LOCUS       KJ867558                1350 bp    cRNA    linear   VRL 15-JUN-2014
DEFINITION  Influenza A virus (A/reassortant/NIBRG-14(Viet Nam/1194/2004 x
            Puerto Rico/8/1934)(H5N1)) segment 6 neuraminidase (NA) gene,
            complete cds.
ACCESSION   KJ867558
VERSION     KJ867558.1
KEYWORDS    .
SOURCE      Influenza A virus (A/reassortant/NIBRG-14(Viet Nam/1194/2004 x
            Puerto Rico/8/1934)(H5N1))
  ORGANISM  Influenza A virus (A/reassortant/NIBRG-14(Viet Nam/1194/2004 x
            Puerto Rico/8/1934)(H5N1))
            Viruses; Riboviria; Orthornavirae; Negarnaviricota;
            Polyploviricotina; Insthoviricetes; Articulavirales;
            Orthomyxoviridae; Alphainfluenzavirus.
REFERENCE   1  (bases 1 to 1350)
  AUTHORS   Cardoso,F.M., Ibanez,L.I., Van den Hoecke,S., De Baets,S., Smet,A.,
            Roose,K., Schepens,B., Descamps,F.J., Fiers,W., Muyldermans,S.,
            Depicker,A. and Saelens,X.
  TITLE     Single domain antibodies targeting neuraminidase protect against an
            H5N1 influenza virus challenge
  JOURNAL   J. Virol. (2014) In press
   PUBMED   24829341
  REMARK    Publication Status: Available-Online prior to print
REFERENCE   2  (bases 1 to 1350)
  AUTHORS   Van den Hoecke,S., Ibanez,L.I., De Baets,S., Smet,A., Roose,K.,
            Schepens,B., Descamps,F.J., Fiers,W., Muyldermans,S., Depicker,A.
            and Saelens,X.
  TITLE     Direct Submission
  JOURNAL   Submitted (22-MAY-2014) Inflammation Research Center, VIB - UGent,
            Technologiepark 927, Zwijnaarde, Oost-Vlaanderen 9052, Belgium
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..1350
                     /organism="Influenza A virus (A/reassortant/NIBRG-14(Viet
                     Nam/1194/2004 x Puerto Rico/8/1934)(H5N1))"
                     /mol_type="viral cRNA"
                     /strain="A/reassortant/NIBRG-14(Viet Nam/1194/2004 x
                     Puerto Rico/8/1934)"
                     /serotype="H5N1"
                     /db_xref="taxon:664713"
                     /segment="6"
                     /clone="N1-H5-VHHm escape mutant"
                     /note="single domain antibody N1-5-VHHm escape mutant of
                     mouse-adapted NIBRG-14"
     gene            1..1350
                     /gene="NA"
     CDS             1..1350
                     /gene="NA"
                     /codon_start=1
                     /product="neuraminidase"
                     /protein_id="AIC64885.1"
                     /translation="MNPNQKIITIGSICMVTGIVSLMLQIGNMISIWVSHSIHTGNQH
                     QSEPISNTNLLTEKAVASVKLAGNSSLCPINGWAVYSKDNSIRIGSKGDVFVIREPFI
                     SCSHLECRTFFLTQGALLNDKHSNGTVKDRSPHRTLMSCPVGEAPSPYNSRFESVAWS
                     ASACHDGTSWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSC
                     FTVMTDGPSNGQASHKIFKMEKGKVVKSVELDAPNYHYEECSCYPDAGEITCVCRDNW
                     HGSNRPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPVSSNGAGGVKGFSFKYG
                     NGVWIGRTKSTNSRSGFEMIWDPNGWTETDSSFSVKQDIVAITDWSGYSGSFVQHPEL
                     TGLDCIRPCFWVELIRGRPKESTTWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK"
BASE COUNT          397 a          250 c          346 g          357 t
ORIGIN      
        1 atgaatccaa atcagaagat aataaccatc ggatcaatct gtatggtaac tggaatagtt
       61 agcttaatgt tacaaattgg gaacatgatc tcaatatggg tcagtcattc aattcacaca
      121 gggaatcaac accaatctga accaatcagc aatactaatt tgcttactga gaaagctgtg
      181 gcttcagtaa aattagcagg caattcatct ctttgcccca ttaacggatg ggctgtatac
      241 agtaaggaca acagtataag gatcggttcc aagggggatg tgtttgttat aagagagccg
      301 ttcatctcat gctcccactt ggaatgcaga actttctttt tgactcaggg agccttgctg
      361 aatgacaagc actccaatgg gactgtcaaa gacagaagcc ctcacagaac attaatgagt
      421 tgtcctgtgg gtgaggctcc ctccccatat aactcaaggt ttgagtctgt tgcttggtca
      481 gcaagtgctt gccatgatgg caccagttgg ttgacaattg gaatttctgg cccagacaat
      541 ggggcggtgg ctgtattgaa atacaatggc ataataacag acactatcaa gagttggagg
      601 aacaacatac tgagaactca agagtctgaa tgtgcatgtg taaatggttc ttgctttact
      661 gtaatgactg acggaccaag taatggtcag gcatcacata agatcttcaa aatggaaaaa
      721 gggaaggtgg ttaaatcagt cgaattggat gctcctaatt atcactatga ggaatgctcc
      781 tgttatcctg atgccggcga aatcacatgt gtgtgcaggg ataattggca tggttcaaat
      841 cggccatggg tatctttcaa tcaaaatttg gagtatcaaa taggatatat atgcagtgga
      901 gttttcggag acaatccacg ccccaatgat ggaacaggta gttgtggtcc ggtgtcctct
      961 aacggggcag gtggggtaaa agggttttca tttaaatacg gcaatggtgt ctggatcggg
     1021 agaaccaaaa gcactaattc caggagcggc ttcgaaatga tttgggatcc aaatgggtgg
     1081 actgaaacgg acagcagctt ttcagtgaaa caagatatcg tagcaataac tgattggtca
     1141 ggatatagcg ggagttttgt ccagcatcca gagctgacag gactagattg cataagacct
     1201 tgtttctggg ttgagttgat cagagggcgg cccaaagaga gcacaacttg gactagtggg
     1261 agcagcatat ctttttgtgg tgtaaatagt gacactgtgg gttggtcttg gccagacggt
     1321 gctgagttgc cattcaccat tgacaagtag
//