtacac tttacaagtc tcgcgcccat gcccatggac tgcctaccca
    25741 aaaactgctt tccaggagcc aagtgcccga gatcagggaa gcaggtcaag catcgacccg
    25801 ctacctattc ggttcactga gatcaccatc tggccatctg cgtgcttggc atacggtaac
    25861 aggaacctca aaatatcaat accaaaatct gtcaccattt cccatcttcc cgagaatcca
    25921 acagaggcac ggtgcgtggc cccttgtggc gattactgca accatacgat gggaaaaaat
    25981 ttcgtttgcg aactcccaca atcctcactg tggcatctgt gtcactgtcg cagctgtcac
    26041 aaactacatc tggaattcgc aagctaccaa tgatctcatc attcccctcc gatctttccg
    26101 gcgatgctat tacaatcaaa tcgcctttct cagtttttga gctgccagaa tctgctttca
    26161 ccgtaccttc ttcgtctttg acgctatccg aaaatgaagc tgcttctgat agaacacagg
    26221 ctgtggcctt cttttcgcgt ttgtagctgc tagttggagc tttgtctaat actgcaacct
    26281 cagagtcaga gatgtcttcc ataatcttat caacgtatcc agactccgca cttgctcctt
    26341 ctgacactgc aaccttggtg cctttgctag tcttaccagc ttctccaaac ttcccacttg
    26401 cttcatctga ttctgcaaca ctgatgcctc ctatactctt accagcatct ctagactctt
    26461 catttgcttc aacattgatg ccttcaatac gcttaccagc atccacacac tctccacttg
    26521 tggtcttcct tttgcgtttg tagctgctag ttggagcttt gtctaatact gcaacctcag
    26581 gctcagagtc agagatttct tccatactct tatcagtgta tccagacaca cttgctcctt
    26641 ctgacactgc aaccttggtg cctttgttgg tcttacaggt ctctccaaac tccctacttg
    26701 cttcatctga ttctgcaacg ttgatgcctc ctatactctt acaagcatct ctagactctt
    26761 cccttgcttc ttctggttct gcaacattga tgccttcaat actcttttct tctgatgctg
    26821 caacaatgcc ttcagtactc ttaccagcat ctcctgactc tccacttgcc tcttctgatg
    26881 ctacaacctt gatgccttca ttgctcttga cagtgcttcc caaccctcct accacctcta
    26941 cgaccatttc tgaactgtca gaaggtgcat ctgctttcag ttctccatcc tttatgctgt
    27001 catcaggatc agatgcatct gctcctgata aagcatcatc cagcttggca ctttcaaatt
    27061 cttccagcag tagctctctt attctctgcc ttagatcaga tgcttcttca ggtttgaacc
    27121 aactccgacc aaactgtgta acaaacacaa gttcattatt gaaatctctc aaacaatctt
    27181 aaaagttgaa cataaacagc aaacaagaac tgaacaagta cagcaaagag ctagcagcac
    27241 taaccatatc aagtttatca actgtgaatc tttctggtgc ctcttctata aaccgttcaa
    27301 tataataaag catgaagatg ccacagtcgt actcattatt ctgccgcgga acctaacagt
    27361 ttttgaaaac atgttatatt gatttctgag taaactcaag tagtcgcagt ctcaacaaat
    27421 gtttaacgca aacatctgga aacctatgtg ccaagagaac tggaaggaca gtgttacttt
    27481 gcacattgtt atactgtatg tacctcgacg ctttccttga gtatattact tttaagatcc
    27541 tcccatgttg tccctaaaat tgatgatagt tggcgccatt ctttttcaag gtatctgcaa
    27601 catgttgttg gcattgtcag tgttgcgcag agggtaggtc acttgcacta aaactcagca
    27661 gtgggcaagt ctaccacatt ctagaatttc ttgtcttttt aatagcaaaa atgaaaatag
    27721 ctagacaact atagctgaag tagtgaaagt cgttacttgc ctctcaactg tgttcaagat
    27781 cttagtactg ggatgcatcg ctagagagtc cagatgaagt atgattggtc ctgaagtact
    27841 cttttttgca ggaatgcaaa tgattaccaa gctccagtgc gccctggttt acaaatgtaa
    27901 agagacattt tttcataaat atactataca cgaaggtaca gcgtgaaaga catgattgta
    27961 ggtttcaaaa gcattcagta tatgctaaag ggcaacagtt caggcgataa aaaaggttta
    28021 acaaataagc acaatattag gaatctcagg agccacattc aagatctaag ataattcaaa
    28081 gggggtccag atgaaccatg aaacttgcta acaagctgat aatgtcttaa acatatagaa
    28141 gtgtggcttt gagaacaaat tatattgcat ggatctgaat aatagtattt cggcttcata
    28201 ttgtaaatgt tttattcagt atcgacttac gtcccatgga tcggcaagat gatgtatgct
    28261 ttatttaata tattgacacc tttccaccat cttctcaact ttgagaactc atcctggaac
    28321 aaaatccaat gaaaacataa attttgccat ctaagatatc atgttaagat aataaaaatg
    28381 aacaaacaag tagaacaaaa aataatgtca acacatgaac ataagagaaa tgagagaaaa
    28441 aaaaaacagg agagaatact ttaattcaat ttgaatttgg aaaaagaaga tgatcaaatt
    28501 ttgtgaagga ctagtgggaa aatactggaa aatgactgga ttgaaatgta gttgaataaa
    28561 actcaaatgt gcgtccaacc cttgagcatt gtacgtcata aggggtacaa gaaaaaaatg
    28621 gtaattcctc actcaagaag aaaataattg gttagttgta attcctccct caagaaggca
    28681 ggcctggagc actggtacaa tctctagttg tgccttggac atcctgggtt gaaaccagac
    28741 tccttttgca caaaaagaaa gggtaaggtt ctctagaaat tcccttcccc agaccccgtc
    28801 ttgtatggga gctttcagga ctgggtatgc catcttttaa ttgtaattcc acccaaggaa
    28861 agaaggacct atctcatagc aactggcaag gaagaacaaa aactgtctat tggcatggcc
    28921 tttatactat ctccttccaa gaatagtggt gtgctccggc acaatcaaca tatgaacccc
    28981 caacccattt taatttgctg gccattttgg ttgtccggct tctttcaaaa caccacaagt
    29041 gtgtgttcag gagtcaactg agtacctcag ctgaggtcaa gggtgaaagc tagagaaaaa
    29101 atagaggggg tgcagactgc ctgtgagtgc atgagttaat tgtggggtgc aattgtgcaa
    29161 ataaggtgaa aaatctatag caataactaa tttcttgttt ataggcctgg gtaggcctgg
    29221 gtatggacac acccaaatcg gcctatatgg atccgccgct ggctgtggtc catgggatcc
    29281 ttgaaggttc actctcagca ggagcttccg gtttgagctc catgatgcca caaatctgtt
    29341 gattgggtag cgtttctctc aaacatgtta catgtcacat atgcatgttt aacagtttga
    29401 gtttgtgcgc gttcgttttt ccttctttgc attagtactg tactagtgtc cataccttct
    29461 ataggccctg tttggatcca taaaggtaat acttagctgc taataattaa aacgggtcca
    29521 gctatctcac tagttgagcc aaaccagcta atagttagct actaatatta gctagctaac
    29581 tattactcca ttccatccaa attataagac attttggctt ttctagatgc actgctttta
    29641 ctatatatct agacagtgta tatctaattg catagcaaaa tcaatgtatc tagaaaaccc
    29701 aaaacgtctt ataatttgga atggagggag tagtagctaa tggatccaaa caaggcctta
    29761 atagggggac tgacatctct cctgccagtt tagaggaaaa aatgaacaaa aacttctatt
    29821 acaaggcact catgtattat gcacccagaa gagtatatta tcccaatttt gaacaaagac
    29881 atagtgcaaa gccatttggt aagagaagta tgacttcatg gcacaaaaga tcgtaccgga
    29941 caatacaatg cttcttcaag ctttccataa aaatacgtgt taaatatgta gaatttgtct
    30001 ctgaaatctt cagcacacaa tctgttcctt tggatgtacc tgcacagcaa catcaaggaa
    30061 agaatacaga gtatctttta atacctccct ggaaatagca tagctcagag ttcacataat
    30121 actcatttac aaattcttcg gctaaataac ccacagtaaa tagtttgatg gcattcagta
    30181 ctttacaatt tacaatgtga gtagcagtag aagagcaaac attaacacct aaatattccc
    30241 atatcgaacc tttcactcgt tgcttcctat ttgtttgaaa aataagtgat acactggagc
    30301 agtttaagta aaaaatcata atacaaagtc gtgacttact ggatgtagaa gtttatcacc
    30361 ggtgacgaca aatatactcc aggatcaaga catttaatat cagatctggt gagctccaca
    30421 gattctctat tatctctgtt cataataaaa tcaaaagaag gtaaaataaa caccgaccat
    30481 gaattcatga tcttaaaaaa aagtgcacaa ttcacctcga tgggtagtag atcttcagtt
    30541 cattcctgaa aatacaattg gttcccgcta acagtttaca tgatgaatac aacaccagag
    30601 agaagcttac cgtctgtcag acatctcaca gtttacttct tcctcaggtt tcatatcttc
    30661 atcatccaat agaaccacat cttgaacctt atgggcaact caggttaata aatgtgtaag
    30721 gtcaaaattg catgtaaaag tggtgccatg accaaactac catgagaaag tatggcatag
    30781 tgcccgtctg cccgataaat ggcctgtctc ttgccgatgc cacatatgac agccaaactt
    30841 attatgaaca aataatacca tggcaaaatt agcagtgtct attaaagaag gtaataacga
    30901 cctgaccttt ctgaaaacaa gatttagtgc gaaacacaaa gctttgtgaa ctcatgttaa
    30961 caaagagagt ttatttttct caaccttgcc cagccttgct agtgagcaat cgttaatgca
    31021 atgaacccat caataaccgg aagaaatgtc cttggtagta aacaccaaca ctcactatgt
    31081 actctacagt tcttatgacc acttaagtca aacatgatat gctcattacg catttcatgc
    31141 agtaggatta cattgaaatg caacataata tagtttgaac atttagcagc taatctgaaa
    31201 tgaggatcgt gtgattttaa cattcaagca acaggaaagt atggatgatt agttatggaa
    31261 taggaaatta aaggagaatt cgcagagtac tcagaatcag cataccaacc tttcgagaat
    31321 aaacagaaga tgaattctga agctgttcct tcctcctgca tagaagaatt aaaaatgagc
    31381 tactgattcg tacttctaga tggatcaaag taatattaag ctatatatat tatatatata
    31441 taaaatggta catcatagat gccaatgtat atgaccacat gtgtgtaata tgtaaatgct
    31501 ttgtgcaaca taagcaaggc agagaatatc ttcaataatc tacaaatttc cataaatcgt
    31561 cacagtttca ttaacaaata ttggacggtt gtacaaaatg gaaagataaa attactagtt
    31621 agaaatgtga cataaatagc tttgtctgta aacacaagga aaatggaagc ccacctctta
    31681 gagaatcttc tggggaggga actctcaacc ttctgacatt tttcatgatc agacacctct
    31741 ggatcaatgg catgagtcct cttcgcagat aaagatgtgg aacttggttg gcttgagtac
    31801 atcttgtcca ccgatatagg atcccttttc cctgcacgcc cttggctttt gagtgtattc
    31861 aatggtaact gcatccacaa ttccctcata atagtttcca ctagagagat tcctacagtt
    31921 caacaagaca taaaaaaaag ggagaaagaa aaaaaaaagt gccgtacctt gcaatattta
    31981 tttttctgaa tgggaggtaa cctcagacag aatctgttgc tctcatgttc cgtctgctcg
    32041 tcttccaggc ctacaaacaa atgacacata acaaatcaat gtcagtttgt atcagtgaac
    32101 agctgtaaca gattcaaccg acgctttatt ctgatgattg atattccaca cggatagcat
    32161 gcatttcccg tgataaatcc actaacccat gacatgtgcc taaagtctcg gacacacctt
    32221 ttgcggctgg cagatgtgca agattagaaa tgataacgac agaaagagtg gaaatcttac
    32281 cccaatcata cacatcctta gaagcggcat gagcatcctg tccccgacca acagcagcct
    32341 gcaaaccaag cgagcaaatg gtactcggaa tcaccgatgc aatgtagtag ctcagaaagg
    32401 gggacaaaga cctacgcgca aaacacagct gaggaacagt atgcgaaact accgcgaggt
    32461 tcaacttcat ccatccgtaa tcaaacaccc cagacacaac tgcaggagag cgggcgtacg
    32521 cgcgtacctt ggcggccgct cgggtcacca gtcggcgcgc cccgtcatcc ccgtgcgcgg
    32581 cggtgcggcg ctcggccacg caccagtcga catcgtcgcg cagcgccccg aacttcctcc
    32641 ggtggtgtct gtctggggac ccccgccgcc gctcgtcgcc cgataacgcc ttcgtgacgc
    32701 ccaacgcccg cgcccgcgtc accggcacct tcgccgcgga ggcgcgcggc gcagacgagg
    32761 gggaggcgaa gcagacatcg acctcgcggt cgcgggacgg tgagttgaca agcacctcct
    32821 cccaatcgat gtcgatccgc cccatcgccg ccgccgccgc cgatcggcct gcgatcgggg
    32881 aggagagaga tgattgactt ggggggtttg ccttttgggg ggtttgtgcg agggaaagag
    32941 tggggagagg aaccgaggag gaggaggaag tggaggttgc cgcttaattg ctcggcgaaa
    33001 tcattcgttc gccagcttac gccggaagga agacgggttt gcggcgtggg aggggacggg
    33061 ttctgtatag tagtgggcct gatgggccag cgtcattcat cggctactgt tagttaggcc
    33121 caggtccgct aagtatgtat gggaaaaaaa catggggctg tgggttgtat agtgatgggc
    33181 taatcaggcg ttggaccaga cacccccaac cccccaccca ccccccaccc cccccgcacc
    33241 catgctttag ttttggttta attcgaactc aaattagaaa cattcattca tgcaaacaat
    33301 ttgggcatgc tgtgatgaag tcttaaagag cagtaatgga ggattacagt atatgaaatc
    33361 gaagtatggc caattggcaa catgtcccac aagcaaccaa aaaaaactgt gcgtattctc
    33421 tttttttttt gaaacagcaa attctctatt tgtaaaaaat ataacagcca tgtatgtgac
    33481 ttcacctcca ccgaagagga ttcagatcag ctcactagtt cattgctttt ctggatgcgt
    33541 agattctagg gctacgctag ctcccgaacg tccggaccgg acgcctgcgt tcgaacgtcc
    33601 acgcagcgtg ccacgtgcac tgatttttat ttccggccca cgcgtgcacc cgccctgtca
    33661 cagcgcccac gtgtccagac gactcacctc acccgcgcag cacgccctgt ctgcctggat
    33721 tcgaggctgc tcctcccgtc cacacgcacc ccgccctcgt cgcgcctgac cgacggcccc
    33781 caatgttcct cgtctacagg acactagcgc gttgcgcgcc ccatccgctg gcctccagct
    33841 cgccgtggcc cattctccgg cgcccgtgtc gtgccatcat ctctccctcg cacccctcga
    33901 ctctccaaac aacatgaaac acttgaatgc aacatccgta tgaaacggat gaaacattta
    33961 gaacatacat ttgtaacata tgtgtgaaat atatgcaata ccagataaaa cacttgcagc
    34021 ttgcgaacat gaaaacatgt actgcaacat aaaactaaaa atggttgaaa catttgaaag
    34081 atattttgtt gcaacgtatg tgtgaaatat gtgcaatatc caaatttgaa cgcttgcaac
    34141 atacgtctgg aacaaaaaca ttttgaacaa cacatctgaa acacttgcaa catgcctatg
    34201 aaacacttgc aatatatgta acatccccga tctacttttg caacatccat atgaaacaat
    34261 tacaacatac ctttaaaacg tctgaaacac ttgaaacgtc acttgcaaca tgcgcttcca
    34321 tcgcaaaatc tccatgttga ggtcgtgctt cacggcggcc acagcgtcga cagcggccac
    34381 gaccttctgg tggggaacga cggcgacggc ggcacctcgg cagcaccccg gcgcgcagca
    34441 cacaacgagc tagagagggg gcgcagcgaa gtggggcagg gcggggatgg agcatggcgc
    34501 aacgacagaa ggggcatggc gtgggatgag agcgcgaggt tagatggggg agccgcacgg
    34561 cgagatatag agtgcactta gatacatagt aagaataatg tatacagaaa gtaatattct
    34621 ataacttgaa atggacggag tacaattttt agcattcgat aagctaaact cgtagtttat
    34681 agttctaatg cgtcacggac acgggacgga ggatttttat attttaatcc ttttaaataa
    34741 tttcacttaa aactaccaaa agttagatct gaaaaaaaaa tttaggtgag attattttta
    34801 aaatattaaa taaaaaatat aaaaatataa aaaaatccac acgggacgca cggctcacgt
    34861 gcaccgctcg agaggcagag cgcacggcgg gataagagga gtgggccctg ctggcctcac
    34921 gctcggtttt cggggttaga ctgtctgcag tggcatactc taaacgatac tctaaagctt
    34981 tagagtatga atatagagta aaaactgctg cactgggtac tttaaaacga tactctatct
    35041 tttctctcac tctatattta aagtagtaca gtgtttactc tatatgcgca gtggcggacc
    35101 ccactagcta aaccaaggaa aaaaatgcta taactcacaa accaaaaatc caaattaaat
    35161 ttcgattgca ctattaaatt cgtctcaata aatccttcaa aactagatca cacatgaata
    35221 tatttagata aagtgacaag tgggtcccat aataaataga gtggatagag gatgatatag
    35281 aggatggatg ggtgcggaag aattgagtat agaggagaga atcttgctga ctaggacgta
    35341 tagaggatga atatagaggt ccatgagtgc ggatagcctt aggcggttga cgggggccac
    35401 gcttcccgcg cttttagcgc aaaactgaaa gcgggcgccg gggtttagac tgtccgcacc
    35461 gcgaccctct aaatcatcct ccaggaagct atagcggacg aaccggctgc agcgggtacg
    35521 ctatcgcata cgctacgcgt gcggacgagc cggccgtccg ctattcccag cggactcgca
    35581 gacgtccgct acccgcgcgt ggggcccgcc gagcgagcga gcagagaggg gaaggagaag
    35641 ggagagaggg agagagcaga gggaggtgga ggacgcgccg gagcccatgg ccgccagccg
    35701 cgagctcgga gtcgcctcgc cagcgccgcc acgccccggc cgaggttgcg ccgccgtcca
    35761 tgctcgcgag cgcggcgccg cgagccccgc agcaacgccg ccgcgggccg cggacggaga
    35821 aagagcggcc gtcgacgccg cgcctctgct ccggagccgc cgccctcggt gcccgacctt
    35881 ccgtagcccg gagccgcgcg ccctcgccgg ggcccgcgag ccgcgcccct cggagcccgg
    35941 agccgcgcgc gctcgccggc gccggagcgc gccctcgcca gagctgccgc gcgcgctcgc
    36001 tggagaggga ggtggaggac ggggagaggg cgagcggtgg tgcggggaga gggcgagcgg
    36061 tgcggttgaa tggatagagg agaggggaaa aagaaaagaa aagaaaagaa aagaaaagga
    36121 aagagaaaaa gggaaaaaag aaaaaagaaa aaaaatctga caagtgggtc ccacagtgga
    36181 tagaggatga tatagagtat ggatgagtgc ggaagaaatt gatatagagg atggaatctc
    36241 gatgaccagg acggaatatt ccttttagag gatgaattta gagtacgatg agtgcggata
    36301 gccttaggac tggagtgggt gaggtggggc cgtgggggct gttgcgtggg gagactcgtg
    36361 gatggcacgt gggctatata cgtggtgttt ttattggtgg cctcggctgc tcagttggtg
    36421 actagtattg tcagtcgcgt gataggctgc tagggacaca acagtattat attctccaaa
    36481 gttaacttta ggtaatgttt cacagaagaa aaaatgactt gcatgtatag gagcagtact
    36541 gtagtagatt tattttattt ccgtaacgac agtttagtcg ttagacaccc atagatgcct
    36601 cattgtggcc gaaacaaacc atcttcaatg aaacttaatt cactgtgcgc ggaggcagca
    36661 ccagtaaata tatacctcct gttcggctga gcttatcagc cgtggaacag tgtttttctc
    36721 tcacagcaaa tcagccacag tcggcttata agccaaaaaa acagcctgcc gaacagggcc
    36781 atagagagag agccgataaa aaagattcga catatttaaa ccgagatagc tcatctattt
    36841 attttttatg gtacaacttg accaccagag ttagtcatcg atgcaattgc tcctattttt
    36901 ctagatctat tctagtactt gacgtgtgga tctcaaaatc taccaattta ttattttgga
    36961 tgtgctcata atggcgtagg acatacattt gttcatagag gtgagtttgt tatgcatgac
    37021 tgcatgtatg tgaacgtcta cgcgatttat agtaaaagaa aaatcgatat aataatagta
    37081 aatgccaccc aataagcttg ataaaggata aagtattgta ttattttcta gttattagtt
    37141 aagtacgcat tcagtaaaat atataatata ataaaacata atatgcattt agcaaaacca
    37201 aacattttca tttaatgtgt ctatacggca gggaagcgag tttagataaa tcaaaatatt
    37261 ttattctaat tgtatttatt gtgattttat tatctagaaa acatcaataa atatatatat
    37321 atatgataat aatttttatt atatgtttta aaatataaat atagagtaaa aaatatattg
    37381 cgctattagg gggcacatga cccctaacgt ccaccttgct ccaccccttg cacgctattc
    37441 atatgtgtaa cgtctagttc gagtggatag aacaaacata ttagtgaagt tgtgcttagt
    37501 tagttgtagt tcacgtgttt gccataaagt ttgtatgaac actagcaaga accccgctcg
    37561 ttgccgcggg cagaaaagag caagttgaaa aggccaagtt gcatggcata attgcaaatg
    37621 ggaacactta ggctaacaac aatatgacta aaataacaat agtgatatcc gaacgaactt
    37681 tataaaagca agattgttca ttacacagtg aaatggagcc tttaagtcgt caacgaaata
    37741 gttatttctg aaacctgaga tcattggaag gagagtgttc tggaagcaca cacctagaca
    37801 atgagtgaca gagtaggcta tgaaattaaa catcgtaacc acaaatagtt tttggctatc
    37861 ttttattaat aatttcattt ggcaaaagct aacacgggtt attaagtttt acatctatac
    37921 aattagaaga gagataataa tctggattcg acaaaagata tgaaggtatc agattcataa
    37981 ggattctcat tatattaacc ttgacctttg tatatatcat ctagttgagg atgtttgcca
    38041 agtgaagtaa gaccatgtag gttctgtatc tgcataagaa aatgacaata agaatttagt
    38101 atcgttgtat atagctaatt cctgtaaatt acagaaggcc tattagggtt tttgctatcg
    38161 cattggtagt tatatatatg actggcgtgt atcaagtgaa gtctgtttca ataaagtcga
    38221 aaaacaacta tctatcctag gatagaaata ttacttatcg tatcagatat tcaagggcaa
    38281 tctaaaagtg gacatcatgc tctatgttat tcaaagtaga gttaacctag aaacacataa
    38341 ttttaggcta gccgtatttc atatttttgt tgcacagaaa ggcatcaagg ttgagtaaac
    38401 ctagatttgc aattagcggt gatgaattac aatcgatagt gcgctctaag gctgacgact
