LOCUS HIVHXB2CG 9719 bp RNA linear VRL 21-OCT-2002
DEFINITION Human immunodeficiency virus type 1 (HXB2), complete genome;
HIV1/HTLV-III/LAV reference genome.
ACCESSION K03455 M38432
VERSION K03455.1
KEYWORDS TAR protein; acquired immune deficiency syndrome; complete genome;
env protein; gag protein; long terminal repeat (LTR); pol protein;
polyprotein; proviral gene; reverse transcriptase; transactivator.
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1
Viruses; Riboviria; Pararnavirae; Artverviricota; Revtraviricetes;
Ortervirales; Retroviridae; Orthoretrovirinae; Lentivirus.
REFERENCE 1 (sites)
AUTHORS van Beveren,C.P., Coffin,J. and Hughes,S.
TITLE Appendix B: HTLV-3/LAV genome
JOURNAL (in) Weiss,R.L., Teich,N., Varmus,H. and Coffin,J. (Eds.);
RNA TUMOR VIRUSES, SECOND EDITION, 2, Vol. 2: 1102-1123;
Cold Spring Harbor Laboratory, Cold Spring Harbor (1985)
REFERENCE 2 (bases 493 to 674; 9577 to 9718)
AUTHORS Ratner,L., Haseltine,W., Patarca,R., Livak,K.J., Starcich,B.,
Josephs,S.F., Doran,E.R., Rafalski,J.A., Whitehorn,E.A.,
Baumeister,K., Ivanoff,L., Petteway,S.R. Jr., Pearson,M.L.,
Lautenberger,J.A., Papas,T.S., Ghrayeb,J., Chang,N.T., Gallo,R.C.
and Wong-Staal,F.
TITLE Complete nucleotide sequence of the AIDS virus, HTLV-III
JOURNAL Nature 313 (6000), 277-284 (1985)
PUBMED 2578615
REFERENCE 3 (bases 1 to 653)
AUTHORS Starcich,B., Ratner,L., Josephs,S.F., Okamoto,T., Gallo,R.C. and
Wong-Staal,F.
TITLE Characterization of long terminal repeat sequences of HTLV-III
JOURNAL Science 227 (4686), 538-540 (1985)
PUBMED 2981438
REFERENCE 4 (sites)
AUTHORS Allan,J.S., Coligan,J.E., Barin,F., McLane,M.F., Sodroski,J.G.,
Rosen,C.A., Haseltine,W.A., Lee,T.H. and Essex,M.
TITLE Major glycoprotein antigens that induce antibodies in AIDS patients
are encoded by HTLV-III
JOURNAL Science 228 (4703), 1091-1094 (1985)
PUBMED 2986290
REFERENCE 5 (sites)
AUTHORS Rosen,C.A., Sodroski,J.G. and Haseltine,W.A.
TITLE The location of cis-acting regulatory sequences in the human T cell
lymphotropic virus type III (HTLV-III/LAV) long terminal repeat
JOURNAL Cell 41 (3), 813-823 (1985)
PUBMED 2988790
REFERENCE 6 (sites)
AUTHORS Arya,S.K., Guo,C., Josephs,S.F. and Wong-Staal,F.
TITLE Trans-activator gene of human T-lymphotropic virus type III
(HTLV-III)
JOURNAL Science 229 (4708), 69-73 (1985)
PUBMED 2990040
REFERENCE 7 (sites)
AUTHORS Sodroski,J., Patarca,R., Rosen,C., Wong-Staal,F. and Haseltine,W.
TITLE Location of the trans-activating region on the genome of human
T-cell lymphotropic virus type III
JOURNAL Science 229 (4708), 74-77 (1985)
PUBMED 2990041
REFERENCE 8 (sites)
AUTHORS Rabson,A.B., Daugherty,D.F., Venkatesan,S., Boulukos,K.E.,
Benn,S.I., Folks,T.M., Feorino,P. and Martin,M.A.