    38461 gcattctatg ttctgcagct aaatactgga aaaattacta agaattcgga acaatatatg
    38521 ttgcatattc tatcagtcaa ttttctaaaa ttattgaaaa aatattgtac cttccatagc
    38581 aggcgggcaa atatttggaa tgcgctcgtg ctgcctcctt cttttctgca aaaagaacgg
    38641 taataagcaa tgagtgttag atacttacaa acaatcctta tacacagata aatgttttat
    38701 tacagtcgag cgaagcaaac ccaaaggcag tgtttgttct ttgcttggga accattcacc
    38761 atagtgattc agcaaaacaa aatgcaagtt cattttcttg tcttggatca attactaagg
    38821 ccatctatca gaatcttgtg catagcacaa accctggtat gacctacaaa cctcttgccg
    38881 cgttgtatat gaaggtgata taagttagtt ttttcagcaa gccatcgtaa ttaggccgta
    38941 actaatagag cttgctctat ggaatcattt ggatggtccg gtgtactaat taatggagaa
    39001 cataacacaa acatccaaag gtatttacct gagatagagg tcaaggaaga agcaaataga
    39061 tatgtggatg tgttaatgac ctagtaacat cgaacttgtt caattgataa caaaaatggt
    39121 gtgaggtgca aaggatccat gaactaataa ccttgcacaa ttgaagctta atgtgaaggg
    39181 actccatgcc tgggaggcaa gctgcaagca aacctgaggg aaacctgcat aacctaaatg
    39241 acactggtat ttgtattttt ggacaaacaa ataaaaaaag atgtagattc agtaaaaatt
    39301 ataaatcaaa attttaatat ggccttaaac taaaatccga aagtaaaaac acaaagtatg
    39361 gttaacctaa actaagtgtt aactttataa gttctaaaat tatgtatagg aaaatcacat
    39421 ataccgatct aagatggagc gtttatggta gaatcaaata tctgaatata ctgctctaag
    39481 ataggcactc aatcataaat ataccaagag aagatctaga aaatacgtgt taatctatgg
    39541 caggaacctc tgctgtaact ccacaatttt gtggttccga tagtacagtg accaaatgtc
    39601 atacaatcct gcagtagcta tacgtaggct gacccatatc aagttgcaac aacgaatatc
    39661 atttgagtaa aaggagagaa gcactggaaa ataaaatact ggaaaagcaa gtataggtgc
    39721 cttgtattac ctggtacatt ctaaaagcag taattcacag aaacagcttc atccactact
    39781 ccctgacatt ttgaaaacaa agaaacgaag gttaatctta agatccatca aataaggcat
    39841 agtggatgga ggaaaccctt aagttttttt tattgaaaaa aggagaaaac atgaactgca
    39901 cagagagccc aaaatctata caaaaagctt ggaagggaag aaccaacagg gcaaaaaaaa
    39961 gacataccct gatcaaccac ttccgctggc cattgattga tgatcactta gcactctgtt
    40021 gttccagccc gaatgattcc atgtggatac ctgcatcgag catcggaact gagatggatc
    40081 ggcaagtgaa taaaaaacaa tagagaaggt agacaaaaat gccaacaacc tcaaatatca
    40141 agcaaagagg actcgtagct gcagttgatc gaaaatttcg atccattgga actatacgaa
    40201 gcaacagcca taaactgaac tggaattaaa tacgaataga acgattgata ggctgcctaa
    40261 gcgcccagca aaccatttgt gagctaaagt atataattcc tacaaattac aattaccagc
    40321 tgcacaggcg caactacaaa atcaaaacgg aatcagtaaa gcacaggaga taacacatgt
    40381 gcatattcct gttgggttag attttttttt gtagagttct atagtgacag aactaatatg
    40441 acccatataa aattgtacat gcataataca gaggaccaag atatttcaac gtaagatcac
    40501 agctagattt gagaggccta agaaaaaaac gcaaaaacag agaacctttt tctattatta
    40561 tgacattccg catgagctgc tgactgccaa caggggagaa gcttcaccaa cgcccagacc
    40621 tgcagcggca gaagaaaatt aaacaggatg caccgattac accgagccat cgtctaacct
    40681 cctgcttcgt ctccgtcact gtcaggccgg tgcacgatga ccaaaggcct tgtttagttt
    40741 cttcccttaa aatttagttc ctatcacatt atatgtttga cacatacatg gagtattaaa
    40801 tatatatact aaaaataact aattgtacag attgcgacta ctttgcgaga caaatttttt
    40861 aaacctaatt agtccatgat ttgacaatat ggtactacag taacatgcta gtgacggatt
    40921 aattaagctt aataaattcg tctcgtggat tacagaggac ttgtgtaatt tgttttatca
    40981 ttactatccg aacatctcga tgtgacaccc cataaacttt agcctctgga tttaaacatc
    41041 actaaagaac tggcacacct accgttgcac acaggtttgg tagctagaag aacgaaccta
    41101 gcgtggcaac agcagatccg ccccgtgcag tcatgggcta gcctccaacg cgcaggtaag
    41161 acaacaacct aatccactgc ggtgcaggga aaagcacgaa ggagaggcta gggtaggggc
    41221 aacgacaaca cgacgagagg aaaggagcgt ccgcaccggc gagcttccac tcttgacgag
    41281 gcgcatgtgc gccgcgtagg ggcccgaccg aggtggggtc gccagtgcta gggctggatt
    41341 cccgagcggg tgtgtcgctc gtgcttgggc gtcggagccg ctagggcgcc ctacctcacc
    41401 tgtgctggcc gcaggcggta cgggagcgcg ggaggaggta ggtaccgcgg ccgcatcggc
    41461 cagtgcagag gcggcggtag gtccggccgc cgcatctggc cccgtaggca ccagggagag
    41521 gaagaggaga cgacgcgatt cgtccacgta gccaggcggc cgcatccacg tgcgctgcca
    41581 ccgggggaga ggaagacgga ggtgacgaag cggggggagc aggcggaggg agcgcggcgg
    41641 cggccgggga gaggaaggga gaggcgacca tgcggggtag caggtggagg cagcgaggtg
    41701 ggtggagggg ataaggatag agaggaatgg ctacgatgga tccaatggaa aaactaaaga
    41761 tttcatatga tgtaacctag tacgggtcgt ggaggccgag acagctctta tgtattgatt
    41821 gcttgcgaag atgaacattg aactcgaaca gaacacttgg atcgagcctg agggtgtcag
    41881 ccgtgagctc gacggttgtc gagtatcgaa tcaagagttc cccatacggt tacacaacag
    41941 aaaaaaggac cacgaatgtt ttacacggcc gaagctttac gtgtggaaat aacatgccac
    42001 ggttaacgaa atagaaatcc ttatctatac tataaaagag cgaaggaatt gaaaatagca
    42061 tgttacctgg aaatttctac ccaccctatg ttttaaatct tagatcatcg atccaataca
    42121 tgtaatcttc tttcttaacc taacaaacgg gcccagccga aaaactttta attctttacg
    42181 cgtgtttata cgtgtggttc ctcggatcac tatttttttc ccacaaaaaa atacccaacc
    42241 cacctatacc ccaggaacgt cggtctcctc aaaacccaca tgcatatacc cacacgccgg
    42301 cctctttgac tgtccccatc ccatccatac acgaggcaac gacggcggcg atagggctcc
    42361 tacggcatga acgagtttga tctccagcat gccgagggag tgctttgctg cgggctccta
    42421 ctccgacgag attgtctcca ccacggtcag gccgacgact ccttccatga caggtaccgg
    42481 cggcacaggc tcctctggag gaagaagttc gcgaggatga cgaacacggg gtgccccgac
    42541 gcgtcctagc tcgtgagctt gccgtaccta tcgacgaacg cccctgcaga accgaagcgc
    42601 ccgtggattg gatcacgatc gagctagact gatgaattga cgaaagaaat gagacgacac
    42661 tcatggaaga gaagcagcag ccagcgatca tggtgccgcg cggggctgtc cttcgcgcgc
    42721 gccgcctgtg tgacggtaac agcgaacgaa gaggacacca ttctccttca cttgatcatc
    42781 atgtccatca tttcatgtgc atctccacca tgatcatcat ttcatgtcca tgcaccatct
    42841 ctttgtgatc ttgtggccac cactccttgc cacgtacacc ttcatcacat gtgttgctta
    42901 tgcctaactc aaaatactta acacatggca ttagcaactt ggtgtcatta attaccaaaa
    42961 ccaaacttgg gctttcagac acgggttgtg cttttccggg acacggacgc agaagtgcaa
    43021 gcgcaagttg cataatctag aagacgaact actctactag gtaatctcgt gcaggtaaca
    43081 taaagaacaa acccctgata gtctgatcct gcatgctatc agaagcccat gctcatgtat
    43141 ctagaagaag caatgataag aacccccaga aacactctgc aacaacctga actgatgcgt
    43201 ctagagttgt tcagttctta aaaatattag attcaaaaaa acgtgaaaat actatgataa
    43261 aaatgtaact acaattaagc tagaaaatgg caactaaaaa cgacatatac cttctacgca
    43321 cgtgcgtgcc gcacatgcat attaactagt ttatgtaaat ggcttaggga tgtttggttt
    43381 cccttgtttt tttatattta tcatattaaa tgtttggaca catgcataga gtgttaaaca
    43441 tatactaatt acaaaactaa ttgcacagat tgagattaat ttacgagacg aatctattaa
    43501 acctaattag tccattatta gtatctgaac accctatgat taaacccata attaacacct
    43561 attaaagttt atcagggtga accaaacaag tcctcacaac ccagtttcaa aatgtttagt
    43621 tggcacgtta gtattaaaaa ataagtcgcc gagaaagcaa ccaccctgtt cggcaggctg
    43681 tttctgcgac ttataaacca gttgtggctg ttttgttatg agaaaaaaat actgtactac
    43741 ggctgataag ccgtgctgat aagctcagcc gaagagtgtg aacgttttct tctcggctca
    43801 gcaccccggc cagcacgacg cactgttgat tacttccgtg gcctctccga ataacagcac
    43861 tcagctacta caaccccggt tagaagcatt ctgttctaac tcaaatttat ctaaatttaa
    43921 atagcaatat acataaataa aacattaaga tatcctctag gtaatatcta gaacgaaaat
    43981 ctaccctatt aatgcatgtg cagcaaattt gttgctggtg cctttcggga aaaaaaagaa
    44041 tacctcgaac gaaaataaca atatactaag caaagctgat gaaaggttga attatggcat
    44101 ttataaacaa acaaacacaa tatcttcgat cacatggaat actagtattt agggcctgtt
    44161 tagatgccca aaaacatcca aatttttttg cacagtaccc gtcacatcga atctttggac
    44221 gcatgcatgg agcattaaat gtagataaaa aaataactaa ttgcacagtt tgtctgtaaa
    44281 tgtcgagacg aatcttttga gcctagttag tccatagtta aataattttt gtcaaataat
    44341 aacgaaaagt gctacatgaa cttttcccaa aaatttttga cacctaaaca cgcccttact
    44401 acaagtaaca agatccggtt tggcacggtt ccaatgaagc gacggcgtga cggcaagcga
    44461 gagcaataat ggccggggca acggctgtta gatcttagga tcgtttaggt gcggatctag
    44521 tgggtagttc tttggtattt ggaataaaca agtgatagtt cgatccggag agagaggaga
    44581 gagaggagtg gttggtgaca ttaagattac cgattgtcga agatgaagga actcgaggcc
    44641 cgcgcgtggt gttgatggcg aagtccttcg aagtccatgg agtcgtagca gcacagtggg
    44701 acgcgatcca gtggcgatga tgaagaccgg tggcgcttcc cgccgcttca gcgcctcccc
    44761 ttagatcggt gtagggacta ggtggggtgt agtggcgaca gtgaacctcg taaccctaac
    44821 cattagcccc cacctcctat ttatggcact gcgcgacgag ggcccaccag ccacttcatt
    44881 gggctgggcg tccccgatca ggacgcatca agggcccaca cctttactca tggggagatt
    44941 tggagaggtt ggtgccctcg ctatctggtg gcaccttgcc gccggcatca cctggttgag
    45001 ttagccacga aatagatcgt ctcgtatgca ccggccgccg ccaccgccgc ctgccaattc
    45061 gtagctgctg gcgtagaatg aatagattac aatgagtgct agagtacatg agtatgaaaa
    45121 atgcttctga ataagaatta ttttaagaat tttgattaat gtttccgctg caaagaaaag
    45181 aaaagaatat tgtcttctca ttaaatccga accaacggga ggatttaatt tgaagtgcag
    45241 ttaaagttgt tcagaaaatg atgaaaagtt tatcctctaa ttaaaccaac gagaaaattt
    45301 tgattagagg gatattcaca ttatgattta agtgaaatta tgatattgtt attttctgac
    45361 caacgttgat gataacaata ttataagctt atttatgaat ttgaagttga gatttaaatc
    45421 tctgataaat tatgcatcaa agtgatcaat tttcagagaa tagataaaga tcaagaaatg
    45481 ctcatgaaat agaaagatgt ttccgctgca atgatgatga tgatgatctt ctaattaaat
    45541 tcgaaccaac gggagaattt aattttgaag agagtcaatg ataattgagt tgttccatat
    45601 gttaattcca tttatgccca acggtgatgt ggaattaatg tacaagaata ttatattcat
    45661 gatgttgcta attttagcaa aagttattga tagaaaattt tatgaatttt atctatgagc
    45721 tttatacatt tattctattt ctgcccaatg gtgatataga attaatgtag aagaaggttg
    45781 ttttgttcta tatctgccca acggtgatat agaatagaat ataaagaaat tagagtttaa
    45841 tgttgatgac tattgttgaa aattcttcag acaaagatct tcatgctttc gttctttaag
    45901 gcagaaaaga aagagaaaga aaagcactgg gtacttgtaa ctcagatgat gaaaagccta
    45961 agcacaaatt gtgtatacga aagtaggcca ttgcatgaga gactgtgtcc tctttaagag
    46021 tggcttgaaa agaaatgttt cctcaaagat ttcagggata ttgatccaag aaaagaaata
    46081 gaacaataag agtttagttt gagaaatgtc ttttatgtac tctctatgaa aaataaaata
    46141 atttaatttt cagtttttta tcatcatgat atgaattgta atgaatgaca tgcatgttta
    46201 atttgaccaa cgtcggatta agcatgtgtg ttaaagaata acagttttat tcctgaattt
    46261 aatgattgaa tatgagccaa tcctggcatt tatgtccctt caagggaatt gcctcgcatg
    46321 gcggcataaa tttaaaaaaa tacccgcgtt gtggggcaaa gttggcatag cacttgtcct
    46381 gcatggcagg agaaagtgag atgaccatgt atatcccgca cagggagaga agtttagggt
    46441 agctctcatg ctatcctagt atgagtttaa gaacaaaagg aagttgaaaa tgaacctcat
    46501 gataagaatg acatgcgagc atgacttgca gaagtactga tgaaaaggac tctgttgagt
    46561 ttttgaagtg aaatgaggaa aagaatacat acttccatac gaattaagaa ataatttcat
    46621 cttccatgat gtaatcatgt ggatgaagtt aataatcaaa gtttcctcac tcacgagagt
    46681 tatgaaggtt tcaaaattgt ggcagaaaag gttgtgccac atttcgaggg ggaggattgt
    46741 gacatgaact gagaaagata gaaaggcaat gaaagaaact cagaaagata attgaaagaa
    46801 attccccatt atatgctttg catttagagg aaaagtgatc tataaaagat gaaggtgatc
    46861 gttgagggag tacaacggtc ataataaaga tacccctaag tatagaaatg gctaaattcc
    46921 tgaacccttt acagttcaac aggaagatag caatgagact aagaaatacg aagacggtgc
    46981 tcaaagcacc aaatgagata gattttaata gaataaaccc aaaataagaa agattgaaga
    47041 tacgctatcc ttacacgaga tggattaatc tgggggagca tggtatgaaa agatctacga
    47101 cttgaagaga agtgggacca gtgcctactc caatgactca agatcgacaa atgctcaaca
    47161 ccatgttgat gttatatgac tcatacaaca catgttgtta gcccttcaag aagatgaata
    47221 agaaaataag gatccggttt tacaggaccc tatagaatcg attggcaatg aaagagcaac
    47281 aacaacccca agtgaaagaa gtgccattag ctaaagatct gaaagtctca aagaataaga
    47341 gaatcagata tttctgatga ctataaattc tatatcaatg aagaaattta aatagaggat
    47401 gatcacacct catttgaaga aaccatgaga ggcgttaaca cgtctaaatt tcaagaagct
    47461 aaggaaattg aagtgaaatc gatgaatacc aacgaagttt gagaaataga agcagttcct
    47521 aatggagcca aaacagtagg ctgtaaagga tctacaagac gaaatgtgac tccaaaggga
    47581 acagaagata taaagcgcga cttgaatcga aagattttac gcaagagaat gaatagatta
    47641 caatgagtgc tagtggcaca tcatgatctg agatgaaagt aaagacagca tttcccaatg
    47701 ggatttgtat gaaaataatt acatggcaca acctaaaagt tttgtcgtgg aaagaaagaa
    47761 cgaacgaatg ggatgccatc tgtaaaaatc ttttatgaac tagagcaagt ctctaaacag
    47821 tggcatttca agttgaaagg tcaactagaa attttggatt aaagagaatg agaggacaat
    47881 tacatctgta caaagttata gaatgggaaa ttcatttcct aatcctgtat acgtggatga
    47941 caccttactt gctagtagtg atgtcaatct actatatgtg aagcagttct tgtcctcgag
    48001 actcaataag aatgttctcg gtgaaatgac actcattata agaattgaaa ttcaccgaga
    48061 caaatgaaag gggtattagg attatcacaa aggcatgctt agaaaatatt gtaaagaaac
    48121 aaagtatgca tgcaagtgaa cctacgcctg ttcatatagt caagggtaat aattttgaga
    48181 attttagcgt tacaagaacc aaaatgagat tgatcaaatg aatatggatc catatgcttc
    48241 agctgttgga agcttaatga gtgcacaact atgatattac agttaatgag tgcacaagta
    48301 tgatattacc ctaacatatt tcatttatcc gggatgtttt ggtagaaagt ccagtccaga
    48361 catagatcac tggaatggag attgagaatg tcttgcaatt atgcaaagat ttaataagcc
    48421 tcatgatgat taagaaagaa caagtactct caaatggttg tgggtacaag aatgttgaat
    48481 ttcggcgaga tgtttagtga aacccacata gtagctaact ctcgcagttg gagttttatt
    48541 gtggaaaagc tccaaagaaa catttgtggt gtcatcaatg atgcatacct atggtacaac
    48601 ttattatgag gcttatggga catgcgaaat ggttaactta tacccggaat ttgtaatggt
    48661 atacaacaac aattaccatt taaagtgatt gactcctatg acaacgggtc aagtgtgctg
    48721 tcaaacacat tgacatgaag ttagacgttg tgaaggagaa agtccggaat cttttaaaag
    48781 ctttcgaatg tataagtaaa aagcaagtac ttacagatca gcttataaag gcttgccacc
    48841 cagtgtgttc agagaacgca cagtcgacat gggtttatgg tatagcctat gatttccgga
    48901 caacaaaggg cccaaagaaa gtatcatttc aaaatggaga agtgtattgt ggctgttagt
    48961 ctagcggcac taattgctgt aacgatggga cagttctatg cactaatctg tgatggaata
    49021 ggaaagaagg aagaaaatgt gaattaaaat tttgagtaag aaattaaaga acgaagaaag
    49081 tgatgagaga tcaaggggga gaatgttggt ttgatctcca ccatgcttgg cccaacggcc
    49141 aggtgtgggc ccttgatgtg ttctgatcgg ggacgcccag cccaatgaag tggctggtgg
    49201 ccccccgtcg cgcggtgcca taaataggag gtggggggct actggttagc gagatgaggt
    49261 tcaccatcca gccgccacca cactccaaat cctagccgat ctagagggta gcactgccag
    49321 cgatgggaag acccaccggt gtcgccactg cgtcctcttc accgacacca tgcgagttgc
    49381 ttcaactacg ttgatcggta acatcgttcc tctccatctt catcttcttt tctctctgat
    49441 ttgtacacca taacaacatt gtttataaaa aagaaaagaa accaccgact gatctacacc
    49501 gactgatcta ctgctagacg gtccactgaa tataacaacg gcaaccgcgc aagatgcccc
    49561 gtgccgtgca cgcgcggtcc atgacacgac acccagcccc gaccccgagc tgagctgaga
    49621 cgtgcgtgac ctggcagagg cccgtcccgt cgtccccgtg ccgaaaataa aaacttggcg
    49681 gcacggcgtt tgggtgacgc cccgcgcccg cgcccgcgcg agccacatga catgattgat
    49741 ttcgtttcag tctcgtcttt atttttaaaa taaatgacag cgacgagacc cacaaaaaca
    49801 aagccacaag agaagaggac gcagaaggca aggcagccat ccacaagcca cccccaggcc
    49861 ctagactccc agtccccacc caccactacc accactcctc ccctcgccgc tgccgccgcc
    49921 gccgccagtt cccgcccgat ccggccgggt cgccccgcca tggaccaggt gagcgcgcgc
    49981 gccgtctccg atcgctccgc tactgccgcc ctcccccttc ccctctcgac ctgccgcagt
    50041 tgcggcggcg agcgacctct gtatgtctgt ctctgatgtg tccctgtaat gtaatgtaac
    50101 gcggccggcc ggaaatggtg ggcgcagtac gagaagacgg agaagatcgg ggaaggcacg
    50161 tacggggtgg tgtacaaggg cacaaaccgc cacaccaacg agacgatcgc gctcaagaag
    50221 atccgcctcg agcaggagga cgagggcgtc ccttccaccg ccatccgcga gatctccctc
    50281 ctcaaggaga tgcagcaccg caacatcgtc aggtacttac tcacttacgc gcatgccatg
    50341 ccagggtctg tttgtgtgct tggaacattg ccccggcccg ggcgttgccg ttgacaagct
    50401 acccgctgct gatgcgctcc gtgcaggctg caggacgtcg tgcacaacga caagtgcatc
    50461 tacctcgtct tcgagtacct cgacctcgac ctcaagaagc acatggactc ctccgccgac
    50521 ttcaagaacc accgcatagt caaagtcagt ctctcctcct ccctctccct tttttgcttt
    50581 gaatcgagcc gccgtacgcc actgctggtg ctgccgtacc acctactatc actcaacaca
    50641 gcggttccgt tgacgaggct gtgactgcga atgatagtaa ttgcgagata tgaatgaaat
    50701 gcaaattttc atgccggaat atgctccctg tgctgtgccg tgcagtccta cctctaccag
    50761 attctgcggg gcattgccta ctgccactcc caccgcgtgc tccaccgcga tctcaagcct
    50821 cagaacctgc tgctcgatcg ccgcaacaac atcttgaagc tcgccgactt tggattggcg
    50881 agggcgttcg gcatccctgt ccggactttc actcacgagg tacaatttca ctcacaccct
    50941 cacgacatgc tgtcggtctg gtagtacgct gacttaaggt gtctgcatta gtcaatccgc
    51001 agtagctgcg aaattgccat gacatgttgt tagcgtattg ggaaaggaat gcagttactc
    51061 gctcatgaac gccacaaaaa atgctatcat cgtcgccttt gtcgcacaga agtttgtaac
    51121 tgttcaattc gttaggccag atgcatatgc gtttcttcat ttttagagaa tggaacaagg
    51181 ttgcagcctc taccaacata tgcgttcctt catggcgtac tggtaccact atctgaattg
    51241 cttgcacgct tttcatattg tgcaaactgt tttgtaactg ccagtaacgc cattcccgcg
    51301 tgcttttgtg tagtgcgcct taagattgtt tacctttgcc gtttgcatat gacagagaaa
    51361 ctgagcaagc attgaagcta ataatggaca aatataaata gacttttatt tatataaaat
    51421 tggaaaggcc gttacgaagg agagctctag gacaataacc gaatttgtcg cctgcttggt
    51481 gatagtgcag tacgagacag cagcattctt gggtaattta aaattattgt tgcctttgga
    51541 ttggtgatag tgctgacttt ggattggcaa gggcattcgt cattcctgtc atgactttta
    51601 ctcaagaggt acattttaca gctggacaac atgttatttg tctggtacgc tgacttaagg
    51661 tatcttcctg agttaagcca tggcagatga aaaattgtct taccatatta gcatcctggc
    51721 aactgttaca aaatgctttc gttgttgcct tagttgcaca actgttcgta attgttcagt
    51781 ttgttaggcc acatgcatat gtatttcgtc atatggcgta ctgataccac tgtctgactg
    51841 gcttgcacgc ttttcatatt tgtgcaatga ctacttgtaa ctgccagtaa tactatttgt
    51901 gtgtgctttt ctgtggtaga ggtcgaccta aactaacttg ggacgagtcc gttaagagag
    51961 atcttaagga gtggaatatc tccaaggatt tagctatgga caggagcgct tggagattgg
    52021 caattaacgt gcctgaaccg tgacctcttt ttctcttgtg ccctttttat ccctttatgt
    52081 gtctccttgt ttctcgtctc ttttgagttt catctctagc ctaccccaac ttgcttggga
    52141 caaaaggcta tgttgttgtt gttgttgttg ttgttgttgt tgttgttttc tgtggtaccc
    52201 cttaagattg tttacttttg tcatgtgcat acaacagagc aagtattgaa gctaaaaatg
    52261 gaaagagaaa cggaacacac gtttatgcat atacatatct aaacaggtaa actggaaatg
    52321 ctgttaagga agttctaaaa aaatcactca tttgcttggc gatagtgcag ttgtgatcat
    52381 tgttgccagt tcgttaggct gcatgcatac gtttttcttc acatggtgta ccagtaccac
    52441 tgcctgactc atttacacgc ccttcatatt tgtgcgaaag ctattaatta tcccgtttgg
    52501 cacggctcca cttcaccagt gaagccattt ttggggcttc agctccatga acagctctat
    52561 cggtggagct ggagccgttt tggtaaatcg tttggcaaaa caactccaca tatggagttc
    52621 cttaaaatat gctttcacag aacgccatgt aggatgaggt gaagccggca gaagccacta
    52681 tttttggctc cttcccaccc caaagctctg tgagagcata tttttagggg cttcatcggt
    52741 ggagttgttt cattttaccc cgtttggcag aaaacggctc caaacggctc atgaagccgc
    52801 tggagaagcc ctaccaaacg gggttagtaa ttgccagtaa caccattcct atgtgctttt
    52861 ctgtagtaca ccttaggact gcttactttg tcctgtgcat acgactgtta ccatgatgtt
    52921 ccacatcttc tcctttccat ttgagcttgt catcatttga ttggaactga acttttttat
    52981 taggtggtga cactttggta tagagcacct gaaattcttc ttggtgcaag gcattattcc
    53041 acccctgttg atgtgtggtc agttggttgc atttttgctg aaatggtgaa ccagaagcca
    53101 ctttttcctg gtgattctga gattgatgag ctgtttaaga ttttcaggtc ttatttacaa
    53161 gagttgttca agctttcttt agtctgttgc atgttgcaga aaaaaacatc ttatctgggt
    53221 tttgcatcct cttctgttcc tgcagaattt tgggtactcc aactgaagaa acatggccag
    53281 gcgttgcttc attacctgat tacaagtcaa ctttcccaaa gtggccatct gtggtaaata
    53341 ataatcaagt cctttttatt attgcaaacg gtggggtagg gttttgagtt gtgtggatga
    53401 aaacttgtac tgtgttctgc tcggttaatc tgttacagat aagtttggga tctccttttt
    53461 gcttgtgtat gagggtaatt caacattaca gtgataacca tttttggctc taacacgagg
    53521 ttcatgctgt aggatcttgc aacagtggtc ccaacacttg aaccggcagg aatcgatctt
    53581 ctatctgtaa gtcagactca tgaattcttt gcattttcta cttatgttct ccattttttc
    53641 cttactctgc aagatcacct tctacttttt ccccatgcca ttagtttttc taagtgaata
    53701 ggtgacatgg ccttctttgt gggtttatat gaaggctgaa aatctgtttg catttgagta
    53761 gcccaaggtt tcatccactg ggagaagagg gaaatggaaa cctagcaata agtttctacc
    53821 tttttttttt tggtcatgtc tctatgcact tacaatattg aggctgcaac ctgcaaatgt
    53881 tttaacatga ggttcagcct aatccttgca caaattccct cttttcccta gcacatattt
    53941 gctatctttg gaaacacctg cgcttgtggg gctgcaagtg cacctggatt gtagcattta
    54001 ggcatctctt ccaatattgg ttcagactca tattctcttc aaacatgtgc atcgaaatgc
    54061 acaggggtca ttttttttac caggtattgc agtttgccta gtctaaggac agttgtagca
    54121 caatttacac tgggtagggg tcatttttgt aactggaatt ttgcagctgc attgcttttt
    54181 ggacaactgc cagtagtaca tgattccctt tcatgtacgt cctgtgttac acttacactt
    54241 actccacatg atgatttgct acatgtcaac cccacagaac ataatcagaa tagacgattg
    54301 cattattcgc tcacgctagc ctttcatttc actgccccga attctgtacg attgtatcag
    54361 tgtgcacgtt gacatctctg acttgacttc tccccaccgt tgctcttgca gaagatgctg
    54421 cggctagatc ccagcaagag aatcaacgcc cgcgccgcgc tcgagcacga gtacttcagg
    54481 gacctcgagc acgcctacta gatgatggac gaaccattca ttcccgtccc ttgccctgcc
    54541 cctcttctgt aaattaaggt cgcaatgcct gggcccggcg agtacccatt ttgtccgctg
    54601 cgttaatcta tagtaaagac taagatggtg cgctgtgcta tcccgacaat gcacctttct
    54661 ttgatttttg gctgtgtaga gaaatgagaa cggtgatccc gagattgatc cttgttccac
    54721 gggatcccta gctatgccgt ggtttcgccc agttttgtct ctctctctct atgtcgatgt
    54781 cgacaccggc atcctctttc tcgaacctgg atggccggat gccggattcc ggtggaaaga
    54841 gagcttctct ggttcaagtt ggtacacggg tatgcttggc tgtgtctgct gtcaccgtct
    54901 gttagctgat gtatgtaatg gtgcgtttct gatgctcggt agcggtgagc aacgtggtca
    54961 gtcaatggga tctgatctga cgctgtgcct gttgacctgt cgccttgaga tcactggtca
    55021 gcgatcgatc tggtgccgtc atttttgtaa ccgaattagc acgatctcgc cttcctgaca
    55081 tgaatttggc gccaggcctc gtttagatgg caaactttgg tggcaaagtt tgcatagtaa
    55141 gtgtcccgtc acactgtagc aattttgttt ttatttggta ataattgtcc aaatattgat
    55201 taattagact taaaatgttc gtctcgcaaa gtataataaa actgtgtaat tagtttttga
    55261 ttttatctat atttagtact ccatatatgt gtcggcattt tgatgtaaca gggaatagga
    55321 attctgcata gtgaatttgg aaggcaaact ttggaatcta aacaaggccc agttgagaaa
    55381 tgccattgtt gggtacaccg tacacccgtg ctctgctcac gcgcagacct cacatgcgat
    55441 gaggtgtggt gtggacttgg ggtggtcgca cagtgagagt tcagctcatg tgcggacttg
    55501 gggtggtcgc agagtgagtt cagcagagtg agtacatgtt cctaattatg tatcataaat
    55561 attaatattt ttaatatata tttagtcaaa gttgtttttc aaaaagtgaa aacgacatat
    55621 ttagggagga agggagtacc ggcgtgcaga gggccggccg gataggctga gtggtcactg
    55681 cgactgcgaa ttggaccgac cggaccatgg cacaggtgaa catctttact agtagtagta
    55741 catgttcctc aaaaaaaaaa aaactagtag tactgcatca cattcacatc acgttggttg
    55801 ttggttgggc ttggtcaatt tcgcatgaat tgcatgttag cagtagaaca aatcgcatgg
    55861 cctggcctgg ttgtgttggg tgttggtagc ggggcggaga cgatacaaga caaccaaggc
    55921 cttgtttaga tgcaaccaaa acctgcatag taagtgtcct gtcacactgt agtaattttg
    55981 tttttattta gtaataattg tccaaatatt gattaattag gcttaaaata ttcgtctcgc
    56041 aaagtacaac aaaactgtgc aattagtttt tgatttcatc tacatttaat actccatata
    56101 tatgccgata ttttgatgtg atggggaatc ttctttttgc atagtggaat ttggggatga
    56161 atttgggaca gcgacgcagc atggcttctt ttgcttttgc aattcgttag tacatgtacg
    56221 gtaatggatg gggtgctaaa ctgctaactg ctaataaagc atcagctaat tacattccct
    56281 agtccatacc aaacttgacc agagttaccc atttctttta caccagcgca attgtacaga
    56341 aatttcacat gacttaattt atttttacgg gagaaacaca gtcaacacga aaaaacgaaa
    56401 tcaactcccg taataaaaag caaaaagaag aaaaaggagc ttaaaatcaa atcgaatccg
    56461 ctgcacaggc ggccccacca gtcagaagcg aacgagttaa gggtgtgttt agttggtcct
    56521 gtaaaatttt tggaagtaca ataacttttt cgtttatatt tgacaattag tattcaatca
    56581 tggattaatt aggttttaaa gattcgtctc gtgatttaca accaaactat ataattagtt
    56641 atttttttac ctatatttaa tgctttgtgt atacgtctaa agattcgatg tgacgagaat
    56701 cttgtaaaat ttttgaaagt ttgaagcatc tgagcacacc cttaccaggc tgacgccgtc
    56761 acaggtcaca cgtctctaat agagagagag ccaatcctcc cttcccatcc cgaccgccgc
    56821 cccacctcct ctcctcctcg gccgcctcgc agtcgccgcg attccacccg cccccgactc
    56881 cgatcgcagg ggcatccaac tcacctcctc cgccagctcc cgctcttcct tcctctcccg
    56941 gagcttctgc gttgggggag aggcggtggc gcccaaaccg gcgtcgtcgt cgtcgacgcc
    57001 gctgccagcc gccatggagg cgtacaagct ctgggtgcgc aggaacaggg acctcgtctg
    57061 ctccctcgag tccctcgcca acgtaatccc cccgatcccg cttcccgctc tgcttccact
    57121 ccgttataac cattttctgc tctccattgg tcctgtaagc tttagtccgc gcgtatctcc
    57181 tcgattcggg ggatgatgtg ctcgcttcgg gttcgttgaa cttgaatcgc gcggtctcgt
    57241 ggttggtcgc tggctacttg gttggggcgt acgcgaattc atgtgattcc gctcgtcctt
    57301 gcgactctat atgccctgtt cctcaccacg gatgagtact gattccgcgt ttcgttggca
    57361 aatttctctt gcctcagctc tacgttgctg gtgcttgcct tggggttgcc gattttgtac
    57421 cgcagctgct ttagctaatc gatacgaggc ataggagttg ccactttgct tatgcttgct
    57481 tcaactcttt tcaggggctg acatggatac tccccgagcg cttcgccaac tccgagatcg
    57541 cgccagaagc aggtgctctc aatggtcctt ccttcagttt ggagtaacat ttagttccac
    57601 tctgtggctt ttgctatctg tggtcatgta tatgtttact gtctcataga tttggatttt
    57661 gagctgtatc agtgccttat ctttgttaat tcaagccttt aagtgtcatc aaactgtgtg
    57721 aactggtaat gatatggaaa ataggagctg caattgccat gctgcaaata tattgtgagc
    57781 tgctagaagt agaacatact gaaatagtta tgatttaaga ggcataggtc gtatatcttg
    57841 tgataggctg cattacctag tgactattaa gatatatgga tgcccagatt tcaaattatg
    57901 ggcgggtaaa gttgacgagt gcatgtcgca tgtggtttca cgtgtcaaag cccccccttt
    57961 tcttccataa tgattaataa gtgacgttat atagacaaca catggcgaca aaaaaattga
    58021 caactgtctt tcatattggg tcatgtttcc tatttgggtg ttaccgttac tgtaactgct
    58081 ttcctaggtt tctgtgatct catgtctgca ttcacggagt gatacatgag tttttgtgct
    58141 caacaccaaa atgtgatcaa tatagttgtg cccaaataat ctgtttgcca cactaccacc
    58201 caagtgcaaa ctgcaaacca tcttttcctg attgatattg ctataaaatc accaaggttc
    58261 cagaagtcca gtgtgctacc atggtcgcta tgtgagttat ctcataaagg aaataaatgt
    58321 tatttgctac tatcaggcca tttattttta tggaactcat ttagtcatat acagctgcct
    58381 agggtggcct tagcactaga ctgattaagc ttatctcaga atttgtgttc acatttttat
    58441 cctggcatct tccattgtta cctaaaaaga atcactggtg ttgtatgttc attttgtgct
    58501 attcgatgta agagaccatt ggaatatgtt tcactgacca gtctgaataa gccttagtgt
    58561 ttaatatttc tgtattgagc atgcatgttt tgcttctaag gtattatgta tcagggaatc
    58621 aaattctttg ctattactaa aaatatataa ctgcatactg tttgcacaac tattttgata
    58681 ctaatctcat aatctgacat aagatattgc agagcttagc tcttcaattt actataatct
    58741 tgtctaggtg actcaatccc ctatgcaata aatcaatatt ttgttcagtt tgtaacatat
    58801 gcatactgat atgataatgt tttcaagaat caagacattg tttacagttt tgattgagag
    58861 aagtctgttt tgagtgctat atgcttgatt tcttcacatt aactcacact tcattgtctg
    58921 aacagtatat gcactactgg gtgttgtgag ttctgtcaat cagcacataa ttgatgcgcc
    58981 cactgagaat cactcatttg cctccaagga gcaatctatc ccatggggtc ttgttgtctc
    59041 tgtactaaag gatgtggagg cggttgttga ggttgctgcc cagcactttg ttggcgatga
    59101 tcgcaagtgg agctttcttg ctgttacgga agcagtgaag taagacactt accttttttt
    59161 cggttagttg catatctatt ggcgttgttc agagtcagac aaaatgataa caattatgca
    59221 atatttcaga gcaggtgtca ggttagctgc ttttcgggag agtggataca agatgctctt
    59281 acaaggaggg gaggtggcaa atgaagaaga ggtgactgtt cttgaaaata attatggagt
    59341 aaatggtaat ggagttccag ccatctatcc gatggatgga tatgctggaa atggtcacaa
    59401 agctatgacc aagggtctgg atggaaaaaa tggatctgta tctaagagtc ttgagaaaag
    59461 agcagttgct gctttgaaca aatttggcga gaatgcaaag atgatgtctg atcctatgtg
    59521 gatacggagg ctccaaccta ctcctgagcc aactggtaat agattttaaa ctacgaagaa
    59581 gtcccatttt cggcctctaa ctatcatgat agtctgattt tggtccccaa actcaaaata
    59641 ccacacaact tggtccttca gctgttttga agctggtttt tgctgccatg gcgatggttt
    59701 tgccatgtag gatgtgttta tattatgcac gactgtccag cactagattg agggaaaaaa
    59761 agagaaccga atttaatgat gaaaccatcc tacgtggtat tctgacctac tgctgacgtg
    59821 gtgaaactat caccacatta gcaaaaaaaa ccagcttcaa aacagctgaa gggccaaaaa
    59881 caaacggttt gaatagtcga agggccaaaa ctgtctgata tttgagtttg gggccaaaat
    59941 tggaccctcg tgatggttca agggccaata attgacttcc atctatttaa ttatcttgat
    60001 atttcttcat gtacttctgg gtctatggtt tttcttctct tatagcgcgt taaaccttct
    60061 gtgttgtgca gtgatggtgg ccgagaagcc aactttggca agtatttggt ctgctaaagg
    60121 gggtactggg cgcttatttg ttttagggga ggttgttcac atattcaggc cacttgtgta
    60181 tgtacttctg atcagaaagt ttggaatcaa atcatggacc ccatggttag tgtcgctagc
    60241 tgtggaactc acaagtctag gcatccattc ccatgtgacc gatctgagtc acagattaag
    60301 gaaagtgcat cagctcagtt ctgctgagag ggatgaggca agttgatttc agttctctaa
    60361 ctagttaaat tttgtttcat tttatcctca ctgatgctga actagctatt ctctggtttg
    60421 attccatcag ttgaaaaggc gaaagatgat gtgggccctc tacttgatga gagatccttt
    60481 ctttgccagt tacaccaagt aatgaacacc ctgccctaag atgatcattg ctcaattgaa
    60541 attgaacctt atatgctcat gcctgcattg tgtcctgaca ggcgtcatct ccagaaggct
    60601 gaacaggtgc tgaatccggt gccattaatt ggctttctta caggtatgta tgccttgttc
    60661 acacctttga tgtatttgtg ttccgtgaaa gcacattgca ataagctctt tgttgcttga
    60721 ttcattgcag ggaaacttat agaactactg gagggtgttc agacaagata tacatacaca
    60781 tcaggttcat agggatggcc agtccgagtt tgctgcttgc ctctcgattt gccctggagg
    60841 acctgtgctt tgtgcgagtt ggttgatggg ttctgtttta atggctgaga acttgtgccc
    60901 aaacctgaaa catgtactgc cgtttctttg ccaaatgtgg catccttgtc ttgtggatgc
    60961 gaagctgcag cgcagccact tcgtgtatga cggcagatga gagaattcag aatctaagta
    61021 tatagtaaat actggtttaa cgctaagaat tggcgtattt gccatttatc atgaatgact
    61081 tactgccttg ttggaaaata gtatgtctac aataaatttg ttcttcaaca gcgaaatttg
    61141 gatgccagta agcttagagg taagtgatgg taacactgat ttatgcctga atcagatcag
    61201 gatcttgaaa gtttatctgt attgctcatt gttaaaatgg gattaggtag atcaagaccc
    61261 atccaaatgg gcattataaa taccggagaa cacaagtttt tttttaatta tcactgaaaa
    61321 acttcgtatt tcataccgga gacattgatg aagatgttag gcatagaatt tcagccggct
    61381 ggttgaaatg gcgtcaagct tctggcgtcc tctgtgacaa aagggtgcct tagaagctga
    61441 aaggtaagtt ctataggacg gcgattcgtc cggcgatgtt atacggtgct gagtgttggc
    61501 ctaaaaaagg cgacatgtcc agcaattgag tgtagtagag atgcgtatgt tgcgttggtg
    61561 ttgtgggtac acaaggaggg atagagtccg gaacgacgat attcgagata gggttggggt
    61621 ggcaccaatt gaggagaaat tgattcaaca tcggttgaga tggtttggac atatccaacg
    61681 gaggcctcct gaggcgccgg tgcgtagtgg agttctaaag cgggccgata atgtaaagag
    61741 cggtagaggt cgacctaaac taacttggga cgagtccgtt aagagagatc ttaaggagtg
    61801 gaatatctct aaggatttag ctatggatag gagcgcttgg agattggcga tcaacgtgcc
    61861 ggaaccgtga cctcttttgt ctccctttat gtcctttttc gtgtctctct gtttctcgtc
    61921 tcttttgggt ttcatctcta gcctacccca acttgcttga gacaaaaggc tatgttgttg
    61981 ttgttgttta ccccaaaggc aaccgcaatt tggcagtggg caaagcgaag gatcaacaat
    62041 ccttgcaatt tttatttttt attttttatt tttacgcgag gtcagctcca tttccattct
    62101 aatacaattg ttcagaagta atagacagag caagaaagga gaatgaacac acgattcagc
    62161 cacatctgga ccaggcttct gattcaagga ccgagcccta tgtaaggcga ccgtgtacag
    62221 gagaatgaac acacgattca gccacatcca actcaaacaa cagctcgaaa atgatccact
    62281 actttattac acatatgtag tttccatcag aaagcgcaca aaactttcac tacaccacaa
    62341 acccctctct tgcatcggat agcctgcaac acaccttgct accgttgttg tgggctcgtt
    62401 cgtagacacg attgtgatcc ggcccactcc gcatctccac ctgcacactc acgttaaaac
    62461 cgcaaccctt ccttgtgcat ccgtattctt cctcttcctc ttggatctaa aagcaccacc
    62521 gccggcagtg acggttctct gatgtgccat ggcagaaggc gtctcctaga ttcgcagaga
    62581 cgatagttcc gagaactgca gcgcccgcgg caccggaatt atcaatatgt gtaatggcgg
    62641 cggcggctgc ctctggatgt gcagttccgg tgcatgtgca tcacacgagt ggttagttat
    62701 ctactcccat ctttaatccc tgttacttag ttcacctgga tggatgtcac gcaccttttt
    62761 ctgtcttgat ttaatggatt catctccgat ctgtgtgttt gatatatcct ttttctttct
    62821 ttcaatttct atttcctgta tatgtattcc ccttatgttt ctagatacga acacaaccct
    62881 agatgttgtt ttttgatgtt gctgctatta ggtctgttgc cgtattatta aatcctaaaa
    62941 gaaaaaaatg tccgccttca tcctatacac taataatcca tcttattgcc ccttgttggt
    63001 ccaccaccat cattgatttt attcgattgg atcagataca aatgtgtagg aactgtgacg
    63061 gcggctctca aacggtttac atcgggtggt gatgcgcagc ggcagtgcgg ccgctcccag
    63121 gtgttcagcg tcggcgcagc tgttctgcag tgatggcatt ggtattggtg cagcacaggc
    63181 ggttagccat ctcccccttc tacaatcctt gttccttggc atatctagcc tgatttttat
    63241 gttcattatt tttctttgta cacagtttct tcttcagggt tcattcttct ttgatatgtc
    63301 tgtgtggcat ccattcttct ctgatccaca ggtttgtgtt tcatgtatat gtatggattt
    63361 atattgtgtt tttcagatga tcctaatcca tatatttcat aagccatcat gtgagatgca
    63421 gttagaactg acctagatat tgctaggtgt tgttgctggc ttagatccat taattttgtt
    63481 aatgtacaat agaatagcaa atgagaaaaa aaatggattc gctattgaat caagattttg
    63541 ttaatgtatg atagaatagc aaatgagcaa aaatggattc gctatgaaat caagatgtca
    63601 tctcatctct ggatgcttta tttttctaaa tgacacaaac atgcactgca tatgcaggct
    63661 acagaaatgg aaatttttct aagttaatgc tcttgaaact gaacctggaa gactactagt
    63721 gcaagttgaa tttctctatg aggtaattta aaatagtatc tattatactg tcaaatagta
    63781 gcttgttctt cagttatgaa attaacaagt atttggtaat aattcagtta tgcttactga
    63841 cggatgatgt tatctttttg aacttgtgca gacaatgata aatcttctga agtttttact