TITLE Transcription of novel open reading frames of AIDS retrovirus
during infection of lymphocytes
JOURNAL Science 229 (4720), 1388-1390 (1985)
PUBMED 2994220
REFERENCE 9 (sites)
AUTHORS Allan,J.S., Coligan,J.E., Lee,T.H., McLane,M.F., Kanki,P.J.,
Groopman,J.E. and Essex,M.
TITLE A new HTLV-III/LAV encoded antigen detected by antibodies from AIDS
patients
JOURNAL Science 230 (4727), 810-813 (1985)
PUBMED 2997921
REFERENCE 10 (sites)
AUTHORS Rosen,C.A., Sodroski,J.G., Goh,W.C., Dayton,A.I., Lippke,J. and
Haseltine,W.A.
TITLE Post-transcriptional regulation accounts for the trans-activation
of the human T-lymphotropic virus type III
JOURNAL Nature 319 (6054), 555-559 (1986)
PUBMED 3003584
REFERENCE 11 (sites)
AUTHORS di Marzo Veronese,F., Copeland,T.D., DeVico,A.L., Rahman,R.,
Oroszlan,S., Gallo,R.C. and Sarngadharan,M.G.
TITLE Characterization of highly immunogenic p66/p51 as the reverse
transcriptase of HTLV-III/LAV
JOURNAL Science 231 (4743), 1289-1291 (1986)
PUBMED 2418504
REFERENCE 12 (sites)
AUTHORS Kramer,R.A., Schaber,M.D., Skalka,A.M., Ganguly,K., Wong-Staal,F.
and Reddy,E.P.
TITLE HTLV-III gag protein is processed in yeast cells by the virus
pol-protease
JOURNAL Science 231 (4745), 1580-1584 (1986)
PUBMED 2420008
REFERENCE 13 (sites)
AUTHORS Dayton,A.I., Sodroski,J.G., Rosen,C.A., Goh,W.C. and Haseltine,W.A.
TITLE The trans-activator gene of the human T cell lymphotropic virus
type III is required for replication
JOURNAL Cell 44 (6), 941-947 (1986)
PUBMED 2420471
REFERENCE 14 (sites)
AUTHORS Lee,T.H., Coligan,J.E., Allan,J.S., McLane,M.F., Groopman,J.E. and
Essex,M.
TITLE A new HTLV-III/LAV protein encoded by a gene found in cytopathic
retroviruses
JOURNAL Science 231 (4745), 1546-1549 (1986)
PUBMED 3006243
REFERENCE 15 (sites)
AUTHORS Sodroski,J., Goh,W.C., Rosen,C., Tartar,A., Portetelle,D., Burny,A.
and Haseltine,W.
TITLE Replicative and cytopathic potential of HTLV-III/LAV with sor gene
deletions
JOURNAL Science 231 (4745), 1549-1553 (1986)
PUBMED 3006244
REFERENCE 16 (sites)
AUTHORS Kan,N.C., Franchini,G., Wong-Staal,F., DuBois,G.C., Robey,W.G.,
Lautenberger,J.A. and Papas,T.S.
TITLE Identification of HTLV-III/LAV sor gene product and detection of
antibodies in human sera
JOURNAL Science 231 (4745), 1553-1555 (1986)
PUBMED 3006245
REFERENCE 17 (sites)
AUTHORS Arya,S.K. and Gallo,R.C.
TITLE Three novel genes of human T-lymphotropic virus type III: immune
reactivity of their products with sera from acquired immune
deficiency syndrome patients
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 83 (7), 2209-2213 (1986)
PUBMED 3008154
REFERENCE 18 (sites)
AUTHORS Jones,K.A., Kadonaga,J.T., Luciw,P.A. and Tjian,R.
TITLE Activation of the AIDS retrovirus promoter by the cellular
transcription factor, Sp1
JOURNAL Science 232 (4751), 755-759 (1986)
PUBMED 3008338
REFERENCE 19 (sites)
AUTHORS Sodroski,J., Goh,W.C., Rosen,C., Dayton,A., Terwilliger,E. and
Haseltine,W.