    63901 gtgattctgt gatatataac tacgaggtat gaggaggtga ctgaagaaaa gatctagtaa
    63961 ggtaaaggtg tccttcttca agtatatata tggtttgttg tctatatttt ggcattgttt
    64021 gattacatta gtatatactt gcagactgat ctctagttta aaattgtttc taagcttttg
    64081 ctttaaattc cacatacaaa agttaactgg gtatcaaaaa aaattctgac ttttatgatg
    64141 accagtccca tgtacaggag atgtatatca ggcgtatgac ccaagatatg tggaacccta
    64201 ttcttctgct tatgctatac aaaactaagg aagacagttg tctttatctg cattgctagt
    64261 tctaatttga gagaacttcc cgtagaaaaa ttagggcacg cacatccacc agttacaatt
    64321 tatatttgca tggctttatt ggttctaatt tagctcagct tcttttatgt caaggttgct
    64381 gtgtcactgt agacaaaagg tattaatgaa acattaattc tagaagagct gccagcaaca
    64441 ggtatatata cgttgtctca tttttcttcc ttcaccatga tttgtaaatt gatgggaaaa
    64501 tcgcatatac tttcctaaat atatgttctt aacgaagcac tgtgttcacg caggacaaag
    64561 atatgatatt ttggatgttc ctatgattga aggatgaaga acaagatttt ccctcaagaa
    64621 tagttgttta ggagtggtgt tacacttgtg tatatttatt ttcagtatga aactttgtag
    64681 ttagtgaatc attgtataca attacagagt ggaccatttt cctgtatata taaaatcatt
    64741 tacttaactt caactattta attatcttga gtattaaaaa tatcttttaa atgcctgtgg
    64801 ctgctggatg tagcatatct aattaattta tcaagctatt tatactataa aaataacata
    64861 tatatgattt taataataaa tcccaaaagc atgtggcata ttttaccagc aacatatata
    64921 tgtgtagtta catattcgtt gctagcatgc aacgcttaca tacccctctt accaacatat
    64981 atatatatgc attgcaattg atccttgcaa cgccacttta agcaacgcat gtcagatgcg
    65041 ttggtataga tcctaccaac acttattcgg gcttatagca acgcatatat gtgttgctaa
    65101 agggggtgtc ctcttgtagt gtttagacgc ccttcaagct tcagtggtgt ggcccctgtt
    65161 agacctctag gatctcatag agtagatcag tggggtagat cttttgtatt tcaggtataa
    65221 acaataagaa catagtgtaa gatctaccgg atccgagaga gagaggagga gtaaggtggt
    65281 gcaaaccgtc tgtaggaatg ggtgcagtgg agttcgatcc ggaggcggcc atgtcggtgc
    65341 agcgtagatt gtcgcggtcc ggtggcggtg gagggacttc ccgtcacttg gctgcgcacc
    65401 ctctttggat cgggctaggg tttgtaggtg gggcgtcgag ctcaggcaaa cttcgtgtac
    65461 tgaaacgccg gcgcctacct ctgtatttgt agcgcagggt gacgggggcc ctccagctaa
    65521 gaataggctg ggcgcccccg atcagggcgc gagtcaagga agaaagccgt tgggctttct
    65581 atatttagga gatcacttct aacattctcc cccttgatct catcacttac tttaatcttc
    65641 gaacttttat tttgacgctt ttactttact cgttccatca cagataagtg tatagagcat
    65701 gtttcatcgt cacggtcaac tgccgatgga tttgacagct acaatacaca tatctaatct
    65761 gaaacagtta ctttaacttt gggcccttta ttatagtcca ggagtcatag gctttccctt
    65821 aaacccatgc cggctatatg ttctctgaac acgttgggtg gtaagccttt tgtaagcgga
    65881 tccgcgagca tctttttagt gcttatatgc tcaagactta taatttgatc ccggacttta
    65941 tctttcacaa cataatactt tatgtcaatg tgtttggcag caccacttga cctattgttg
    66001 tgagcatact gtactgctgg atcattatcg cagtataact ttagtggctt atgtatgctg
    66061 tcgaccacat tcaaaccggg tatgaacttc tttagccagt tcacctgccc cgttgcctca
    66121 taacacgcta caaactcggc atacattgtg gacgatgtag tgacggtttg tttcgagctt
    66181 ttccatgaaa ttgctcctcc tgcgagagtg aatacatatc ctgacgtgga ttttctatca
    66241 tctcccgcat aatcagaatc cgaatacccc actatctgga gagaatctga ttttctgtac
    66301 gtcaacatga ggcctttcat accttgtaaa tatcgcaaga ctttctttac caatttccag
    66361 tgttcaattc ctggattact ttgaaatcta ccaagcaacc cagtaacaaa agctaagtca
    66421 ggacgcgtgc acacttaagc atattatagg cttctgatag cagaagcata tggaaccact
    66481 ttcatttgat cgagctcgta ttagttccta gggcattgaa aatccccata tctgtcgccc
    66541 ttgaccatgg gtgcaggtga ggcactacat ttatgcatac tgattttctt taaaactttt
    66601 tctatgtatg ccttttgtga tagtcctaat acccctttac ttctatctcg gtgaatctct
    66661 atgcccaaaa caaatgaagc ttcaccaaga tctttcatat caaattttga agataaaaac
    66721 ttctttgtct ccagtagtag actgacatca ctaccagcga gtaagatatc atctacatac
    66781 aggattagaa agatatatct tccattctta aactttgtat aaacacaatt atcctcaata
    66841 ttttctttaa acctaaaatt ctttattgtt ctgtcaaact tcaagtacca ctgtctcgaa
    66901 gcttgcttta acccataaat tgatttcttt aagcggcatc ccattcgttc tttttcctct
    66961 acgacaaaac ctttcggttg tgccatataa acattttcct ccagatcccc attcaggaat
    67021 gccgttttta catcaatctg atgtaattct aaatcatagt gtgccactaa tgccattata
    67081 attctgaagg aattcttaca tgagactgga gaaaatgtct cattgtaatc aatcccttct
    67141 ctttgcgtga aaccttttgc cacaagtcgc gctttaaatc tttcaatatt cccttaggag
    67201 tcacgttttg tcttgtagac tcatttgcag cctactgttt tggctccttt aggaatagac
    67261 tctaagtccc aaactttgtt ggtactcatt gactttattt catctttcat ggcctcaagc
    67321 cacttggatg aattatcgct tctcatggct tcttcaaatg aagtgggatc actctccatt
    67381 tgaaattctt cagtgttata cacctcataa tcatcaggta tcgctgatct tctaactctt
    67441 tgggaccttc tcggggcctc catatttggc acatcttctg tttggggctg ttattgctcc
    67501 ccctcatctg tggcatcagt ttgtataggt tcctgaagaa caggttcctc atcattattt
    67561 actgtgacca ccggagaact gacaacaggt gttggcacta tagtatctgg cactgttggt
    67621 gcaataagaa caggtagttc aaagaatagt tcctgaatca tcggagtggg cacacatacc
    67681 cgcttctcct caagaacaat ttctcgagcc accatgctcc ccctcatcat ttcatcctct
    67741 aagataacag cgtgtctcgt ttctacaaat tttgtgtatc tgtctgaaca gtagaaacaa
    67801 aaaccttttg acttttcagg ataaccaata aattggcagc taactatttt gggatctaac
    67861 ttcctaatat ttgggttaaa tacttttgcc tcagcaggac tcccccacac atgcaagtgt
    67921 tttagtggag gttctcttcc tgtccacaac tcatatggta ttttgggcac cgctttactt
    67981 ggtactctat ttagaatatg aatggcgggt tttaacgcct ccatccatag actcaatggc
    68041 aagtcagagt aactcatcat actacgcacc atatccatta aggtacggtt gcgcctttca
    68101 gctactccgt tctgctgagg ttcgcccggt gtagaatact aggctactat gccattctcc
    68161 tgtagaaacc ttgcaaaggg tccaggaact tggccatatg gggtatgccg accgtagtac
    68221 tccccaccac gatcagatcg gaccacttta atctttaaat tatgctgatt ttcaacttca
    68281 gccttaaata ttttaaattt atccaacgct tcatttcttt ctttaattgg ataaatataa
    68341 ccataacggg agtagtcatc tgtgaatgtt atgaacgagt caaaaccatc cacacttttc
    68401 acaggaaaag gaccacagat gtctgtatga attatctgta gaattcctgt gctttgttta
    68461 gcatcctttt taatttgctt tgtgtatttt cctttaatat attctctaca ctgttcaaag
    68521 tctgagaact ctaatggagg aagaatatca ttcttaacta gtctctctat tctctccctc
    68581 gaaatatggc ctaaacgaca gtgccataat ttcgacgacg catcttgagt tctctttcgt
    68641 tttctatttg cgttcacaaa cgagaatacg ttatcattcg catcatatac ggaattcaca
    68701 ttttcacgaa gtgataacaa ataaagatct tgcttttgaa aagcaaggcc aacacattca
    68761 ttattacata atatttcaca tttgccatct ccaaaatggt aatcaaatcc atcgttgtcc
    68821 aaacatgaca cactaatcaa gtttcgtttt aatgacagaa caaataaaac atcttttaac
    68881 aaacgaatga atccatcagc aagctctaag gagacatcgc caacaacttc gacgtctgct
    68941 tggactccat ttatgacttt aacgtgcctt tcgcttcttt gcgtagttct cgtcaaacgg
    69001 aatccctgta aagaatttgc aacatgaaca attcctcctg agtcaatcca ccaagtagat
    69061 ttcgaatact gtacatacag ggattcattt ataaacgtaa tcatgttctc accttgcttt
    69121 gccatgatca tctttagaaa atcgggacaa tctttcttgt aatgtcccgt cttctagcat
    69181 tgaagacact gatctttgtt cactgtaaat ttgttctgct gaggctgatg ctgcatggga
    69241 gctttgccct ttggctttga gggagagttg gcattggcat tgaaattctt tcttttatta
    69301 tctttaacaa aattgagagt accaccattg gcggctttta tcctctcttc ctcttgtgca
    69361 cacatcgcca tacaacgttc taaatcccat ttttcaggct gaatgttgta gttgacaaca
    69421 aaagtgtcaa actcttttgg taacgaagca aaaatcagat ggacaagaaa ctcttcagta
    69481 agagccaggt ccattgattt gagcttgttg ttcaaatgat tcatctttga tatgtgctct
    69541 cgaatgccat tgccatgacc accttcagtg tatttttctg tcaccagctg ctttatcagc
    69601 tgagtagcat atgtctttga agagccatag aactgactct ttatcctttc caagtactct
    69661 gtgacagtgt cacactcttg gattgagccc attatggtag gctcaattgt gttctttatg
    69721 acagcaacac acttcttgtt ggcattgacc cacttttgct tttgtaggtc atatgctatc
    69781 tgtacggaag catggtccct ctcttttttc tgccattcag catcaaactc attagcctcc
    69841 ctcaccggtg ccacaagttc actggggcat ggtgtggtga ccatccagtc ttcctcagcc
    69901 aaaacaaagg cgaagtcaat tttctttttc tattcattgt agttgtcacc tttgaggggt
    69961 gggatatctt tgataaaccc tatcaaagag taacctcctg aaaatataag tcatataaag
    70021 tgagaactta attataacat gaataattgc atgctttagt tccaacgttg atcaaaatta
    70081 aaacatacaa aaatcatcct ttttacacta attctagatc accgttgggc agaaatagaa
    70141 ttaatgcata ataaaatcat aataacatca taatactgct attaatcaac gttggtcaga
    70201 ataataacaa tattatgatc atattttaaa tttatccatt tttcaaaatt aaattctccc
    70261 gttggttcga atttaataat gaaataacat ctttaagtac gcagcggaaa tacttttaat
    70321 attctcataa tgttttccag aagcacttta atcactctac tgttgtctga acaaataata
    70381 tcgttggata aaatttgccc agaaatttgt atcaaatttg aattgaaaaa gatcaaaata
    70441 tgcatcaata attgcttctg gaaaataata aaagaaaaaa tcgaaagaac ttctatttca
    70501 tgccattttg gcccagtcgc gcagcagttc gcggccttaa ccgcacgcca tcggcccacg
    70561 agcgtcggcc cagcactgcc ctttggcggg tttcgcgaag aaaggccggc ccacaggcag
    70621 ccgcccgcac gtacgccccg cgcaccaggc cctaacctgg gcctgggcca gctattcaca
    70681 cgcccgcctg ggccaatttc ggcctgagtt ggccaccggc caatctcagc cgttcgtcgc
    70741 aatcggacgg ccacgcgcgg agatcggtgg aaacaaaacc gcaccggcca gttaccctgg
    70801 aaaaccctaa ctccatttcg ttgtccagtg accgcagccg ctagggcacg cagggaggcg
    70861 cgccgctgag cctcggcggc cgcctgtgcc tcggcgtccg cgtagctccc ttgccttcga
    70921 ccgtctttgt tctttctctc tttcctcctc actgccgttt ctctctggcc acacaaaagc
    70981 agcaacagtg catggtcatg gcggccggtg gaggcaagaa gacggcgccg ccgcgggtcc
    71041 cctcgccggc gcgcgtgctc gcccgtggtt gagcacgccg ccgtcgagcg gcctcgcggt
    71101 ggtgccatcg gctcgcgcgc gcacggcggc ggtgctctgt gacgcgcgca tggcacggct
    71161 cgatcccgta cggtggcggg gaaaaattcg gcgaggcggt gggcgggtcc aggtatgaac
    71221 cccgtccata ccctcctctc ttcttttacc cgatgagggt tagggttcca tttgggaaat
    71281 actttccgat ttgaaatcgg ttcatttctc tcttttctat tccccaacag ctagatctac
    71341 atgctatgta ggcgtctgat accaatgtta gacctctagg atctcataga gtagatcagt
    71401 ggggtagatc ttttgtattt cgggtataaa caacaagaac atagtgtaag gtctactgga
    71461 tccgagagag agagaggagt aaggtggtgc aaaccgtctg taggaatggg tgcagtggag
    71521 ttcgatccgg aggcggccat gtcggtgcag cgtagatcgt cgcggtccgg tggcggtgaa
    71581 gggacttccc gtcacttggc tgcgcaccct ctttggatcg ggctagggtt tgtaggtggg
    71641 gcgtcgagct caggcaaact tcgtgtactg agccgccggc gcccacctct gtatttgtag
    71701 cacagggtga cgggggccct ccagctaaga ataggctggg cgcccccatc agggcgcgag
    71761 tcaaggaaga aagccgttgg gctttctata tttaggagat cacttctaac agccccggcc
    71821 ctggcaaccc cccacacaca ccaccttctt cgtcctcctt tggtgcttcc ttcagctgca
    71881 ccttctgtct ttccgggccg agcattatgt ccagaccttc aattaacatc tctctaccca
    71941 cctccaggta tatccctgtc cagtatcaat taaaagcaca tgcataacac aacacttcag
    72001 caggatgttt aatcatttta ttttcaaagc aagctttatt tcttgttttc catattgccc
    72061 agcaaactgc agcaatgcca aacacatgga atttgggagc atttggagaa ccatttctta
    72121 gtccaagccc aagtctgttt cacattgaca ggtctgtcag atgccccaag tctgaaagca
    72181 ataatggacc aaataacttt agctaccagg caagagaaga agagatgaga agaactttcc
    72241 tcctgatcac ggaaataaca cgagggatct cccttccatt tccttttgag catattgtct
    72301 gtggttgaaa tatcaatcct tgcaacacgc acctagttta ctcatgcact tgcaacacgc
    72361 ttccgattta cagtattatg tactgctagt tttacacgca tggcaagatg gtatcacaag
    72421 cgtgccatgg ttctgttcag ggccagctca tcgtttgcta cggatgcatc agccctcttg
    72481 gccttgctgt gagattcact tctcgcctgc gagcttaagt aggagagaga ctgcagccat
    72541 gagacgagta ccggcttccg agtgacatcg tcagactccg cgacatgggc gtgcatgtca
    72601 tcgagcagcg catcctggcc ttcctttggt agcagggtta caaattctgc cagctccttc
    72661 agcaggtaag gaaatgactg caaagagaag aaaatcattg aacaccttgg ctttcagagt
    72721 catcggaaaa caggtcaagt taggctccat catcaccaac attcagccag cacatgagaa
    72781 atatttgaca cttctcttag ctactttagt atgaattatt gttagagaaa agtcactttt
    72841 atgtttctaa cattctgcaa ccccaatgca acaattgagc tagctatcag ttttacagaa
    72901 ctgttgctct aaaactagaa ctacatgaga ggaaaagaac atgaccatat tccaacctga
    72961 atatccacaa ggaagattag tctcagcagc agatccaaca ttttcttaca cggatctgtg
    73021 ctctcttccc atgatctcca caaggatttg ttctgaacct ttgcaacctc gcagagatct
    73081 ttagccttga caacaaggct atggatacaa aaaagaatgg cagcgctgcc tgcaggaaga
    73141 tgtcgtacaa gtgctgcaac tcctgatgct aatccatcaa atggggttac cccaggataa
    73201 gcctattaat gaacaaagtc agaaatgagt catcttccag ttcaaaatca aataaggaaa
    73261 aagatgccga atgaactacc tccaaagatc tcttgatgta gtaaaaggta agttgctctt
    73321 tcaaagctgc tcgatcatcc tgatcagtat cactgccaga tgacgagaac gataccatca
    73381 cagagtgtga agcacttgta actttctcat ttgaatgctg tagatatctt tttcatgcta
    73441 agggtcacat catttttagt actgaaagtc ttgataaata aattaaaagt agtaaataag
    73501 aagacaaaac aatagaatgg aatgcaaaaa aggatacaag aacataattg aagccacttt
    73561 atcctgaatc atatgaactg gaatgaggcc aacacaagtt ggcacaaccc gcaagtaaaa
    73621 cagtatgcgt gatgtctgaa cctcatctct atgccagata tatgttgttc cagccaaggc
    73681 tggtaaatct gcaacacacc aaacatgaat cttaatcaac aattgctagc acatcctagt
    73741 agcaatcaca acatagcagc aagagaagtg tcattgaact aacctggttt acttgtcaat
    73801 tcagtatatg aaggcattga ctcaatgaac aaagcagtag ctgctgcatt ctcttgaatg
    73861 gcaagcacag cactccggac tgcctcagtg tactcaggaa gacgcaatcg cctaagatgt
    73921 tccacacaag agaacgccac caagattcta gcagcaacct cgggttggaa cccctcggag
    73981 gacttagcat ttagcctgtg tttagtgacc tccgctgcaa agactacaac cacaagaaat
    74041 gaggcctcag caatcttgtc aatcgctgta atcaagtcat cctgcttccc ccggtgcagc
    74101 agcactgctg cacgaagatg gcaataaatt tcctgtgcat actcccacac acaagtttcg
    74161 acaaagcttt tagccttgtc atttgcatat gaatactggt tgcaaagaac cccagtcacc
    74221 gggcctgcct ctttgaaaag aatgctatca aggtgttgat tgacctgagc cttgacaaac
    74281 tcgttccctt ctgccttttc aactgacatc ctgagcaaat caggaagcgg aaggagctcc
    74341 ttcagcaatc ccatacagac acaccgtaac acagactcgt gaaatgtgat ctgcccacac
    74401 cgtgtcagtc ccaatgcgac acactgagca aggatacgct gatcatcagc aggcctccct
    74461 tctaaaacag cccgctcagc tacaaactga attgtccgct caggagcctc cttcagccgt
    74521 ggatcaaagt ccagccggta tctcgccgaa gcaaccctca atgcccgcaa tccgccacag
    74581 gctgccatca ccactggaaa cagcacataa tcctcgccct cacacgtctc cggtgaaatc
    74641 agctcaaaga gcacctgaac cttccgcatc ttcctcgcct cgacgaaccc catcaccagc
    74701 cactccatca gcttaagcac ccgaacacca gtagccagat tcccagtcct cccacaaatc
    74761 ctaagcaagg acacaagaat cctcctgaac tggacctcat cagcagacac cagcgcgtaa
    74821 ccaacccccg taagcgcgag gtggtcgaga tcatccgcac tctgatcgcc ccgctccaca
    74881 tcttcaagga tgcggctcac agccacaaca gtgtcatcat catggccatc ggcaggctca
    74941 ccactgccgg cgggattctt cgcggtggaa gtgggtttcc cgtatccggc atggccaggg
    75001 agatccttgg cggaggcgcg ggcgccgagg aggaggaggc gaggtgcgaa ggggagggag
    75061 gccgggacgg aggcggggac gaggtgcggg gccgcggcga gcagcggggc cacgaggcgg
    75121 gggtgtagcg gcaggagcgg gagcaggagc gaggcgtgcg cggaggagag gcggagcgcg
    75181 cggcggtggt ggtggagcgt ctctagcgcg gcgagggcgt cggtggggga ggtggaagcg
    75241 tcgcggaggc gcgaccacgc ggtgaggatg gtggtggggg agggcggcgg cggaggggga
    75301 gggggtggcg cgaaagtcgc ggactcgagg tggtcggcga ggtgcaccgc cgccgccgcc
    75361 gcggccggtc ccggtcgcgg cggggctgtc gtcatgctgg ggtggggact tgagagttga
    75421 gacttgtgtg atgaagactc cgacgagatc gtattcgtgt ccactttgga aggacaagtt
    75481 tgaattttga aattttggtg aatttgcaac tgcgttcaga aatgtcttcc tgttccgaat
    75541 tataattcgt tttagttttg ttctaaatta aacttgtcta attttaacta aaaataccct
    75601 cgcttcgctc atgatagtcg gtcgagttcc ctttttccat tttagttgag tttcgcctct
    75661 cctcctttcc ttgtctccat tctgattgat tcgcttcttc gtgcaagcac ttggttcgcc
    75721 ccttactata accatcccgc tcaatctttt acaccgacgt ttcgtactct cacgaccggg
    75781 tcatcataag aaaatactgc caaatctttc cgaaatgaga agtttactac ttttttttcc
    75841 agtaatgcag acaacccttt ttaaagcgct aggccgggct tgcccctgac tctcaaaaag
    75901 agcaggaggc ctcaactcat tccattaatg ttcgttcccc acgcgtctaa atccaactca
    75961 gtctttatcc tgccttggac tctatagaag agcatagatt taataagcat gaagctaaat
    76021 aaatctataa ctaaattata catgatccaa tgagtataca atttttaata tagttcaagg
    76081 atacaataat tagctcatca taaaaaattc accactattg gaccatagaa gctgcagtta
    76141 tgaattattc caattaatta cagaaaaaca tagatctaaa gctacaacaa aatctttgta
    76201 ctaaataata ctatattata tattgactgt gtagacctac tcatgcggag tccaacaaaa
    76261 ttggattttt catttaatga tttttctgtg ttttactatg atttttcaaa gatttagcga
    76321 aaataaataa aaaaagacaa aactaccgtc actgtagtaa aaccactgcc taaaaccgcc
    76381 tggggattat ttgaccgatt ttggaaagta catggggtaa aaaatcgggt tttataattt
    76441 ggggtgaagt agtccaccat gaatagttaa ggaggttata tagatttttt ttccaaaaag
    76501 atattgacat ctatgatttc tgtaagctag gacaaaacta gagaggtttg atgttgctaa
    76561 aacaaattat aatttagata gaagaaggtt atatggcaca aagtatcgtt gatggttaaa
    76621 acttgctacc ggtgacttta attttgtcaa cattctaccc atataaagag catcttcaag
    76681 agtcgtttgt aaattcactc tctaaattat catttgaaga gtgatttgaa taaaaaatgt
    76741 tatttatatt tttcacctcc aacaatttta atatatccta tgcgtactct aaaaagtcaa
    76801 tctcgctctc tagctttatc tagcaagaaa tacaaaatgg tggatagcaa tatttggaga
    76861 tttgaataaa catattggag gatatttttc accaaaatct ctattcctat aaaaaaggct
    76921 atataaaggt tcttggagtt gctctaagaa tttcaaaaac actgttataa tatatcatag
    76981 ttcaacaggt gccaacaagt agtagcgtac tgtttcgttt tcaaattgtc attttggaat
    77041 taagtttgtg cgggacattg gtactaccat cgtttcaaaa taactaatgt tcagagttta
    77101 tcctaagtca aatcattcat ttatggtact ataatataaa aatatattta ataataaaac
    77161 taataatact tatttgatac tattataaac aatttgtata ttttttattt aaatttaatg
    77221 aaattttaaa tagtttgagt tttaggacaa atctaaaaca tcaattattt tgcgtgtatt
    77281 ttatgagatg aattttttga gtcttattag tccgttaata gacaatgtcg tattacagta
    77341 aacatgtgct aatgacggat taattagtct taataaattc gtctcacagt ttatagacga
    77401 gttctataat tgatttttta ttagcatccg aacacctctt tcaatatctt ataaaacatc
    77461 cgatgtgacc ttctaatact ttactttacg tctcttaaac taaacaagcc cgcaagtatt
    77521 taaccagcta ctaaaatatt cagcaaccca cacgtgttcc tagggttcat tcatccaccc
    77581 ggccagcccc atctcacgcc gccaccccgc ctggcgcctg cgcacctcca ctcctatcga
    77641 acacctcact ctatcccaac ctcgtgcatc accgtgacac cgtcccaccc cagccaaaaa
    77701 atcccaaatc ccttccctcc gccgtcgatc gggcctccat ggccgccaag cgccgcgccc
    77761 ggcggccaag atccgacgat tccaaggagt tgggccgcaa cggtggctat gagggttccg
    77821 acgaggaggt ggaggagagc ggcaagtccg gcgagaccgc catatccgcc gagcccaagg
    77881 agatgcagct gaagcaagct gagcaaccct cgccgctgtc cacgaaggat gctggggccc
    77941 agggctccgg cgaggcctct ccagcgagga gcgcgccgcg cggtggggtc gcgttgaaga
    78001 ccaagacgac ctcgaagctt gccaagaacc cccctccggc gtcgcaggag gaggatgagg
    78061 cgggggactc tggtgatgcg tcaccggcga gggacccgct gcccgacgac accgccgacg
    78121 ccggccacaa caagagggcc gtgactccga agcggggccc accaccgcag cagggagaag
    78181 agcgcccgga gactgtcgct gcttcggccc tacagcagct tagaaaggcg ttgaccaagc
    78241 cgacgtcgcc gccctcctcg tctgacatcg cccaagaaga cgagcaccat ggcagggaga
    78301 tggcagagca agagcagagg aacacctcac cgtcacagga cgagcacaga gcccgtgaag
    78361 agttgcagca ggagaagaag atcacagagc aagatcatgc cggtgacact tcacccccac
    78421 atgacaagga caaggacaag gacatgcaca agccacgcag tgccggtgac acttcacccc
    78481 cacatgacaa ggacaaggac aaggacatgc acaagccacg cagttctgag acggagaaga
    78541 agccagcagt tgagcgatca tggtcctatg atgacgagtt caagattctc aatgctttgg
    78601 tcgtgcacgc ccagtcccac aacggtgctt tgcctgactc atcgcacctt ttggccaatc
    78661 tcacctttga caaaattgat gccaccgagg acaagctcac tgacaagatc cgcaagctta
    78721 ggagaaggta ctgcaggttc cttttacaag gctgcccatc cgatgacctt agtcgtcggc
    78781 tgtttaagct atctgaaatc ctctggggcc aagctgatga agatgagcgg gttgagccaa
    78841 catgtaggga cttcagtgta ctatcaaaat tgtatcctca cctgaccaaa gaagtcaaag
    78901 cgtatgccga aacgcacagc tcaggggact taatcatggc aatgttcatg accattggtg
    78961 atgagaaggc ccgcgatctt gatgctaagt gcaagaagca acatattgaa gcattcaagt
    79021 tggagttggg ccaggcaagc ctaaccaacg aattgctctc tgccctttca agtctgacca
    79081 ccaagatcac agatccctct caggccacat catgcaagag gggggccgag aagctggaag
    79141 agccccttga tgagcagtat ctaaggcgca gcaagagagt tgcagggaag actgaaggct
    79201 tcaaggacaa gccaaatgca gatgacgtct tcaacccaaa gccactggca atggtcccaa
    79261 ctccgaactc cccagccccc cacctcacca aggacattgg ggacggtatt gccactggct
    79321 tcctgcagat tcatcctagg gacgtctggc gcactgatca agctggacac cgatgaagga
    79381 aaggcctaaa agttggcggc accttgaact aatcctaggg atagtttaat ttcagtttga
    79441 acacttttgg ttcatgtcac ctgtctctct agctttgcct gcgagcaagc atgttctatc
    79501 aaaagagccc ggttttgaaa atcgacgatt acgacgcgcc tagtcgcgac tagtcgctag
    79561 gctttggcct ggcgcctgga ctaggggggt agtcgggcct caagtcgagc ggagaaggag
    79621 aagggggaga agggggagag aaaatcgtgt gcgtactcgc ctcgacctcc gctgggaagc
    79681 aggtcccgcc ggctgcgctg ctcgtgactc gccttgaagc agatcccgcc ggcgagcctc
    79741 ttgcccgcct ggcaagacct gccggcgacg cggctcgtgc tcctccctgc cggcgacgca
    79801 gctcgtgctc ctccccgccg gcgacgcctc ccctgctcct ctccgccggt gacgcgggtc
    79861 gtcctcctcc ccgcctggcg gaggttgctg gtgggggagg aggagcgggc gcgcggcgta
    79921 ggggagcggc ggcgcgggcg agcgggcgta gagatgcgtt cgggagggag agagaggagc
    79981 aggggagagg ataaggggag ttgggccgtg gtgggtgagt tgcggtgggt gagttgggcc
    80041 gttaatgggc cttttttctc tttctcccca ttccatgacc acttctcttc tatttttttt
    80101 cttttctttt aagtaaatat acatgtattc tgttcaaaaa atgtatatat acatgtatta
    80161 gtcatcgcct agcaaaacgc ctagcatcgc ctaggctcga ctagtctcga ctagtctcta
    80221 ggctaagggt cgtcgcctag atttcgccta gcgcctagca aaactatgca aaagagaaac
    80281 agcagcttgt tggcaaagag gcaggttcca gggttcagaa aaaatgggct gttcatatgg
    80341 aacagccgtg ggtatttgtt acgaattcat cacatatatc tatgctcagt tacccaacga
    80401 ataaaatttc taactactgg tcttgaattt acacaacaat ttcattcatt tggtgattag
    80461 gcatacacat aggagtatat tgtcttcctt actgattttt tttccagttt caagatactc
    80521 caatgaaatt aatattcttt ccattccgat cagtatgaaa ttgctgttcc ataagcggtg
    80581 tgcacatgca tgcacattag ttaagttatc ataaacaaaa tgtcagttgt cttgtttgac
    80641 ttccaatttt actctttttt tttaaatcac gtctgttcgt agttaaaatt atgcatctga
    80701 ttgcatgtgg tgtggtaccc ctcgtcttcc tcttgttttt tcagcaggcc agtggttttg
    80761 taatattttg ttaaatatct accacaacaa tgggtaatta gtttcttatg atcaatattg
    80821 ccaatattta tttcctctta atgaaaaacg tggaacatca ctgtcaccaa aaatgttgtt
    80881 agtaatttgt taaacctacc agtaaagata tgtacggaat gtaagaaaaa ctgtaaataa
    80941 tcgtcagcaa acggtgtgta gtttacgtgg tgatgaagca gagctgaaag agaaaggaac
    81001 atgtggggat gacaaacgcc gagcccgttc gcttcgctga aaagccacga ctgaaagtac
    81061 tgttcactaa tttgttgtga gagaaaaata ctgtttcggc taaaaaaaca agctaaaaaa
    81121 tacagattat aagacaagcg aacggacgga catcaaccac acactgtcac acacgtgatg
    81181 taagagatga ggatcgaagt cctcattatt gatgctgtct gggccctggg agcagcagat
    81241 ggagcaatga ttcaggaata atgtccacac cataccacac atatgggagg ttgaggctga
    81301 gactgagatg catgcagctg aaataagcta agcaaacaag tcgatgcccc agaatttggc
    81361 aggctggtta gtccggtagt tcctatcgac ggccttcatc ttctccatgt cctcgccgga
    81421 gatgtcgaaa tcgaagacct caaagttctc ctgcagcctc tccaacttgg aggtcttggg
    81481 gatcaccacc gtgttccgct gcagacccca gcggaggaca agctgcgccg gtgtcttgcc
    81541 gtacttctca gccaagctct gcaaattgta ttgtagccac aatgccaagt tagcagatca
    81601 cattggcacc agaattgatg atattacaag gtaaccaaat aaaatgtact cctatgttaa
    81661 acaaggatga tgatgtaatg gagatttgaa atgacaacca ccttgatgac agggtcgtcg
    81721 aggcatgaga ccgtcccgaa ccactcggtg ttggcagtgg agccacccaa gggggtatgc
    81781 gcggtgacgc agatcccatg cttctggcag aacttgacaa gagaatctcg ctggaagtag
    81841 gggtgcgtct cgatttggtt cactgctggc tttatcttgg cgtaggccaa gcagtctcta
    81901 gtgaggaaga tgtcatagtt gctgcaccag taaatcgata attattagta ttgttattat
    81961 tgtaacaaaa gtgacttcct ccagcatgaa aaagtagact gaaaatctcc aagcatgtaa
    82021 aaagtggcaa caagaaaatt ttagtgtaag ctttattata ttcgaattca ggatattttg
    82081 aaactaaact actctttcaa gaccagcaat attcctagta caaaagggct ggcaaagact
    82141 gctcaatgtc tgcaaacaag ggattagggc aaaacaacaa acatgatatt gggctgcata
    82201 gccgacagcc atttttacag gtccttgaag acagacaaac aagatccaac accctaacag
    82261 agtccccatt tccccaaaag aaagaactag ggatcaataa aagaacataa gcaaatatta
    82321 acggaaactg aaatttgtaa tgaaggcagc aacctaaact ttagtttaac atgattaata
    82381 cattcatgat tctgcttaag cacggaccaa ggaaatttac aagaaaagca tgcacttttc
    82441 actagaaaag ggacgaagat aaagtggagg gtgacaagag tatggaatga atttgcatgc
    82501 aaccatatgc aatgaaactg aagagagaat ctggaaggac caaaccattc tgaacatgct
    82561 gcagttaaaa ggaacatgta gatcaagcaa gtgtttgcac tggaaaattt aaggcagtta
    82621 aaaggaacat gtagatcaag caagtgtttg cactggaaaa tttaagggaa cacatatgaa
    82681 ctaaatgttc ctgtatgtgc aaaactcttg actacagcaa gatcatattt atctactact
    82741 tcctcacaac aaagaaaaat tatctactac tttgtcaatg taatgaatta taatacaaag
    82801 ggaagcttgc caagactaat aaatatctca aatgtcaaat ggtgccaaca aaacaaagaa
    82861 aaatgttggt tcggtttacc tgattccaat gctgcgcacc agtcccatgg aaacaagttc
    82921 ttccattgca tgccatgttg tttccaatga gatagtggta tcaatgtcta gcacaccatc
    82981 atcaccaagg gcgctagaag ttgtgccaac tcctgcagaa atacacatat ctgtgaggta
    83041 cccactgaat ctttctaaat attatgcaaa gggcaaggat attacctgta tgcctagtag
    83101 ctactgggaa gtgaataaga tagagatcta gataatccag ctgcagcttc ttcaagctat
    83161 ccttgcaggc ttcaagcaca tggccatgat ctgagttcca cagctgcaat gagaacagat
    83221 gccaaacttt agatcacatg aagatcatgg agaagaatgg ggcaaaaaaa aaatgcagtg
    83281 gaatggaaac tcagaaacat ctgctaagta aaagacagtg acatcctggt tgagtcaaaa
    83341 tcaggtgttc cagtttaaga caagacaact ttagtttcat ttgagtgata tcagggttct
    83401 gatgacacta cacgctggcc ataacaccat aacaattcca aatatgctaa aatgcagagt
    83461 aataattgga attaagtatg actgactcat tttcagtagc cgctgaatgc taaaaacggt
    83521 tgggaaacca accgctgcaa tcctttcaat caattcatcg ggcataatct taatggtcac
    83581 attcatttgg aaaagggcag ttttccagaa tacagaaggt agcattcttt gtttatcgtc
    83641 tcttttgggt ttcatctcta gcctacccca acttgcttgg gacaaaaggc tatgatgttg
    83701 ttgttgtaca gcaggtagca ttctgtaatt tagataacct tggttgtgat gaacagatcc
    83761 tccctcttga caagtccggt ctgaaacgcc tctgcgagtg cgtcacctac ttcagcttca
    83821 ttctggtagt cagctgcaga gcaagttacc aaacacagag acagtaaatc accaagtaga
    83881 aaaaggaaaa ctcctgtgcc gacactagta gttgagacca tattagcgta ctccacaatt
    83941 gacaaagaaa tctaatcgtg gacagcacag tgcagtgact aagcatgcct gtatcattcg
    84001 tactatgaat caagtgttta tcaagacaaa cagaaaagtg attgtctaat tgacacatag
    84061 acactcatgt ggcactgaaa gaaacattca ataatttgat tgtaacattc agacaagcac
    84121 acaaacctag tgtttgtcta gacaaaagga agattgatgg gcatgcaaac actcatgagg
    84181 catcgaaaga aacattcatc aattttgatc ggtacagtac aacagaccaa gagtggcaaa
    84241 gaaatcatgc tcatctaata agcaacacaa cacaccgtgt aatcgcgcct gagccatcga
    84301 taatgtcagt cagtctctca gacaacgatg tacaaatctg cgagtatttg tacctagttg
    84361 tctgacagaa ttaccaaatt catttatgta gtcagctaga gaccacggta gacacaccca
    84421 acccaatagt gaccgtctga tcggcacaca aacacactca tgtagcagtg aaagaagcac
    84481 tcagtaattt gatcgttaca gtacagcaca caaagatcgc gagagaaaca tcgccattga
    84541 tagttagcat tattggcaaa ggaatcccag tcatgtaacg tacgacatgg aaagcgtgct
    84601 gtcttaataa gcataataag agtgtactgc ttgactcgtc aaaacaaaaa aaggaaaacg
    84661 aagagcactc gacacacaag tacaaacagt cagtgttttg gatcggtaca gtacaacaga
    84721 cgatgatcgc gaaagaaatc ccactcatct catctcatct catcagcatc agcaacgata
    84781 gggcactgtt aagcacgcct gcatccagct cgagacaagg atttggcact tgccaggaca
    84841 agagcgccca agtgactgaa agacgcgaac tgctacggcg tcgagcgaaa cacgggggcc
    84901 ctcgacctcg acccaactat ccatccgatc cgtacgctga tgccagcacg gacagggccg
    84961 gcgattcgcg gtgggtgggc ggtcgggttc cggggggatt tcgcttaccg gcgcagtcca
    85021 ggtggcggta gccgacgcgg agcgcggcgt ggatgaggcc gcggacgtcc ggcttgtcca
    85081 tccgccacac gcccagcccc accgccggca tccggtgccc gctgctcagc gccaccgccg
    85141 cgtccttcgc cgccgccatg gcgccctcct ctcaggccct cacctccccc cgcgcgcgga
    85201 tgctgctgga ttggccggcc gcttcgcctc gctcgttggc agtggcaggc agtgggactc
    85261 ttaagtgttt tcttcttttg gtttttatta ttcgttgtta ataacttaat actcctactt
    85321 ggatattccc gcttgacgtg gcgtattctg aaccattaca gtgggccggc ccaggccagc
    85381 aggaggctgt gcagcctgcg agatcaatta gtttaattgg gccggcggca ggatgttccg
    85441 tgaataacaa tatctccatt cggtttttaa cacttgaagg gtgtcgtgta gtgcctactg
    85501 cctatgaatc tatgatagga gttggaaggg tcagagaatt agactttttc agaattaagg
    85561 ccctgtttaa gacatttttt ctgttcaaat tcaaaacagc tctagcttct agagaatatt
    85621 ttgtattgta gcaagaaatt gtttttctct atctccacta ctatacaaat gattttaaga
    85681 gacagtgccc aaatattaac gaaggcgggc acaaaattca acctcctcct gaaatactgg
    85741 gctattaatg gaggcggtta attttattta ccgaggcggt cacttttgcc cgcctaggaa
    85801 aatacacatg agacctagca aaaagcccat tgccaataca tctatcgggc tcatatataa
    85861 atagaactta tggtgtcatc tcactatccc tatcactctg tcgtctccct cccgagttgc
    85921 ccctctccct ccagagccgc ccctctccct cccgtcactc cctccctcca gcggcccctc
    85981 tacctccctc agtgtcgctc cctccggcgc cccatctctc tcttcctctc tatctttgcc
    86041 ccaactggcg cgaccggctg gccccggcgg cgtggacacg gccagcctcg gctcggttgc
    86101 ggatagaggc ggatccggca gcttcgcgag atccggcgcg aggaggcgga ggccgacgag
    86161 atccacgcgc tgggaggctt gtgacgctcc ccggcggcgg atctagggcg tgggcgccgt
    86221 ccttcgatgg cggatcgagg gtggtggcat ccctcggcgg ccgatccaag gcatgcccgt
    86281 cctccggcgg cagatcaagg gcgggcgcga ccggatgtag ggacgacaac agcagcaacg
    86341 cgcagatcca ggtagcggtg gcggcgacgc gtggatggac ttggtgagct catggatggg
    86401 ctcgacgggc ctgtccgcag gtttttcttt ttttgttttt cgtgtttgat ttacgaaggc
    86461 gggcaaagca accgcctccg tatgtcacgg attaaccgtg acctttgatt ggaggcggtt
    86521 acaatgcccg cctctagaaa taaaaaaacg cctgcctcta ataagatttc tgtagtagtg
    86581 ctctttcaga aatgaactag aagccgatga agcccgaaaa caccgcctct agagcagcca
    86641 aagctgaaaa aacccctaca acacgcaccc taagagtgta aagtggagtc tgtcttgaga
    86701 gcctatttaa tttgaagtta ttccactatt tttaccttat taacgcctcc taaacgtcct
    86761 agcatcacca atttttggat ctagaggttt gtctagttca ttttggtgga ggatgtaagc
    86821 ggtgctccat aaactagtgc acctgctcca ccatagagat ttcaaattgg aggtagaaaa
    86881 tagagtgaaa ctatccgaat aggcccacat ttgaaatata atgtttaatt taaaaaactt
    86941 tgtgtcttta tgttatttta gtaacgaaaa gggccaggta tataatcatt tcgattaaga
    87001 atgtacagtt ggacatttca agtccaccaa tattcgggca tttcaaacac aacacgatgc
    87061 atttctattt tgagttgttg aactagcttc cgcaactcta tcatgtgtac gcaacaacac
    87121 tgtttcacct tccctaaagt gctctaagtc tatgctcctc gactacataa cgctggatgg
    87181 ttgtgtgcaa aactcttata gaggtcaaaa tataatttat tttttaaaaa atggatagtt
    87241 ctgatcgctt ccgacctctg atagtaggac aagaggtttt tatttttgat tgcctcaacc
    87301 ttcaaatata aactgtagca tctgagctca caccacacac cacacgcgca cacttccaat
    87361 agcaggacaa gaggtggaaa acacagaagg aaacggaagg ggggaaaaac aaaggaaacc
    87421 gatcagcacc gtgaatttct ttgtgctgca tgtaacgggg cctcgcaagt cgtgggctac
    87481 aattccttaa taacaaagaa aaaaacgttg cgggctgcaa ttgaattggt gtttccccgg
    87541 cgctgggccg cgggcgtagc tagctggcgt ggccgcgctc ggcgctcccg tgatctcggc
    87601 tcgctctcgc cctctctgtt gtctgacggg taactcacac gcgcgcggcg gcgcgggcac
    87661 tcccgtgagc ccggaatctc catggctgcc tgctccagct ccatcgcccg cccgtgagtt
    87721 gggccgggaa gcaatgcaag ccgccgcgat taacgacggc cgcgcggtgg gaactcggaa
    87781 cggccacaaa taaactaagc cagagccaca tatatatgct cggtctgtcc ggtccttttg
    87841 ctgcttgctt gctgctccat gtatgtatcc ggccgtccgg ccggcacgca ccggtaatcc
    87901 cggccgtgcc tggccggtaa ctgcacgcgc cggattaccc gaatgaatta cctgcctctg
    87961 acttggaccc gcgcgcactc gatgcataca tactccattc ttcgacggta acagtacggt
    88021 actccactca agattttagg tctctactca aattatttaa agtttgacca attctattat
    88081 ctaatgtata aatagatata ctatatgagg atacttttca cgctaaatct aatgacacta
    88141 ctcatttcat attatcatcg atactttttt tatatatata cccgttcaat ttcaaaaatg
    88201 ctccatagtc ccttttatga tggagtagta aatttgactc gacgctacgt tgattaggac
    88261 agaggaagta agactacaaa aaaaagaatg acaatactga taccctggaa aaagggacaa
    88321 attaaacgag acaaatgtcg atgaatgaag caagagatat gtaacatgca tgcagcatat
    88381 cttttttttt tgatgaatct ggagaggtcg tagtccctac aacgatttat taaaagaagg
    88441 agcttaaaga attttaaaga aaagaaaaca gctaaaaaaa gggaacaaga acaagtcccg
    88501 tatcttattt cctgggctta ttattctttt atatacatgt cccgttctac ctggtactca
    88561 gtgaattgag atgtaggggc tattcgaaag gaaccctaag tttgaattgc aaacttatac
    88621 ctagttcaga gcagctccgg tgatgaataa tcgaaccaag ggcctatcca tctgaaccat
    88681 caacactgca gccaacgaac catacatgtc agaagcaaaa tcagatgctg tagacatgcc
    88741 aaacataggc gaataaaata ttcccaaaca aacacaaatg agtaatgggt ggaactttcc
    88801 gtctgtcgca tgactgagcc gcatacagag aaatattttc ttatgggtat aggacccaca
    88861 caactgatgt ccacgcttga ggttgtctct aaaccatatg cttcgttgta gcactggagc
    88921 tgctcttagg cactctacga cgtgtgcttc aagtgatgct gagagaagag aggattctgg
    88981 ctttgctcgt catgttttag caagccaagc taactcccag tgatggcaac aaaatgggga
    89041 gcgatgcatg ttcttgtgcc agtgacagtc gatgcccaac cgataaaata gtaccctatt
    89101 cgtcaaccgc tcatctcagt accgcgagaa tggaggcggg tgttggcaca ccagtactcg
    89161 ttgtcattgg ctccaacttc gttggccgct gtgatatagt gtgggagtca gtgtgttcga
    89221 ggtagaggtt ggtggcatca gcttggggga gtacggacgc aatggcatca tagtcattat
    89281 ggttcttcta gatacatttt tttgggttat gtatatataa agatatacac ctaaaaacta
    89341 aaacaactta cattgcaaac aaaggtagga ggtagcaatg tagcatactc caccaaaaga