TITLE A second post-transcriptional trans-activator gene required for
HTLV-III replication
JOURNAL Nature 321 (6068), 412-417 (1986)
PUBMED 3012355
REFERENCE 20 (sites)
AUTHORS Starcich,B.R., Hahn,B.H., Shaw,G.M., McNeely,P.D., Modrow,S.,
Wolf,H., Parks,E.S., Parks,W.P., Josephs,S.F., Gallo,R.C. and
Wong-Staal,F.
TITLE Identification and characterization of conserved and variable
regions in the envelope gene of HTLV-III/LAV, the retrovirus of
AIDS
JOURNAL Cell 45 (5), 637-648 (1986)
PUBMED 2423250
REFERENCE 21 (sites)
AUTHORS Willey,R.L., Rutledge,R.A., Dias,S., Folks,T., Theodore,T.,
Buckler,C.E. and Martin,M.A.
TITLE Identification of conserved and divergent domains within the
envelope gene of the acquired immunodeficiency syndrome retrovirus
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 83 (14), 5038-5042 (1986)
PUBMED 3014529
REFERENCE 22 (bases 8761 to 9060)
AUTHORS Fisher,A.G., Ratner,L., Mitsuya,H., Marselle,L.M., Harper,M.E.,
Broder,S., Gallo,R.C. and Wong-Staal,F.
TITLE Infectious mutants of HTLV-III with changes in the 3' region and
markedly reduced cytopathic effects
JOURNAL Science 233 (4764), 655-659 (1986)
PUBMED 3014663
REFERENCE 23 (sites)
AUTHORS Feinberg,M.B., Jarrett,R.F., Aldovini,A., Gallo,R.C. and
Wong-Staal,F.
TITLE HTLV-III expression and production involve complex regulation at
the levels of splicing and translation of viral RNA
JOURNAL Cell 46 (6), 807-817 (1986)
PUBMED 3638988
REFERENCE 24 (sites)
AUTHORS Lightfoote,M.M., Coligan,J.E., Folks,T.M., Fauci,A.S., Martin,M.A.
and Venkatesan,S.
TITLE Structural characterization of reverse transcriptase and
endonuclease polypeptides of the acquired immunodeficiency syndrome
retrovirus
JOURNAL J. Virol. 60 (2), 771-775 (1986)
PUBMED 2430111
REFERENCE 25 (sites)
AUTHORS Terwilliger,E., Sodroski,J.G., Rosen,C.A. and Haseltine,W.A.
TITLE Effects of mutations within the 3' orf open reading frame region of
human T-cell lymphotropic virus type III (HTLV-III/LAV) on
replication and cytopathogenicity
JOURNAL J. Virol. 60 (2), 754-760 (1986)
PUBMED 3490583
REFERENCE 26 (sites)
AUTHORS Wright,C.M., Felber,B.K., Paskalis,H. and Pavlakis,G.N.
TITLE Expression and characterization of the trans-activator of
HTLV-III/LAV virus
JOURNAL Science 234 (4779), 988-992 (1986)
PUBMED 3490693
REFERENCE 27 (sites)
AUTHORS Patarca,R., Heath,C., Goldenberg,G.J., Rosen,C.A., Sodroski,J.G.,
Haseltine,W.A. and Hansen,U.M.
TITLE Transcription directed by the HIV long terminal repeat in vitro
JOURNAL AIDS Res. Hum. Retroviruses 3 (1), 41-55 (1987)
PUBMED 3040054
REFERENCE 28 (bases 1 to 9635)
AUTHORS Ratner,L., Fisher,A., Jagodzinski,L.L., Mitsuya,H., Liou,R.S.,
Gallo,R.C. and Wong-Staal,F.
TITLE Complete nucleotide sequences of functional clones of the AIDS
virus
JOURNAL AIDS Res. Hum. Retroviruses 3 (1), 57-69 (1987)
PUBMED 3040055
REFERENCE 29 (sites)
AUTHORS Wong-Staal,F., Chanda,P.K. and Ghrayeb,J.