    89401 caaataagac tacgtctaaa aagatagtaa caaactgata tagatatgta gagtttctgt
    89461 aaaattaagg accccttagc ttggaatggc aaactcatag caagcttact tcctcaaaat
    89521 gctaacgata cacaaaagat gaataacgca gtacgtctag tcagatcgta acaaactcat
    89581 atgcagggtt cctcccttag cttcgaatgg caaattcatc tctggcttag ttgcttgaaa
    89641 tgccaaagat ataggagtac tccaagatga aataaacaat agtgcgtcta actagatttt
    89701 aacaaacaga gatgtaggag ttctctaaaa gaaacctcta gctagctttg aatgagaaac
    89761 tagctcatca ctggcttatt agttgctcta actaaatgca gatgctatac gtactccacg
    89821 caccaaaaca agtaaggcat gcaatacgtc taaacagatc gtaacaaata tgcaaaaacg
    89881 ctgtatatga gttcgaaatg ctaaagagta aagacatagg atgaccctta gcgtttgaat
    89941 aacaaactca tcgcttgcat agttgttcga aatcgaaatg ctaaaaatgt gcaccgtgac
    90001 gaattaggca acacgtctaa cgtgagccaa caggtgcagc ttgcttctag ctacaagcta
    90061 agcctcttgt gagttctcga gactcgtttc gggttcacga gtcgtcgttg cagtagcagc
    90121 gagttggtcg tggtccatgc atgcatgagc atggctacaa gcccggccgg agtcccggcc
    90181 tgcactcagt cacgtcacct gcgtaaagct acactcacag acgcacacag ttacaggcag
    90241 cagcagtttg accactcggc atgcacatca catgccgcaa cagacgccac cttttcagtt
    90301 gcttccaacg aacaactacc atacctgtcg tctgcttgcg agtcacacta tcgctccact
    90361 ggcctatata tattccactg attaacaccc tgacagcatg cactctctcc tagctgcaaa
    90421 tacgtgcata tcgagctagc tagccaatgg cgccgcccat gaggaggagc tcttccacgg
    90481 ccacggtgtc ccgcctcgcc ctcgccgccg ccatcctgtg cctcacggcc ggcggcaaca
    90541 ccgtggcggc gttcaactac gcggacgcgc tggacaaggc gctgctcttc ttcgaggcgc
    90601 agcggtcggg caagctcccg gcggggcagc agcgcgtgac gtggcgcggc gactccggcc
    90661 tgtccgacgg ctccgcggca ggggtggacc tggccggcgg ctactacgac gccggggaca
    90721 acgtcaagtt cggcctgccc atggccttca ccgtcaccat gctctcctgg agcgtcctcg
    90781 agttcatgcc cggaggcgcc gcgggcaggg ccgccgtgcg ctggggcgcc gactacctgc
    90841 tcaaggcggc cgcggcggcg cccgacgcgc tctacgtgca ggtggccgac ccgaaccgtg
    90901 accaccagtg ctgggagcgg cccgaggaca tggacacccc gcgcgacgtg tacaaggtca
    90961 cgcctgacaa gcctggctcc gacgtcgccg gcgagaccgc cgccgcgctc gccgccgcgt
    91021 cgctcgtgtt ccggacctgt gaccccgcct actcctccaa gctgctccag actgctcaga
    91081 aggtacgtgc tcttgggcgg cgggtcggcg tgccgcccgt gacgcgacgt gctctggcct
    91141 ctgatccatc gtcgtggcgt ggctggcgtg cggttgcagg tgttcgactt cgcggaccgg
    91201 tacaggggct cgtacagcga ctcgctcagc tccgtcgcct gcccgttcta ctgctcctac
    91261 tctggctacc atgtaagctt tctgtccgta gctttgacta tgttgtcgtc tctgttggtt
    91321 tcagtacgtt ttttttggct gcaaacgatc tcgtcagagg tcagactcat ccaaaatgtg
    91381 ttcttggcac atgcaatgag aatgcagagg tcgcacatgc cgcctgcatt ttctctccac
    91441 ctttttctca actcaacttt tgagaaccaa tgcaggacga gctgctgtgg gcggcggcgt
    91501 ggctgcacat ggcgacggcg gcggcgggga actcgtcgga cgtgtacctg tcgtacatct
    91561 actccaacgg gcacaacctg ggcgcggagc aggacgactt caccttcagc tgggacgaca
    91621 agcgcgtggg caccaaggtc ctcctgtcca aggccttcct gcagggcatc ggcaagggca
    91681 agtccgacga cgcgctgcgg ctctacaagg cgcacgccga cacctacgtc tgctcgctcg
    91741 tgccgggcgc cgccggcttt cagcagtcgc agtacacgcc ggggggactc ctgttcaggg
    91801 aaggcgacag caacatgcag tacgtcacct ccacggcgtt cctcctcctc gcgcacgcca
    91861 agtccctcgc gtccgccggc cccgccggcg tagtctcctg cggcggcggc ctggtgccgc
    91921 cgtccgcgct ggtggccgtc gccaagcggc aggtggacta catcctgggc gccaacccgg
    91981 cggggatgtc ctacatggtc gggttcgggg cgcggtaccc gcgccacgtg caccaccgcg
    92041 gcgcgtccat gccgtccctg cgcgatcacc ccgcgcgcat cgcctgcgac gaggggttcc
    92101 ggtacctgca ctcgtcggat cccgacgcta acgtgctggt gggcgccgtc gtcggcggcc
    92161 ccgacggcag cgacgccttc accgacagcc gcgacaactt cgcgcagaca gagccctcca
    92221 cctacaccaa cgcgccgctc gtcggcgcgc tcgccttctt cgccgccacc cgccacccct
    92281 gaagctagca cgtacatgag aatgagatcg atcgatatga ttattagcgc ctgctggtgc
    92341 actgcacagg tttggtatgt acctggtgtg tcgtgtatgc atgtgtgaag cgtgtagtgt
    92401 acatgcatcg gcctcaatca aagagtaaag gtgcgtgtac actaccctta ctgtatgaaa
    92461 aacctgagct ttttttgaac taaaaaaaac tctaaaatct taaaaagtag cacatggaac
    92521 taaatagtcc ttatggtcac gccccgttac ccgccgccta cccaacctca caacctccct
    92581 cctccctttc ttctcctcca acctcaattt gagcacaaag tcagcaatgg cggtcctctt
    92641 cttaccgatt tagatccatt agctatcaaa tccactaggt atttgttgga aggtgctctt
    92701 gcaaggtata ggtatggtat ccattccacc aaaccatttc tcttaaattt catggtggtc
    92761 acgagtgatg ttatgcagtg gcggatctag gggtattccc tggtattccc aggaataccc
    92821 aacaattttg atgttctctt aagtatatat ggatatatat ttatacatat aaatgtgtaa
    92881 tgtaatattc tctagtattt tcacagattg tcacccatag cagccaaaaa cgacggtagg
    92941 aatacccaac gatgaaatgc tagctccgcc actgttgtta tggcatgagg ggggcaacat
    93001 atatagcaac aaccttgtca tgggagttgt gagccgggtg gatcgtgcac aatcggctga
    93061 tcagaccgag tatgcgtgat gcaagacgaa gacagaagaa atcggtggag gcatccacat
    93121 ctgtggcggt gatgacgaac cgacgataaa ggtgtgcgga caggatgaca agaagcaaca
    93181 cataaaagca tccctcagca taggatgctc ggcctagccg cacggtcgaa gaggtagatg
    93241 ctggtgtagt tgatgctgat gatggagtcg tgcacgtgag gttggccggc aatggatgat
    93301 tcaaccccga tctatgacga actgaagccg catgatggtt ggtgaactgc ggtggagagg
    93361 gaggaaggtg tccgacggca ctcaggtgag gtgaagatgg aggatggcgg ccaatcagcc
    93421 atggttgaga gcgccgtggg agcgcggtca cagtggagca tggaatcgga atttgacgac
    93481 gagtgaagat tggggaatga cgtttctgga gacccattag tgaagaagac atccgttttt
    93541 tatcaaacag ctgatccaag gaggcatcca tgatagttgg gccggtcgta tcgtcgcggc
    93601 ccatggcaac agaggcgtcc cgacgaatgc cctgacccag catttccgct atataaatgc
    93661 cctgtaccag gccgaccgcg gtgtgattca gtcgcccgta catagatttc ttgccataca
    93721 ttttggtgtg ctagtacatc actctagctt gccactgtac atgtagctag ctacttaact
    93781 ttaatttcgg tttaggttca agcaaagcgc ttgccaacat acatttatct gtgtcctcgg
    93841 cgacgtgtat atatagctct ctactagtgc ttctgcggct gcggctgcgg ctgcaaaatc
    93901 acacctgcgt ggcattaact agtactaccg gccggcagct gcagtggctg caccgaacat
    93961 gcttacgtac gttcacaata gatggacaga aaattactca ctggggaaga tctctctgca
    94021 caaaaaaata aaatatgcgg tgtgtcagtg tattgaagta cacaataaca gagaaacaag
    94081 aaggaataca ctttaattat tcatatttaa tgaaaatata aatataggtt cctcagagaa
    94141 acgagaagga atacacttta attattcata tttaatgaaa atataaatat aggttcctca
    94201 tataaataca cttcgtagcc tgctaacggc gatctgactt ggcgacgtgg tcttctcggt
    94261 tccagggcct taaagtaagg ctcatgatta attatatcca cgtttttagc tcgcggaaca
    94321 cctttgatta agctgttgca gttgtcgttg tcggtcttcg cttcatgttc tccacacatg
    94381 tggtgttggt gtagatgtac ctagcattga tatgactcat ggccacgtcg gcattcatga
    94441 acaggtgtag cgtagcttga acatcagcta tgctcgcact ttcagtcaat gtatggagca
    94501 gtagctacgt acgttaacca gctcttttaa ccgtccatga cattgattct atatatatta
    94561 atactaatta tttgttatat attaatacta attatttgtt aaggaatata tatatatata
    94621 tatatataga cacacacaca cactctccta tgtatatctc tagatttagg gtatatatga
    94681 cccaacgaag tatatgtaga cgaagtatac aatcatacta gaccatctac ggtagtatgt
    94741 atgtcaagta tgcaagtata cgtagagtat atggttacac ttattatata tatatatatt
    94801 aagtagcatt ttagtaatat attaaaaagt atgtgctctt atgaaaaaat ttcgcgtagt
    94861 aagagttgaa gtatcttaaa ttgagtatat aaacatactc gaattgataa attagtatgc
    94921 acacatacgc aatatggttt attaaagatg gaagtaacta cacgccgcgt gtaggaaaaa
    94981 tgcaccctat atatatatat atagtccacg aaactattgt ttgatatata gtatcagttt
    95041 gcccgcaata tgcattttca ttagaatgcc tttttttcga tccccaagtc ttaaagtttc
    95101 actagtaaaa tttacggcag tggtagtgcc cggacgtctg gacggatgcc cgcgcctgca
    95161 ctccgtttcg tgcgccatgt gggactcgcg ctacccgagc gagaagaggg gaagggggca
    95221 gcgcctctgg ttcggaaaga cttggtctcg gcgtcatttg gatgccctgt cagcgcgagg
    95281 agtaggacac actgagacga ggcaggagaa ggcgaggaga aaaatgcaac acccgatcta
    95341 tttttgaaac attcagatga aacacttgaa acatgcatat gaaacactta caaaacacaa
    95401 ctaaaaaaca tttgaaacca ctgtaaacat acacaacatc caaataaagt accggtaaac
    95461 atatgtgtga aacatatgca acatctagat aaacaaactt gcaacatacg tctgaaaaga
    95521 tagatgaaac attggaaata gaagctcgca acatacgtgt acaaccattg caacctgcaa
    95581 catcccgatc tacttttgca acatccgtct gaaacactta caacatacat gtgaaacatc
    95641 tgaaacactt gaaacatacg cttgcaacat gcgcttgcgc aaaatctact tcctgcttgg
    95701 atgagaaatg gggtcgacgc ggagcttgac gcttgcgggg agctcgatgc tgcggagtgg
    95761 cgatggggga agccagtggg cgggcagctg cgtggtctcg gcgagtggtt gtgctgcagt
    95821 gatagggtgt gcggtcccct gcggtgaggc gcccctgcgg tggaggtggc agcaccgccc
    95881 acagcgcgca catgctttgt ttgcagcgcc cctacggtgg aggtggtagc gccgcttgca
    95941 tgcggcaagc gcatgcgctg gtgaggcgcc tctgcagtgg aggcggcagc gttgcccatg
    96001 atgagcgctt gtgctgcctg ctgcgagcga ccctgtgcta gagaaggtga tcagtgggtg
    96061 ggcattgcgg tggagtcgga cgcagaggtt tgatagtggg tcaacgggtg catctgggcg
    96121 gacgtggtgg ccggacgccc tattctaatt actattgtaa atttgtatca ctttagctct
    96181 tgaggctcca aacagtaggt ctaaagtgtc gtctaaagtt tagccaacct cacaaaaaaa
    96241 tttagaccat ataagtgagc taaagtggtc taaagtttta gttttcaaca ttactcaact
    96301 aaactttaga tcatactctc cgttccaaaa agagcaatgt tctgagattt aagacagatt
    96361 agtggagaac aaaaatgtct ctaataccct tagtttgtta cacatgattt tcttaaaaga
    96421 atagatgtca cgtgatttac ttcctaatta agacgcgttg catgaagcat gcagagatct
    96481 gcgggaggca acaacagcag cgcatgtcaa ttggtaattt ggcgccggat gtgttgggca
    96541 tgcatgagag tcaatagatt cttttgtggg ccaacaccat gtctaaaact cgtaacatca
    96601 ttttttggat aaatcacgga acatcactct ttctagggcg aagggagtag gatcaaaaac
    96661 cctaagtaat ttgcagatag agatagggct gtgagcaagt cctaggcagc agagcacgct
    96721 tgctctccta ggccggaaga ggcttgggcg gaggccgctc gcagaagtat gagctcatgg
    96781 gctcctccta ttgataaatg cgcgtagccg acccaatatc ctctctatct ctctccctca
    96841 gtcacacatg acacagtcgc tatacttaag gcgcatttgg tttccagcca tcgcgtgcca
    96901 cgccacactt tatggctgcc acaactcccg agggtgatgt ttggttggtg atttatcttt
    96961 ggcggacata gcttttcaca gactgagatt ctgccacaac tgtggcgtcc aataacaccg
    97021 ccacagttgg tgtggccgag tgcggctata atccgaacat ccccttactc tcttgcatcc
    97081 tagtttcact gtcagtgtaa catcatggac gatgatgagg gtaaaaatag aaataaaagt
    97141 aaaaaaacac aacacacgca cgacatatga tatacctact acactccgac atttgcactc
    97201 tgtacattgt cgttctcttc tttggctgca tagttgtatt atttgcaaag attttgatcg
    97261 tatatagaat cgtctgtgtc gcatatgatt tttccacaaa tgcatgcata cgaggcatac
    97321 gcattcgtac taaaacttag gatacatgat gtgacctaaa accactaata tgcatgcatg
    97381 catagagcaa acaaaaagtt tctgatgaag tttcgacgta tgcgcattcg tactatatta
    97441 attaattatt acctaagcta cgaccgggcg ctaaatttat attagcagct ctaactattt
    97501 ttagcagaac ctttatttat attgtcgtca gtgaaagcgt ggagctctcg tgctagtact
    97561 atataaatac acacacgtgt cttcggaaag gtacggtatc tgagtatcta ctaaatatct
    97621 catcacacac tgagctaagc tatcgcgtgg tagtgggccg ggcaagatga gcgtgccgat
    97681 ccccgggaag tcgtcgtggc cggagctggt ggacggctgg cactgctaca caactgacct
    97741 ttcgtcggtc gctcaaaata tctttagtct cggcgatttc ggcgactaag actaaataga
    97801 cttttagttc tggttggtgt tactaaccgg gactaaaggt ccctcgtcaa cggctctgtt
    97861 gtcaggcgct gtcgcgaggg cgtgttggcg aagctggcgg cgacgacgat cgcccacgac
    97921 aggccggacg tgtccatcga tgtgctccca agcgccgggg tcgccgatca tcccgccgga
    97981 ggacccgaac tacaacccca tgcatgcgcg tccgcgtctt catcgacagc aacggcattg
    98041 tcaacccggt ccccgtcatc ggctaggtag ctagcgccgc cgccggtttt gtttggagtc
    98101 gtcatgtgtg tgtgtcgtcg tcgtcctcgt cgtctgccgc tcgtcagtca tcacacggtg
    98161 gcgcggtcga cctctgtgtg tggtgtgtga taatggaata aatatcccgc tgctgttgcc
    98221 tgttgtatgt cctcgctttc ggctaggaca tgcatatgta cgtgtgattg caggcaagtc
    98281 atcaactact gtgctactcc ttcctatgtg tgggaattga agaacgaact accggtgttc
    98341 tgttaccatt aggtaacaaa tctccaccta tatacttact acagaaatga tgatcatcgc
    98401 agtgactttc accgttagtt atgtgagaac ggacaacgat acatttcacc tctggttcat
    98461 aagctgaggg gtcgcggaag ggtgacttac gggcagtgat gaatgttttc accgccggtt
    98521 tgacgcatga tctggaagtg aaaacagtgt catcttcacc gctatatcat acactaaact
    98581 ggtggtgaaa acatttagca ccgccagtta gttgcccaat gagcaaagca cttataaacc
    98641 ggcgctgata agaaatttca tcgctggttt gaagatggaa ggccgaagtg cccgttagag
    98701 tgaaaattgc aggttataca tttgttttta tttttattac aaataatatt aatgatttca
    98761 ttaattcaac tagcgatgtc actactatgt tttaattatt tataataatt cttaaaatgg
    98821 caactttaca taaatgtttc taaaacttta aagtcccaca tatcttttta attgtagctt
    98881 cattttacgt ggtttttgtg cctacgcaat cgtagaaatg agccctacat tttactagta
    98941 gtctttacag tatgtctttg taatgtttga tatactgagt ttagttttat ttgctactag
    99001 ttgaattcct cgtgcgttgt tgcggaattt tataaagaaa ttctaaactt aaatttggtg
    99061 tagaaaaaca cttccacttt agcacgaaaa gaaaaagact tggtggcatc ctttgtgata
    99121 ttaattgtca tcaacatggt gggagagaaa aattgacggc gtcagtttct gatgatgtgg
    99181 ctgcttggtg actattaaat gacaattgtg tgctgatgat gtggcttaac atgagagcaa
    99241 agaaatcctt agtggggttt tgctttataa gaagagtaaa ttgcacccac catacaacaa
    99301 cttgaaaggt gggtgtagat tggtccaata acttatagaa tactcaattt agtgcgataa
    99361 cttggtaagt gtgtgcatat tagtccaaca acttataaga tgtccaattg tgcaacaact
    99421 tgtaaaattg gtgcatctat agtccaaacg ttacaacgat gacatatttg gtcacattgt
    99481 atagcaaaca gatagtatat ctggctcgga acaaataatt gataattatg tgcccattaa
    99541 tattcgcatc acaatggtga tatagtgttt cctcaaaaaa atggtgacat agttgtccaa
    99601 gacaagaatc tttatttcga aattcaaaaa aatatattca cataaatcga gcatttttac
    99661 atgttcttgg accagttttg acccacatgt caagttgttg cactaaattg agcattttat
    99721 aagttgtttg actaatttgc acccaacggc caagttcttg tatggtgcat acaatttact
    99781 cttataagaa tataagatat gcttttattt acatgttgct atctaacgaa gagaagatat
    99841 tcgaggtgga ttcagaagaa aggtctgaaa ttttgcacaa tgttcagagg caagcgtcgt
    99901 tgacctactt acacctacat ttattttatt ttgattaaat catagttaga cttttagttt
    99961 catgatgagt cctatgttaa ggtcttttac tagatcttgt aacactatcc ttgaaactgg
   100021 ggtttggttt ggtagaatca tgtgcttagt gacggtaatg cccaatcttc tgtttggtgg
   100081 aggtgtaatt actctggatt tggtggaaac cttcatactc acgatctagc ttcctatcac
   100141 aaagacctgg accgcacaat catatcacca catctctcta gctattgacc atgcattgtc
   100201 cggttgacct ctcatcatga aggctaatca ctgcctgtga atcacaagaa aaaacaagaa
   100261 agacaccact caatttgcag agagtaatta gcctcacaag ttggggtttt gcatacctat
   100321 atacggtgaa actttttgat tacagattaa taatctaagc aaaatatatt gtattaggag
   100381 tggataagga ctactggatg tgtccataat ggactttgac gcgataaatg acccaacaac
   100441 ccaaaagaag atgatgcaac accatgatag attatgtaca tacacttgtt tcaacgagga
   100501 ttgccattga ctcgtaagga tttgccttgg aactgtttca attgggaact tatccccctg
   100561 gagtctgtat gcaatctggg tgatggtttt agtatgagtt gctcatatag tttgaggtgg
   100621 accggaactc gatatggatt aggcctttaa cttggtttgg acaccctctg cctccatggc
   100681 tttctccatg tgcttcttga tcctatctga agttactcgt catgtactac tgtatatata
   100741 tacagcgacg acaagctact cgttcgattg ctccaagaca gtactcgcca agcatgcatg
   100801 acaacaccaa agcgtatcgt cacgtacgta cgtgtcagat ggaggatgga cgcatgggcc
   100861 ggctcagatc ctaattaata ttagtgccaa tttaacatca gacaacgaaa gcaaaaatat
   100921 aaattatgta cgtgcactcc acatcacaca ccttgtacac cgttgtcttg ttggctgctt
   100981 agtagttgta aacgttctgg tcctaggtag aatcatcttt aggagtattt ggcaaattaa
   101041 cagcatcgat cggatcgtag aattaactca tatatcgaga ttctatatgt ttcacaacaa
   101101 aatatttgca taattaaggt tcgtaatatc ttacaaagat cgaagcatgt taattgattc
   101161 atattaattt atttgttttt ttttctaatt ttaagtggac agttcgaagt aacatttccg
   101221 caacaaaata attttagtta tttatatcat tctaaagatg tcatgaaact ttaacatagg
   101281 attccattcc aggccagaga tagttttatt gatgcacgag gctataaaac tccacttctc
   101341 ctatatctca agtgcttgat tttttgttgt tcggacaatg tgcaattttt gatattgttt
   101401 ggcaatataa aagaaattat gaatatcttt cgtgagtttt ttcttttaag tgtactaatt
   101461 aattgtgtaa aattgttgcc tgaaaatttc taaaaatttt aatcacctaa aatatagcaa
   101521 ctcttgttta tgagtaggac gatagtacct tgtaagatgc ttcctaggat tgcacttata
   101581 gtatcttaag aataagattc tagctactat tcgtatcgga tcatatgtca atcaaacttt
   101641 ggctgcatgc aaccaaacaa aaatttattc ctgttaaaac gaggcatacg cattccgaat
   101701 tttactttca gtttttcctt tttacctgtg acggcgcgcc aatactaaga agcgttaact
   101761 tttagtcatc aatgacgtgg cgccctcgct cgatcggccg tatatatata cgtgtcatag
   101821 aggcggtatc tgagtatctc acagactcac actaagagct agctagctaa tataaccgcg
   101881 agcggccgac gacaccggac aagatgagcg tgccgatccc cgggaaatcg tcatggccgg
   101941 agctggtggg cgtgaatgcg acgctggcgg cgacggcgat cgcccatgac aggccggacg
   102001 tggccgtgga ggtgctcccg ccgggggcgc cgatcatccc ggactacaac ccgttgcgcg
   102061 tccgcgtctt catcgacaac aacaaccttg tctccaaggt ccccgtcatc ggctaggtct
   102121 ctagtcctct agctagccag gcaccaggcg ctgcacccgg ccagcagctg gttttgatgt
   102181 ttggagtcat gtgtgtgtcg tcgtcgtcgt cagctcgtca gtcatcacgg tgccgcgatc
   102241 gagctgtgtg tgtgtggtgt gatggaataa ataccggctg ctgtttcctg catggcctcg
   102301 ctctcggctg ggacatgtat gtgtacctgt gagattaccg gcaagtcata cactactgtg
   102361 ctactggtgt tcatacaatg cttgttttct acctctcgct ctctctgctt acgagtgaac
   102421 agattgtcaa tgattgtaaa caaagcgaaa gctattttca tttctatttt gaatttgaat
   102481 acataaaaaa acgtattacc cagggggata caaattggca agcttaaggg aaattaagtg
   102541 ctaactacct atccaaacaa acagctaagt cccaagtaaa aatcctaagc caaagccaga
   102601 aaagcttaac tcctattctt tctagcctcc gcggaagttc cgtgtttgag tgcagaactt
   102661 ccacacttaa tggttgatcg tctacaaagg gaaggagtac aatatactct ccccccttct
   102721 tccccaagtc atcttcgaca ttagttatac tcacctgctt gtggatagct ccctctctca
   102781 ccccattgaa ggctccccat cctctcccat tgtttcttag tgaagtccct tgagagattg
   102841 gttctagaag tgagttagag agcttgtgac caaggttttc aaatgttctc ccctcctagt
   102901 tgttggtttg tgttcttttt ctcttggagc tcgaactcct agacggctag aggttgccct
   102961 ggagctctcc caattggttg tggttgagca ctgggaagtt tgtattgctc ttgtgaagct
   103021 aatgaaaacc cccaacctca atctttgtgg ttcgcttgag aagatgatag ggttggaaga
   103081 gacccaaagc ctttgtggct tactcaccag tgaggacata ggcaatcttg ggttggatgg
   103141 tctaaatgtc aactttgact aatgattgta tgcaagaatg tgggttggta atgtcttcag
   103201 caacacaaag aataacaatt cgactggatg gtttgtttgg ataaggttgg atagtgatgt
   103261 gaactggtgg acatttgtgg tcatggtgtg atggtggttg gttgacgggt atcaattata
   103321 acatcaaaac gggcttgtga ggctgccacc aatttgtggg catcagtgct aacttactta
   103381 tattgcaaat gcacgataat gttggatcct tttccttaag actttaagag tattttaaga
   103441 tttatatcga attcaaggaa cagacagatt tctatatggg caacctttta tactaatgaa
   103501 atctattatg ggttgtaggg tgttctaata tactgaagta gggtgatctg aatgaacggt
   103561 actagtgttg tgttgtgaac ggaaaaagaa gtgtgattgc ctaggatatt aggatcatca
   103621 tctagtactg tctataaact actgtatcgc tgtagttact attacacttt acaagcaagg
   103681 aatgccatca atgtgctttg tcacgcatca ctctattaca tcttattcct aaacaattta
   103741 ttaataaaat atatgtttat tatagattaa ggtcaacgtt taaaatacta tatttattgt
   103801 tagaatttgt tagcagctag tgtggaatta ttgacgactt tcaccttccc aatgctagct
   103861 tattttggcc caagattact caagagagct gcataaagca ggctcatgtg cgagcgagcc
   103921 catttaaaaa acgacgtgaa agaaaggaac tccgaaaaag gaaacggtca gcgtaataaa
   103981 ctgcatgtgc atcttgttaa gcccgaaata acaatctgca ctcagcatat attagatatt
   104041 aatgtactat tagtattatt cgtgtctttt atttatggat gtttagccag ggagagtcac
   104101 gggaggttgt atgtcatctt gggaccaaga ttgtaagagg cggtggagtt tgatttggac
   104161 aggagatgga gtttgactcg acgaaaatac tgctcagttt tgacacaaga aacacttcta
   104221 aaccgcgttg aagcggattg ccttatacat actaagtggg acggacggtc attacggagt
   104281 tggacacaga tggatgggcc ggaccaaaaa attgaggaga gaaattttgc ctctttaaaa
   104341 cggacgttgc ccgtcgtgcg tgagccagaa tacttgggct tagctcaacc gtgtttcaat
   104401 tacacactaa taagacccat aataaataat atctgcacta aattatttgt cgcgtatgaa
   104461 aaatcaagga gagattgact cagtttaatt aggtggctat tatcccgtat ggaaaatcaa
   104521 ggagagattg actcggttta attaggtggc ttgtctatat ctgttataaa tctataccta
   104581 ataataaagt ggcaatgcaa ataatgtttt tcaattctaa actaagaaga gtgatgttga
   104641 gtaatggttt ttcaattcca aactaagaag agtgatgccg agtagttaag ggaggaccgg
   104701 acgaaaaaaa taggggtgag aaattttacc tttttattat tactagcaaa attgtccgtg
   104761 cgttgcaacg ggtgataata aggacatata taccattatg attaatttca aacttccaaa
   104821 gccaataatc tagcttggtt taattttttt ttgaaacagc ctggatgtat tcacgccagg
   104881 gagttggact tatatgtgtt taacagaact cctgtcctag ttgtattcac gtcaggagtt
   104941 actcagtctg aaatcctcca tagccgtcgc catctgctcc acgttctctg ggccacagat
   105001 cggaacagag gtgcaaattt agagtgtcag actcttttgc tgaatcgtct attctgtagg
   105061 tccaagaata attgttccaa ggagtctcag gtgggcgtca tgcggagcag tctgtgaggg
   105121 cgatatcatc cttgcttgtg gaggtgttat gccatcattt gaattagcat tattggcaac
   105181 catttattgt ggatttacct ccagaattat gagttggtca catactctga gattggaata
   105241 gtgtatcaca gaacctgtag ttggattttc ctttctaaga gaatagctat ctatatacaa
   105301 aatggtattc caattttcat gacgtcacac aacaaaaaca tctagatgcc cttttaagag
   105361 ttgtgagctc atgaagtaag atctacaaca gcattacgct tgaaattttc acgtgctcct
   105421 attgggtcat cgcacatgtt cagtattagc aaccaagtga gagttaatat taggtgttat
   105481 gctaaatgtg agccacagat gatgtacctg agttatgggt tggtgccctg attccatcgg
   105541 cacttggaag ccaagtgtgc ccattactaa tgcaaaaatt attattccct gcaacaaatg
   105601 tcaaactatt cagttaacta gaattctgaa aacaaaagcc aacactcgag tgttctaggt
   105661 attgtggaat tcagaaatat gccggtgtgt aactcatttt agctaccctt ttgaagtaaa
   105721 ctgattctga agaatgtaca agaacacaaa agttcagagc tgacatctga gtaggctttt
   105781 cttatgtgat taagaatatt tatcatcttt aatttatata tgataaaaat caaccaaagt
   105841 aatttggtta gataaacaat gtcctttcca cttgttgcat gcgcttcttt gcaattggat
   105901 agttgtgctt gttctgcttt ttcatagtgt atatgctatg aacctaacta tgaaccctta
   105961 cagaaggtcc aataggcagt ccagcattga cgctataaac gccatggata cagtttcaac
   106021 tgaagcaatg gcttttctac caaaaagagg aggcaatgac ttttctgaca aagaggatca
   106081 gattgattat attcgacaag ttaataacaa ccatcttgct ctttgccaat tgctgaattg
   106141 gctcttcatc agaagaaaag aagcagacat agttcacaac atatatctta taaggaaaac
   106201 aatattgaag gtctatgtga atattccata atcacatact aaacaatggt aaatctagaa
   106261 atcagtctct ttcttttgtt ttgtgtaggc tatatgtttt tatgtagaag tccaaagtga
   106321 taaccgtcgg ctgtttccaa aatcgaagct tgcagcaaaa tctcgaacaa caaaaagaaa
   106381 gcctctgtcc tgaatatagc tccttgcacc catccatgat tgtcttgagg tcaacctcac
   106441 caagatcaat ctttttttgc cttggactca cacttggaaa gaagttcact gagcctaagt
   106501 caagcttatc ctcctcctga attggtgctc gtctctgtca aactgtctag gcaaaacatg
   106561 aagaaatcag atcctataag ccaaggcaga aaataaattt catccaagta catgtccttc
   106621 agagacatat cactggatgg ccactggaac tgcaaatcgg aagagaatca aaggtaacat
   106681 catctacaaa ttaggatttg ccaactgtgt cacttgattt tactcatact gtgcaaattt
   106741 tgaaccataa atcacatgtc ccagttaatt ttgctctctt tcttttacta cttttgtcag
   106801 tacatgatga gtaataacat aagaatcaaa gaagagggag aaaccacatg taagaagcca
   106861 accttgcttg atcgtgcccg gtgagatcag gagcgttgtc cacctcggcg aggtcaggtc
   106921 gcctgcgagc ttaggatgtc ccaatgaatc ttgcgagatc aggatttccc aatggcaact
   106981 tttaatttca gtttcaacca aaatctctat aaacaggaaa ataacggaag gagtttgtgt
   107041 cgagcgtacc atggaatccg aacgggagtg atgttgagta atggtttttc aattccaaac
   107101 taagaagagt gatgccgagt agttaaggga ggaccggacg aaaaaaaata ggggataaga
   107161 aattttgcct ttttattatt attattatta ggtatagatc tggatcacgt caatcaaacc
   107221 ttggctgcat gcggggatat atcacattgc aatacaggga caatttcgag ttgtagcgac
   107281 cggcggtgag ctctaaagca gcaaacaaaa acttcctgat gaaacgaggc atacaaattc
   107341 ctacttttac tttcagtttt ttttagtcat caatgacgtg gcgccctcgc tcgatcggcc
   107401 gtgtatatat acgtgtcgta gaggcagtat ctgagtatct cacagactta cactgagagc
   107461 tagctagcta atataaccgc gagcggccga cgaccggaca agatgagcgt gccgatcccc
   107521 gggaaatcgt cgtggccgga gctgctgggc gtgaatgcga cgctggcggc gacggcgatc
   107581 gcccatgaca ggccggacgt ggccgtggag gtgctcccgc cggggtcgcc ggtcatcccg
   107641 gaccacaacc ccttgcgcgt ccgcgtcttc atcgacaaca acaaccttgt ctcccaggtc
   107701 cccgtcatcg gctagggctc tagtcctcta gcaagccagg caccaggcgc tgcacccggc
   107761 cagcagctgg ttttgatgtt tggagtcatg tgtgtcgtcg tcgtcgtcgt cagctcgtca
   107821 gtcatcacgg tgccgcgatc gagctgtgtg tgtgtgtggt gtgatggaat aaataccggc
   107881 tgctgtttcc tgcatggcct cgctctcggc tgggacatgt atgtgtacct gtgagattac
   107941 cggcaagtca tacactactg tgctactggt gttcatacaa tgcttgtttt ctacctctcg
   108001 ctctctctgc ttacgagtga acagattgtc aatgattgta aacaaagcga aagctatttt
   108061 catttctatt ttgaatttga atacataaaa aaacgtatta cccaggggga tacaaattgg
   108121 caagcttaag ggaaattaag tgctaactac ctatccaaac aaacagctaa gtcccaagta
   108181 aaaatcctaa gccaaagcca gaaaagctta actcctattc tttctagcct ccgtggaagt
   108241 tccatgtttg agtgcggaac ttccacactt aatggttgat catctacaaa aggaaggagt
   108301 acaatatact ctcccccctt cttccccaag ttatcttcga cattagttac tcacctgctt
   108361 gtggatagct ccctctctca ccccattgaa ggctccccat cctctcccat tgtttcttag
   108421 tgaagtccct tgagagattg gttctagaag tgagttagag agcttgtgac caaggttttc
   108481 aaatgttctc ccctcctagt tgttggtttg tgttcttttc ctcttggagc tcggactcct
   108541 agacggctag aggttgccct ggagctctcc caattggttg tggttgagca ctgggaagtt
   108601 tgtattgccc ttgtgaagct aatgaaaacc ctcaacctca atctttgtgg ttcgcttgag
   108661 aagatgatag ggttggaaga aacccaaagc ctttgtggct tactcaccag tgaggacata
   108721 ggcaatcttg ggttggatgg tctaaatgtc aactttgact aatgattgta tgcaagaatg
   108781 tgggttggta atgtcttcag caacacaaag aatagcaatt cgactggatg gtttgtttgg
   108841 ataaggttgg atagtgatgt gaactggtgg acatttgtgg tcatggtgtg atggtggttg
   108901 gttgacgggt atcaattata acatcaaaac gtgcttgtga ggctgccacc aatttgtggg
   108961 catcagtgct aacttactta tattgcaaat gcacgataat gttggaacct tttccttaag
   109021 actttaagag tattttaaga tttatatcga attcaaggaa cagacagatt tctatatggg
   109081 caacctttta tactaatgaa atctattatg ggttgtaggg tgttctaata tactgaacta
   109141 gggtgatctg aatgaacggt actatagtgt tgtgttgtga acagaaaaag aagtgtgatt
   109201 acctaggata ttaggatcat catctagtac tgtctataaa ctactgtatc gctgtagtta
   109261 ctattacact ttacaagcaa ggaatgccat caatgtgctt tgtcatgcat cactctatta
   109321 catcttacgc cttctttaca tgcattatga acggattgcc cgatgcaaga agtgataacc
   109381 accacgctac ggacacagca atgtatgagt gaagttaaca ttaaacaaga aacgcctcta
   109441 taaataatga atgctaactc tccctaacta acatccctac cccagtcaca cactcactct
   109501 ctcagatcct aatagtgcca agttggaaat atgcgcctgc aatccacatc acaccttgta
   109561 catcgttgtc ttgtcggaat agtagttgtc aaggttgtga tcctagaggt agaatcatct
   109621 ttaggagtat ttatttgact aacagtatcg accatatcat agaattaact gatatatcga
   109681 gattctatat gtttctcaac aaagtattta cataataaag gtttgtaaaa tatcttccaa
   109741 agatcgaagc atgttgattc atattaattt attagttttt ttctaatttt atttggacag
   109801 ttgaagtaac attttcacta caaaataatt ttaagttatt tatatcaatc taacgatgtt
   109861 atgaagcttt aacataggat tccattccag gccagagatg gttttattga catatgagac
   109921 tataaaactc cacttctcct gtaactcagc aagtgcctga ttttttgttt ttattcagac
   109981 aacatgtact tttgtcattg tttagctata taggaaaata taaattatag tttttctttt
   110041 aataattgta ctagtttatt atgtaaaggt gttgcctgcg tcataagctc cttccaagga
   110101 ttgtacttag tatcctaaga ttctagctat tatttttact agcaaacatg tccgtgcgtt
   110161 gcaacggaag aaactatcaa acgtttatag taaattatga ctatagtctc taattaaagt
   110221 cagtatagcc tattttaatg aagtcgttgt ttggggttaa gattgcgaag cgcaaccatt
   110281 gaagtcctaa atatgtaaat ttctcattat atatacgtac atattagaaa tttgcactgg
   110341 catgtgcata tagtttgaag aaacatttat ttttattaga ttggatgaca aagtgttcaa
   110401 gatttaagtt tacggtttga ttagttaggt catcagccga ttcatcttat agtaataatt
   110461 tttttattcc taaacaattt attaataaaa tatatgttta ttatagataa aggtcaacgt
   110521 ttaaaatact atatttattg ttagaatttg gtaacagcca gtgtggaatt attggcgact
   110581 ttcaccttcc caatgctagc ttattttggc ccaagattac tccaagagag cagcataaag
   110641 caggctcatg tgcgagcgag cccattcaaa aaacgacgtg caagaaagaa actctgaaaa
   110701 aaaaacgatc agcgtaataa actgcatgtg catcttgtta agcccaaaac aacaatctgc
   110761 actcaactac attaggcatt aatgtattat tagtattatt cgtgtctttt atttatggat
   110821 gtttgtccag ggagagtcac gggagtttgt atgtcatctt gggaccaaga ttgtaagagg
   110881 cggtggagtt tgattcggat aggagatgag tttgactcga cgaaaatact gctcagtttt
   110941 gacacaagaa actcttctaa accgcgttga agcggattgc cttatacata ctaattggtg
   111001 ttagggaaag tgtttctatt gatttgggct aaccctaaaa gggtagctat ataggtaacc
   111061 atacatgggc cacatgggcc tagccctatg ggcctaatac acacacattc caacaccccg
   111121 cagtctgaac taccggcgca gcggagttct aggctgaaca agaaagaaca cacacagccc
   111181 cccacagacg caactagcca ctggtgatgt tgaggctgga gcgaaactcg gtgaaggtcg
   111241 aggacgggag gcatttggtg aagatgtccg tgaactggga ggtagtcgga acatgaagga
   111301 cccgtacctc gcccatggcc acccgatcac ggacaaagtg taggtcgatc tccacatgct
   111361 tcgtccgctg gtgttggatg gggttggtgg agaggtagac cgcactgaca ttgtcgcagt
   111421 agatcagtgt actccgggag ggcggagtgt gcagctcagc gagaagctgc tggagccagg
   111481 aggcctcagc tacgccgtta gcgacagcgc gatactccgc ctcggcactg gaccggaaga
   111541 ccaaaggtgg cgcttagatg accaggacac caggttgccg tccaagaaga cagcgtagcc
   111601 ggaggtggag cgccgagtgt ccggacaccc tacccagtca gtgtcagtgt agacgacaag
   111661 gtcggcggag gaggaccggt ggagtaggag gtcgtagtcg agcgtgcccc ggaggtagcg
   111721 gaggagacgc ttgagagccg tgaggtgagg ctcccgggga tcatgcatgt gaaggaagac
   111781 ctgctggact gcataggtga tgtccggccg ggtgaaggtg aggtactgaa gggcacccgc
   111841 gagactcctg tagcctgtgg gatcagacac tgggggtccc tcagcctcgg acagcttgcc
   111901 ctgagtatca accggagtgg agcaggggtc gcaatcagtc atcccagccc gctccaggat
   111961 atcccgagta tactgccgct ggtgaagaag taacccatca ggacgaggct caacagtgac
   112021 cccgaggaaa tggtggagca cacccagatc cttcatagca aactcttgct gaagagcggc
   112081 aatgatccgg cagagaaggg gctcactgga ggccgtgagg acaatgtcgt caacatagag
   112141 cagcaagtac gcagtatcag ctccatggtg gtagatgaac agagatgtat cagacttggc
   112201 ctccatgaat cccggtgtca gcaagaaagc agcaaaccga tggttccacg cctagggtgc
   112261 ctgcttgagg ccgtagagag acctgttgag ccggcagacc atgttaagat gggaggaatc
   112321 aacgaacccc gccggctgac tgcagtacac tgtctcggtg agaaggccgt gcagaaaagc
   112381 attcttgacg tccagctgat ggacaggcca tgaccgagca agcgccaacg agagcacggt
   112441 gcggacggtg gctggcttga ccaccgggct gaaggtctca tcatagtcga ctccagggcg
   112501 ctgagtgaag cctcggagaa cccatcgagc cttgtagtgc tcaagagtgc cattagcccg
   112561 acgcttgtgg gtccagatcc acttgccagt gacgacgttg gagcccgttg gtagaggcac
   112621 caactcccac gtctggttgg cgagaagcgc ggcgtactcc tcttccatcg cgcggcgcca
   112681 gtgaggatcc aacagggcat cgcggacgga agagggtact agggagacca gcgcgtcgcc
   112741 agtcgatgcc tcaagggcct ggggtggcag tgtgccagcc gcgtgccatg tcaccatcga
   112801 gtgaacatgc cgtgggtgtc ggtgaagaag cggcgagtga tagactggcg gtgcatcacc
   112861 gtccggtggg gactgcggcg gtggtgtcgg tgtccccggc ggagaaggga ctacgagtgg
   112921 cggcggccgc ggcctgcgct ggtacacccg taccgacgca gcgaaccacg acggaggtgg
   112981 cggggcaggt gccgaggcag gaccaggcaa cggcgaccgg catggccccc ccggggcagt
   113041 atcgggggac gaggtccccg ggtttgcacc aagcggagag gtcagggccg cgccagagga
   113101 cgacgggccc ggacccatcg gggagccggg acagatggcc ggcaaggagc gcggcgaagc
   113161 ggtacctgca ggagaccaca aaaaggtggc tggaccaccg tgtcagcggg aaagagggag
   113221 gggggggatc aggaccagga ggggtggtgg tgctggagaa gggaaagacg gactcatcga
   113281 acaccacatg gcgagagatg aggacccgtc gggaggtaag gtcaaaacac cggtacccct
   113341 tgtgatccgg ggagtacccg aggaagacac aaagagtgga gcaggggtcc agcttgtggg
   113401 aagatgtggc agcggtgttg gggtaacacg cacacccaaa cacgcggagg tgatcgtacc
   113461 gaggaggggt accaaagagg gcgtggtgtg gcgtgggagc tggacaagca gcggaaggaa
   113521 gacggttgag gaggtaggtg gaggtgtgca agccctcagc ccagaagcga gcaggaagag
   113581 agacctgaaa cagaagggtg cgcacggtgt cgttagtggt gcgaatcatc cgctcagcct
   113641 tgccattctg cgaagaggta tatgggcaag acatgcgcaa ctgaacacca tgagagagaa
   113701 agaatgcccg ggaggtgaag ttatcaaact cacgaccatt gtcacactgg acggccttga
   113761 tggtgaggcc gaactatgtg gacacccaag tgaagaagtg aaggagcgtg ggaaacatat
   113821 cagacttcgc acggagggga aaactccatg aataatgcga aaaatcatca accaccacaa
   113881 gatagtactt ataaccagaa atactgataa caggagatgt ccataggtcg caatgtacaa
   113941 gatcaaaaat gcgggccgca tgggaagtag aactatgaaa aggaagacga acatgtcggc
   114001 ccaattggca cgcatgacac agttgctcat catgagcccg agtacatgga agaccagagc
   114061 tacgactgag ctgcatcagg gcatcacgtc caggatggcc gaggcgccgg tgccaagtag
   114121 tagagaaagt agaagcggcg aaagcagcta acaaaacgga cggcgaagaa gatgaagttg
   114181 cgccgggaag cgaagggtgt aaaggggccc ggtgctatca catcggagca gaggatgccg
   114241 ggaagccaaa tcctttacag taagaccaga agagtcaaat tccacagaac aggaattgtc
   114301 agttgtaaaa cgacgaatag aaagaaggtt gtgaaccata gaaggatcaa caagaacgct
   114361 aggaagatgg aaggagccat gagcaccggt ggtacccaca gacgtgaccg gaagacacga
   114421 accatttgcg accataatgg acgaaggaag agaagaagag ggagagtgga cagacgaaag
   114481 tataccaggg tcaggggtgg tgtggtaggt ggctcccgaa tcagcgatcc actcaggtcc
   114541 gacaggaggt gtcaggccca tagtgctgaa cgagcgagcc aaggccgcct ggtcccagcc
   114601 ggcaacccca ggtagggtgc cgaagggtgg agcccacggc atagcaggga aggtgccggg
   114661 aggtggagca ccaggcggag caccagtgaa catggccgcc ggtggacgag ggtcgccccc
   114721 gggagcgtgg aagggccaca tggagatgcg cccggaccac gggttctaga aggaaggcca
   114781 tggtgccccc ccctgtggcc cagccagtgc cggagcctag gtgagaccac cccggccgcc
   114841 cccgtgaccc cctccccggc aatgacgacc accacgaccc cccacccccg ctcggcccgg