TITLE Human immunodeficiency virus: the eighth gene
JOURNAL AIDS Res. Hum. Retroviruses 3 (1), 33-39 (1987)
PUBMED 3476127
REFERENCE 30 (sites)
AUTHORS Modrow,S., Hahn,B.H., Shaw,G.M., Gallo,R.C., Wong-Staal,F. and
Wolf,H.
TITLE Computer-assisted analysis of envelope protein sequences of seven
human immunodeficiency virus isolates: prediction of antigenic
epitopes in conserved and variable regions
JOURNAL J. Virol. 61 (2), 570-578 (1987)
PUBMED 2433466
REFERENCE 31 (sites)
AUTHORS Goh,W.C., Sodroski,J.G., Rosen,C.A. and Haseltine,W.A.
TITLE Expression of the art gene protein of human T-lymphotropic virus
type III (HTLV-III/LAV) in bacteria
JOURNAL J. Virol. 61 (2), 633-637 (1987)
PUBMED 3543401
REFERENCE 32 (sites)
AUTHORS Muesing,M.A., Smith,D.H. and Capon,D.J.
TITLE Regulation of mRNA accumulation by a human immunodeficiency virus
trans-activator protein
JOURNAL Cell 48 (4), 691-701 (1987)
PUBMED 3643816
REFERENCE 33 (sites)
AUTHORS Nabel,G. and Baltimore,D.
TITLE An inducible transcription factor activates expression of human
immunodeficiency virus in T cells
JOURNAL Nature 326 (6114), 711-713 (1987)
PUBMED 3031512
REMARK Erratum:[Nature 1990 Mar 8;344(6262):178]
REFERENCE 34 (sites)
AUTHORS Fisher,A.G., Ensoli,B., Ivanoff,L., Chamberlain,M., Petteway,S.,
Ratner,L., Gallo,R.C. and Wong-Staal,F.
TITLE The sor gene of HIV-1 is required for efficient virus transmission
in vitro
JOURNAL Science 237 (4817), 888-893 (1987)
PUBMED 3497453
REFERENCE 35 (bases 6225 to 8795)
AUTHORS Reitz,M.S. Jr., Wilson,C., Naugle,C., Gallo,R.C. and
Robert-Guroff,M.
TITLE Generation of a neutralization-resistant variant of HIV-1 is due to
selection for a point mutation in the envelope gene
JOURNAL Cell 54 (1), 57-63 (1988)
PUBMED 2838179
REFERENCE 36 (bases 790 to 2292)
AUTHORS Pal,R., Reitz,M.S. Jr., Tschachler,E., Gallo,R.C.,
Sarngadharan,M.G. and Veronese,F.D.
TITLE Myristoylation of gag proteins of HIV-1 plays an important role in
virus assembly
JOURNAL AIDS Res. Hum. Retroviruses 6 (6), 721-730 (1990)
PUBMED 2194551
REFERENCE 37 (sites)
AUTHORS Ido,E., Han,H.P., Kezdy,F.J. and Tang,J.
TITLE Kinetic studies of human immunodeficiency virus type 1 protease and
its active-site hydrogen bond mutant A28S
JOURNAL J. Biol. Chem. 266 (36), 24359-24366 (1991)
PUBMED 1761538
COMMENT On Mar 25, 1997 this sequence version replaced gi:327742.
[6] sites; tat mRNA and other transcript boundaries. [7] sites;
tat mRNA.
[8] sites; mRNA splice sites.
[9] sites; 27K antigen cds.
[5] sites; gp160 and gp120 coding sequences.
[1] sites; regulatory sequences in the LTR.
[(in) Weiss,R., Teich,N., Varmus,H. and Coffin,J. (Eds.);RNA Tumor
Viruses, Secon] review; bases 1 to 9718.
[15] sites; trans-activator function and TAR sequence. [19]
sites; pol coding sequence.
[22] sites; 23K sor gene product.
[23] sites; pol NH2-terminal region.