   114901 agggaggggg acccaggaga gacggcggcg gtggagcgga cgaccgtggt ggagcagacg
   114961 gacacggcag cggagtagca gccaaagcca tcgaagaaga cgaggacccc ggagaagggc
   115021 cgaaccccgg ctggatgccc tgagtgagct cctccatgac aaggtcgtcg cggacctgca
   115081 ggaaggtggg gaagggccgc tgacgggtga tccacgtcct gaggtgggcg tagcggtcac
   115141 tgagcccgcg gaggacgttg aggaccagga tgcgatcctc catgggccag ccgaggtcac
   115201 caagggagtc cgccatggtc ttcatctgat gacagaactc gccgacggag aggtcgccct
   115261 ggacgaaggt gcggaagctc gcgtcgaggt gcagagcccg ggcctcggtg ttgcccagga
   115321 actgtccctc aagcgccagc caggcctggc gagcgtcagg ggagttgcgg acgaggtcgt
   115381 ggaagtcgag ggagatcgtc ccgatgatcc acgagaggac gatgctgtca aggcgtagcc
   115441 acgagggagt ctgagccgcg accgtggcat cggcgaggac gtggtcgtcg agggcgtagc
   115501 ggcggagggt gaggaggacc aggtcccgcc accgggcgta ggagggtgat tcgggcttga
   115561 gaaccactgg gacgaggagg cgaatgttct ggaccccccg gcctggtagt gaagctgagc
   115621 cacgagcggg tcggccgggt tgtgccagag gacggcggtg tgtgacacgc ggagtcccga
   115681 cgagtcagag gaggtggccc cagcgtcctg ggaggcggga gaggcgagga gctgctccgc
   115741 ctcggcgatc tgacgggcca gggcgtcggc cgcgtcgcgc tcaagctccc acgcaagggc
   115801 cgccgcgcgc acacgagcct gcccctccgt ggcggcagtc cgggcagcga tgagggctgc
   115861 ggcgagggcg gagtccggac ctggtgaagg agcagtgggg agagcacctg cggcaccacc
   115921 tccaagagga agagtcatcc ccccgagggc cagcagggga ggccagccga ggccggggcg
   115981 cactggatcc gccagggcgc cagcagcagt agtgggatcg acggctgggg gtggcgagcg
   116041 gatggccaag gcaccagcag cagcagtgga ttcggtggct gggggtggcg ggcggaccct
   116101 agacggcggc aggtggggtg gcgggcggat cccagatgac gtagtaggag gtggcggaag
   116161 aaagccaggc ggcggggaga aggagcggtc gccagagccc cctccccggc caccgcgacc
   116221 atgtcaggtg cgggagggga ggcgccgttg ccctaggccg cgggagtgac cgccatggcg
   116281 ccggcagtgg ccgccccctg agatccgacg gcgctaggag cgggtgagga agtaacctga
   116341 gcccaggatg gggagggaag gaaagggaaa taggtatagt aggagggagg agtagggggc
   116401 cggccatggc gccggtggcg gctggccagc tggcggtcca ggcggcggcg gctgagaggg
   116461 tgatggggag gaaaggttaa ccctaggctg ctgataccat gttagggaaa gtgtatctat
   116521 tgatttaggc taaccctaga agggtagcta tataggtaac catacatggg ccacatgggc
   116581 ctagccctat aggcctaata cacacacatt ccaacaagtg ggacggacgg tcattacgga
   116641 gttggacacg gatggatggg tcggagccag aatacttggg cttagctcaa tcgtgtttca
   116701 attacacact aataaggccc ataataaata atatctgcac taaattattt gtcgcgtatg
   116761 gaaaatcaag gagagattga ctcagtttaa ttaggtggcc attatcccgt atgaaaaatc
   116821 aaggagagat tgactcggtt taattaggtg gcttgtctat atctgttgta aatctatacc
   116881 taataataaa gaggcaatgc aaataatgtt ttttaattct aaactaagat aagaagagtg
   116941 atgttgagta atggtttttc aattccaaac taagaagagt gatgccgagt agttaaggga
   117001 gggccggacg aaaaaaatag ggggtgagaa attttgcctt tttattatta tactagtaaa
   117061 aatgcccgtg cgttgctacg ggggcgcatg gtttattgta tgattctcgg atatcactat
   117121 ctatctttat cgaatttatt aattaggctt aatccaagct taagcggcaa ggctcgggat
   117181 cggccggcat ggcggccaca tagcccgtgc ctcgccacga caatgccgcc catcaccgcg
   117241 acaactggag ccaccatcac atccaccacc accagaacca ttgcgcggcc ccgacctcgc
   117301 cttactctgc tgccatggcc attcacaatg aggatgcttc tgccgacaca gcctcgtggt
   117361 gctgaccctc tttaccaact aaaccaaaca caaaccacga tgaccctctt tacctgctaa
   117421 tagtagtaac aatggtacat ctctctagaa caagaaatct atttttcttt cttccagaga
   117481 ttttagattt ttttacggta cagtttttgt caatggtccc accgagtgct ttccagaatg
   117541 tactgcgtat gattaggagt cgagtgcttt tttttaccgg agatttttag tttgttcttt
   117601 tttccgatag agtttttttt ctctggtcca atctgtactt tccagaatct atgtacgagt
   117661 ctaatactat tttttttaga atctatgtac gagttcaatc ctttttcttt accggtgatt
   117721 tttttagatt tttttacaga gatttttttc ttccaatttt ctcctttgtt ttttctagag
   117781 tcccatccta tgtttttctt cggtagtttt cgtttttggg tctaccatgt tttccatagt
   117841 ccgatcgtat atttttttgg cgttagtttc tttttctgtc gtctctattc ttatttagtt
   117901 tagaatttct attcaggtta tttaaaatta gaatttattt ggagcaggag tcctaaccca
   117961 agaagtcttc catatgttct ataaaattag gaggacatgt tagatagatg gaggaggata
   118021 gttttcatgt tgggagttag ttcggaagag gtggaccaag caaatggatg gacgaaaaaa
   118081 agagcctgaa attttgtctc tttaggcagc ctgggctgca cggtgctgct cttcctcacc
   118141 aaaacagagc tcagtgcccg ccgacgatga tgtggatggg gtaggccaag tcatggtcga
   118201 cgtggacgta ctggccgagt tggagcttgt tggagagcac gtgatcggct tgcgcaagcg
   118261 ggtgcatgac gtacgtggag tgagaggcat cggagatcct gacgtagaac ttgtcatgca
   118321 tgggcaacag gtccttctca tccagatcca ctggaaagat gttcatcacc tgctgcaccg
   118381 ctgtccggta ctcgctcacg ggattggcga aacaggtctt catgccgtcc aggagcttca
   118441 cgaggacgct ggacgacagc ggcgtcatgt ttacactttg attcacagat ggtagtcacc
   118501 cctgtgcggc gaggcgagct tggccctcgt ggacggatga ggtgtgcggg tgacgagcgg
   118561 gtggtggccc aggagcagcc tggtgccgat gatgacgccg gtcttcatgc tatccaggag
   118621 cttcatgagg acgctggacg acagcagtgg catgtttaca cttggattcg cagccggcgg
   118681 tcacaatcta gttatgcaca acgattattc agaacttcaa atcaaatgaa agagaggaaa
   118741 tatttgtgct ttgaggagta tatttgattt cattatatag tgcacgatag aatcgagtct
   118801 taattggatc aggattgtta gagctaccaa caaacaaggc aaggaataaa agaatacagt
   118861 agtgcatgac cgtacatgta caagcaagga aggcaagctt gggccggaca tacacacaaa
   118921 gtacggaaga tttaaggagc tgccatgttc tattaggact ctaattggtg tggtcgccgt
   118981 tacttaaaac gtagacaaaa aagtttagat gtcggatatg tacaagcaag gaaggcaagc
   119041 ttgggctgca catacacaca atgcacgaca agatttaagg agctgccgtg ttctatttgg
   119101 actctaattg gtgcggttgc caacactaaa aatcatgttt tggtctcttg tacgcagata
   119161 tatatataaa taaaaaagtt tagatgtcgg attagaatta cgagtccatg tcacatacat
   119221 gaccctgtat attttgaaat cggattccat atcgcgctaa acaggagcta ttctaactca
   119281 tatgagcacg agttatatat atataagtct ggacggaaga aactctccat cgtctggtag
   119341 ttaaagggag acagaccaaa caaatggatg gacgaaaaaa agagcctgaa attttgcctc
   119401 tttattatta ggtatataga tatagattat taggtataga tctgatcacg tcaatcaaac
   119461 cttggctgca tgcggggata tatcacattg caatacaggg acaatttcga gttgtagcga
   119521 ccggcggtga gctctaaagc agcaaacaaa aacttcctga tgaaacaagg catacaaatt
   119581 cctactttta ctttcagttt ttttttagtc atcaatgacg tggcgccctc gctcgatcgg
   119641 ccgtgtatat atacgtgtcg tagtggcagt atctgagtat ctcacagact tacactgaga
   119701 gctagctagc taatataacc gcgagcggcc gacgaccgga caagatgagc gtgccgatcc
   119761 ccgggaaatc gtcgtggccg gagctgctgg gcgtgaatgc gacgctggcg gcgacggcga
   119821 tcgcccatga caggccggac gtggccgtgg aggtgctccc gccggggtcg ccggtcatcc
   119881 cggaccacaa ccccttgcgc gtccgcgtct tcatcgacaa caacaacctt gtctcccagg
   119941 tccccgtcat cggctagggc tctagtcctc aagctagcca ggcaccaggc gctgcacccg
   120001 gccagcagct ggttttgatg tttggagtca tgtgtgtgtc gtcgtcgtcg gctcgtcagt
   120061 catcacggtg ccgcgatcga gctgtgtgtg tgtgtgtggt gtgatggaat aaatactggc
   120121 tgctgttgcc tgcatggcct cgctctcggc tgggacatta tgtgtaccag tgagattacc
   120181 ggcaagtcat tcactactgt gctactggtg ttcaaacaat acttgtcttc tacctctcgc
   120241 tctctatgct tacgagagtt aacagattat cagtgatcgt aaacaaaacg aatgctattt
   120301 tcatttgtat tttgaacttg aatacagaaa aaaccgtatt atcaaggggg atgcaaattg
   120361 gcaagcttaa ggtaaattaa gtgctaacta cctatccaaa caaacagcta agtcccaagt
   120421 aaaaaccaaa gccagaaaag cttagctcct attctttctg tacttcatgg aagttcagtg
   120481 tttaagtgca gaacttccgt acttaacagt tgatcgtcta ataaaaaggg aaggagtaca
   120541 aatatactct ctcccccttc ctccccaatg gtcatctgca acattaccca ctcatctgac
   120601 catggatagc tctctcccac ccccaatgaa ggatccccaa cctctcccat tcattcttag
   120661 tgaaatccct ttgagaaatt ggatccagaa gtgagttaga gagcttgtga gcaaggtttt
   120721 cagatgttct tgcctcctag ctgttggttt gtgttcttgt tctcttggag ctcggcctct
   120781 catagatggc tagaggttac ctaggagttc ccaattggtt gtggttgagc actagaaagt
   120841 tcgaattgcc cttgtgaagg tagtgaaaac cctcaagctc gatgtttgtg gttcgcttga
   120901 gaagaggata tgagtagaaa aaatccaaag cctttgtgac ttcctcaaca atgaggatgt
   120961 agacatgcct tcactatgta acaaaaggtc atatccacta gtggcaccta cagacgccgg
   121021 acaaaagcgc gtctgtgata aaaaaattac agacgcgcat tacccaacag acgtctgtag
   121081 tagatcgccg accagggtca ccggcccggc ggggtcaaca tgcgtatgta ataacgggtt
   121141 gctacagacg cgtgtactta aggcgtgttt gtagtaatga aaacagtaca gacgtgtgac
   121201 tctgaacgtg cgtctatagc ttaatcctta ctgcaggcgc gtgatggcta aagacgcgtc
   121261 tatagtaagt aaaacagtac agacgcgtga ctctgaacgc gcgtctgtgc taggatctta
   121321 ccgcagacgg gtgcaggcta cagacgcatc tatagtaagt tattagtaca gacgcgttat
   121381 gctcaacgtg cgtctataga agactcttcc tacagactgg tgcaggctgt agatgcgtct
   121441 gttgtaagtc attagtacag acgcgtcacc ctaaacgcac atcagtagta tgtgcttatt
   121501 ataggcgtgc aaaaagcgcg tctgcattaa gcccttatta ccaagatgat cctgaacgca
   121561 cgtctgtgat gtgctttttt ttttacatag tgcttggtgg ctctgtacgt aaatcatgtg
   121621 tcttgtcatt tattgttgat aattttgtgc tatacctctt gtttgcatcc atattccagg
   121681 gttttcagcc aatctattcg tatagtgtgt tgtagctgca gggacttggt gctaagcgaa
   121741 gctcataccc ctaggaggct tggtatataa ctcaacctaa gtttagaccc tctattcaat
   121801 ttagttttta gctaggatgc gcagaacttc tgcgaatttg tccgaaactt ttgcaccgtg
   121861 gaagtttcgc cgaaatctac tgcagaacct tcacattttg ctaatccact gcatcgattt
   121921 taggttttta caagcctatt caccccctct aacccttgac tgatcctttc aataggtaac
   121981 cgagcactgc agaactcaca caggcctctt tacatggtct ggaagaccct gcttgaccca
   122041 aagtaggagc aaagggaaat tgttgcttgg gagcttcaaa gtctttccat gtcgccataa
   122101 catatgtttc agtcctaaaa acatctgcaa gctaggctaa aagataaaag aggaaaaagt
   122161 ggtgcattga aaatcataca agagattctt tcctgctaca cactcagttc accctggatc
   122221 tctttttgtc agagtgagaa agcaaaagag atagaagaat ctttacatcc atatgttgat
   122281 gcatttccat tgcaaaagtt caggccacat tgcatagtac tgcatgatgc atatgctagc
   122341 attgcattgc attgcattgc atgaggcaat acaaaaggtt acttgaggga gcacacgtac
   122401 tgtgataact gaatagtcat ctgttcatgt taatttgatc tgagctctta cacgtactgt
   122461 gtaatataat tagtagtagt aacggtggtc attggcagga gatgaaagct ttcccacttt
   122521 acccatgcat gataaggctg tgtcattgct cagcagtttc actcactatc aggccttaat
   122581 gcaggagtca gtgttagagt atatattagg atagatatgg tagattaaga tcgtataatc
   122641 tcggcttacc ttatatatct aagggagacc ttttgcaccc taagcaatgt acgactatat
   122701 aatccatcca caagacttag caatacagtt tttctattcc tccaatagtc aggcatgtag
   122761 ctgttccctg tcatgcatga gcatgcatgt aagaattttc tgaccactat tggttgtctc
   122821 tttgattatc tgtgccatgc atatatgttc attggaatac gggacattcg ccgtcaatag
   122881 gtcctgcggt cctaggcgac cggccggcaa cctctgacag caaacaaaag gttacctgat
   122941 gaaacgaggc agcctaaact ttccagcaaa gccaggcatc aggaatggcg tggcgccagg
   123001 ccgtgtgtac tcctatatat acacacgtgc gtgccgcacg cagaggtatc tctcagtatc
   123061 ttcgacggag tatctcacac agtacaccga tcgagctagc gctagtgagg agcgggcatg
   123121 atgcatgagc gtgccaatcc ccgggaagtc ggcgtggccg gagctgctgg gcaagcaggc
   123181 gacgctggcg gcgctagcga tcgcccacga caggccggac gtggtcgtgc aggtgctccc
   123241 gccggcctcg gcggtcatcc cgaagtacaa cgacgacgac aacggccttg tctcccaggt
   123301 ccccgtcatc ggatagccaa cccagctggt ttgtctggtg tcacgtgtgt catcgtcgtg
   123361 tcgttgccgt cgtctgttca tcacggtgtg ccatgatcga tcagatgtac gtgtgctatg
   123421 gtacacccaa ataactgtga accgtccact aaatttgatc ggatggttaa taacatctat
   123481 tacttcctag gaggtaatag atgaaatata tgtttattta atttttattt ggtaaagtag
   123541 gataggtaag gaaagtttta gatataaaaa tattttctta aatctaattg atgcatatgt
   123601 aatctgttgg aggcgataca tcttttacat gtaacgtgtt tttgttccaa acctctatgt
   123661 tcctatagat tttttttcat gcatctaacc tgttttttta atcgagcatg caacgtgtaa
   123721 gtatgtctag aagatgcagc aaacatatca tcattaggtg agtagcagag atcaaaccat
   123781 taacgtgaaa tggatcattc attggaattt gaatggagag agtgatcatc catgacgatg
   123841 catacattga tagtcatata taatatatat attgtgcacg actcatagct ttgattttta
   123901 ttttttattt tgaagagaag attgatcctt tgtaatgcta aaatgttcgt tgaatcttca
   123961 caggttagat cgtcacaaca atccaatact ttggtgccgg catgcacata aaaaaggaag
   124021 gattgattta gtccctcgcg agatttgttg cagggatttc tttccttttt ctcaggttat
   124081 tatttattta tttaattcat aaaatttgaa ttaatcaatg gctcagattt atttgagatt
   124141 ttacctctta gtaggtaatg ggtgtaccat agcattgcct gtatgtgtgt ggtgtaatgg
   124201 aataagacaa taatgtcgtc gtcgtctgtt catcacgctc cacttcagct gggacatgca
   124261 tgcatgtgtg ggaattggac aactacttgc tggtgttctt ctctgtttca agtacaaacc
   124321 aaagcataag gcttacacac gcatgaagaa acaaaagcaa ggttcagccc acatagtggg
   124381 cgcagcaaaa aaaaaagcag aaaaattagg cctcaatacc attcgagaag ttccatacaa
   124441 acttcgcaaa gacagccttg tttggatgca catacttttt gcaatcagat accactaatc
   124501 ctttatacaa caacgttttc ttcaacccct tgcgtgtccg tgtcatcatt gacaacaaca
   124561 accttgtctc ccaggtcccc gtcatcggct agggctctag gcctctagct agccaggcac
   124621 caggcgctgc tcccggccag aagctggttt tgatgtttgg agtcaagtgt gtcgtcgtcg
   124681 gcggcggcgg ctcgtcagta atcacggtgc cgcgatcgag ctgtgtgtgt ggtgtgatgg
   124741 aataaatgcc tcggagctct cgctattggt ttgtgttctt tttctcttgg agctcgggct
   124801 ctagacagct agaggttgcc tcgaagctcc cagtcggttg ttgttgaaca tcagaaagtt
   124861 tgtattgccc ttgtgaagct agtaaaaacc ctaagctcaa cctttgtggt tcccttgaga
   124921 agatggtagg gctagaagag acccaaagcc tttgtggctt cctcaataat gaggatgtag
   124981 acaagcctcg gtggctcttt tgaacctcag ggtaaatcat gcgtcttgtc ctttattttt
   125041 gttgatttga gctgtccctc ttgtttgatc catattctag ggtttccacc caatcctctt
   125101 gtatagcgtg ctgtagccgc aaggaattgg tgctaaggga agctcataca tctaggaggc
   125161 ttggtatttt gacctaactt tagaccctat tccagtcagc tgtagtagtt ttcagctagg
   125221 atcggatgcg cacattttgc caatctgctg tctcgagttt aggtttttta caagcctatt
   125281 caccctcttt taggccttgt ctgatccttt caactgctaa ccgatgtgag tgtaagcttg
   125341 ctgcaggtat gacgtggacg atgatgacgt ggagctaatg aggcgggagc tcgcgaacca
   125401 actcagtttg aattggagcg tgtgcagttg ccagcagcag aacgtggtga ccgcgcccac
   125461 ggcgagccct gtgtcaagca attacaatct gtctcctgtg tatcgtttgt cttttaaaat
   125521 ttgtgtgtgt gaaccatgtt cattagctat tggtataaat agtctgatgt aagaggagcg
   125581 tgttagcgtg tttggttggt tgtaaacctc attgtactca gtgtttgcta aagcgaaaag
   125641 gggtgctgtc accctagcgg ttcccgtgct gttcactgtg ttcatgcgcg ttcttgctgt
   125701 ttaggcctag ccagtttgat caatagtgct gtgattgtgt tcctgattct aacatttggt
   125761 atcagagcct taatcacacg ctaatcatca ctaattcata ccatgagcga gcggagtggg
   125821 agcggaggcg gtggcagtgg cgatcggatc cattatccac cgctcactgc aaccaactac
   125881 accagttgga gcatccgtgt ccaggcgatc atggaggatc agggggtgtg ggagatcatg
   125941 gagccgtcgg gggagacgtc ggggcaggat gccacggtgg ttgcgacggc gaaggcgaat
   126001 gaccggaagg cgaaggctca cctgctgcag tgcatccctg atgacctgct gatgcaagtg
   126061 gccgggcaga agacaggcaa ggaggtgtgg gatacactga aagctcgatt tgtaggtgaa
   126121 gaacgagtca aggaggcgcg gttgcagact ctgaagagcg agttcgatgc cttgaggatg
   126181 aaggaagggg actcgatcga ccactatgct ggacagttga cggggatgtc agtccggtat
   126241 agcaatttgg gtggatcact cgatgatcag gcacttgtga agaaactgtt cgatacagtg
   126301 cctgagcggt tcatccaagt ggtggcagga attgagcagt tctatgatct gaagaagctg
   126361 tcattcgcag aagcagttgg gtgattgaag gcttttgagg aacggatccg aagaggaggc
   126421 agtgtagtga agtcagagcc agggcaagct ctgctgactc aagcagaatg ggaggcttga
   126481 tagaagcgtg catccggaga aggatcatgg aagaacagat cccatgatgg tggtggagga
   126541 agccgtggta gagggagagg ccgaggcagc agtgctggag gtcgaggagg gcatggtgat
   126601 ggatctgtca agcgagataa gagccacatc aagtgtttca aatgccatca gtatgggcat
   126661 tatgcaaacc ggtgcccaag tgaagagaaa aaagatgaaa agaagaaaga agaggctcat
   126721 catgctagag cagtcgagtt cgagcccact gtgctgctag cagagacagg agtgatgggg
   126781 atgcaggagc agacaggggg aggaagtcta ttgtcggaaa accgtcagac tgagttgcat
   126841 ctgaatgagg tgaagatctt tccagaactg cattatacaa gcagtggtgg atcctgtgga
   126901 gaggtttggt acttggacaa tggtgcaagc aatcatatga caggagatct gcacaaattc
   126961 aaggacatcg actctactgt ctctggtaag gtaacttttg gtgatggctc aacagttgag
   127021 attcaaggta ggggtacaat tctgtttcag ggtttgtctg gtagtcagtg ggctttacat
   127081 gatgtttact acattcctaa gctcaaaagt aacttagtta gccttggtca gttaactgag
   127141 attggatata gaattttgat ggatgatgac ctgattgaag taacagaaaa gtactctgaa
   127201 agaatgataa tgaaagttca gagatcattg aacatattat ataagattga attgaactgt
   127261 gtagagccag tttgtctaaa gtctagtgtt gatgatgagt tatggctatg gcatggtaga
   127321 ctgggacatg ttaatttcaa ttccatgaga atgttggtag aaaaggagat ggcagggggt
   127381 ttaccactga tagagcatcc tgatcagctt tgtcagtcct gtttagcagc taagcaaact
   127441 aggagcccat ttcctaaaat gtcaagttgg agggcagatg aacctttaga gttggtacat
   127501 gttgatctgt gtggtcccat aacaccagag actgcaggag gcaataagta ctttatgctc
   127561 ttggttgatg actgtactag gtggatgaca gtgtcaattc tcaaaaccaa agatcaagct
   127621 agtg
//