[20] sites; sor 23K protein.
[21] sites; sor 23K protein.
[24] sites; Sp1 binding sites in the promoter region. [17] sites;
acceptor and donor splice sites for tat and 27K. [10] sites;
deletion mutants in the tat gene.
[18] sites; env gene conserved/varable regions; separate entries.
[16] sites; trs cds boundaries.
[12] sites; trs cds boundaries.
[11] sites; env gene conserved/variable regions; separate entries.
[26] sites; tar or transactivator target.
[13] sites; 3' orf mutations.
[14] sites; pol p34 terminus.
[31] sites; promoter, TAR, tat-III mutants.
[32] sites; envelope protein epitopes.
[33] sites; trs/art protein.
[34] sites; inducible enhancer element.
[27] revises [30].
[29] sites; long terminal repeat.
[28] sites; R orf.
[35] sites; sor.
Sequence for [25] kindly provided in computer-readable form by
L.Ratner, 19-AUG-1986.
The HXB2 sequence is being used as a reference genome for all the
HIV entries because it has been derived from a demonstrably
infectious clone. Hence not all of the 'sites' references above
were concerned with this isolate.
FEATURES Location/Qualifiers
source 1..9719
/organism="Human immunodeficiency virus 1"
/proviral
/mol_type="genomic RNA"
/isolate="HXB2"
/db_xref="taxon:11676"
/note="HTLV-III/LAV"
repeat_region 1..634
/note="5' LTR"
/rpt_type=long_terminal_repeat
repeat_region 454..551
/note="R repeat 5' copy"
mRNA 455..9635
/product="HXB2 genomic mRNA"
prim_transcript 455..9635
/note="tat, trs, 27K subgenomic mRNA"
intron 744..5777
/note="tat, trs, 27K mRNA intron 1"
CDS 790..2292
/note="gag polyprotein"
/codon_start=1
/protein_id="AAB50258.1"
/translation="MGARASVLSGGELDRWEKIRLRPGGKKKYKLKHIVWASRELERF
AVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTVATLYCVHQRIEIKDTKEALD
KIEEEQNKSKKKAQQAAADTGHSNQVSQNYPIVQNIQGQMVHQAISPRTLNAWVKVVE
EKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRVHPV
HAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTNNPPIPVGEIYKRWIILGLNKIVRM
YSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTIL
KALGPAATLEEMMTACQGVGGPGHKARVLAEAMSQVTNSATIMMQRGNFRNQRKIVKC
FNCGKEGHTARNCRAPRKKGCWKCGKEGHQMKDCTERQANFLGKIWPSYKGRPGNFLQ
SRPEPTAPPEESFRSGVETTTPPQKQEPIDKELYPLTSLRSLFGNDPSSQ"
CDS 2358..5096
/note="pol polyprotein (NH2-terminus uncertain)"
/codon_start=1
/protein_id="AAB50259.1"
/translation="MSLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGP
TPVNIIGRNLLTQIGCTLNFPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEIC
TEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPH
PAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWK
GSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRW
GLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQI
YPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAE
IQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKT
PKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDG
AANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYA
LGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRKVL
FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSP
GIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTD
NGSNFTGATVRAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKT
AVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRN
PLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED"
CDS 5041..5619
/note="sor 23K protein"
/codon_start=1
/protein_id="AAB50260.1"
/translation="MENRWQVMIVWQVDRMRIRTWKSLVKHHMYVSGKARGWFYRHHY
ESPHPRISSEVHIPLGDARLVITTYWGLHTGERDWHLGQGVSIEWRKKRYSTQVDPEL
ADQLIHLYYFDCFSDSAIRKALLGHIVSPRCEYQAGHNKVGSLQYLALAALITPKKIK
PPLPSVTKLTEDRWNKPQKTKGHRGSHTMNGH"
CDS 5559..5795
/note="R (ORF) protein"
/codon_start=1
/protein_id="AAB50261.1"
/translation="MEQAPEDQGPQREPHNEWTLELLEELKNEAVRHFPRIWLHGLGQ
HIYETYGDTWAGVEAIIRILQQLLFIHFQNWVST"
CDS join(5831..6045,8379..8424)
/note="tat protein"
/codon_start=1
/protein_id="AAB50256.1"
/translation="MEPVDPRLEPWKHPGSQPKTACTNCYCKKCCFHCQVCFITKALG
ISYGRKKRRQRRRAHQNSQTHQASLSKQPTSQPRGDPTGPKE"
exon 5831..6045
/note="tat protein, first expressed exon"
/number=2
CDS join(5970..6045,8379..8653)
/note="trs protein"
/codon_start=1
/protein_id="AAB50257.1"
/translation="MAGRSGDSDEELIRTVRLIKLLYQSNPPPNPEGTRQARRNRRRR
WRERQRQIHSISERILGTYLGRSAEPVPLQLPPLERLTLDCNEDCGTSGTQGVGSPQI
LVESPTVLESGTKE"
exon 5970..6045
/note="trs protein, first expressed exon"
/number=2
intron 6046..8378
/note="tat, trs, 27K mRNA intron 2"
CDS 6225..8795
/note="envelope polyprotein"
/codon_start=1
/protein_id="AAB50262.1"
/translation="MRVKEKYQHLWRWGWRWGTMLLGMLMICSATEKLWVTVYYGVPV
WKEATTTLFCASDAKAYDTEVHNVWATHACVPTDPNPQEVVLVNVTENFNMWKNDMVE
QMHEDIISLWDQSLKPCVKLTPLCVSLKCTDLKNDTNTNSSSGRMIMEKGEIKNCSFN
ISTSIRGKVQKEYAFFYKLDIIPIDNDTTSYKLTSCNTSVITQACPKVSFEPIPIHYC
APAGFAILKCNNKTFNGTGPCTNVSTVQCTHGIRPVVSTQLLLNGSLAEEEVVIRSVN
FTDNAKTIIVQLNTSVEINCTRPNNNTRKRIRIQRGPGRAFVTIGKIGNMRQAHCNIS
RAKWNNTLKQIASKLREQFGNNKTIIFKQSSGGDPEIVTHSFNCGGEFFYCNSTQLFN
STWFNSTWSTEGSNNTEGSDTITLPCRIKQIINMWQKVGKAMYAPPISGQIRCSSNIT
GLLLTRDGGNSNNESEIFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPTKAKRRVVQR
EKRAVGIGALFLGFLGAAGSTMGAASMTLTVQARQLLSGIVQQQNNLLRAIEAQQHLL
QLTVWGIKQLQARILAVERYLKDQQLLGIWGCSGKLICTTAVPWNASWSNKSLEQIWN
HTTWMEWDREINNYTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWFNITNWLWYI
KLFIMIVGGLVGLRIVFAVLSIVNRVRQGYSPLSFQTHLPTPRGPDRPEGIEEEGGER
DRDRSIRLVNGSLALIWDDLRSLCLFSYHRLRDLLLIVTRIVELLGRRGWEALKYWWN
LLQYWSQELKNSAVSLLNATAIAVAEGTDRVIEVVQGACRAIRHIPRRIRQGLERILL
"
exon 8379..8652
/note="trs protein"
/number=3
exon 8379..8424
/note="tat protein"
/number=3
CDS 8797..9168
/note="27K protein (premature termination)"
/codon_start=1
/protein_id="AAB50263.1"
/translation="MGGKWSKSSVIGWPTVRERMRRAEPAADRVGAASRDLEKHGAIT
SSNTAATNAACAWLEAQEEEEVGFPVTPQVPLRPMTYKAAVDLSHFLKEKGGLEGLIH
SQRRQDILDLWIYHTQGYFPD"
repeat_region 9086..9719
/note="3' LTR"
/rpt_type=long_terminal_repeat
repeat_region 9540..9636
/note="R repeat 3' copy"
regulatory 9612..9617
/regulatory_class="polyA_signal_sequence"
/note="HXB2 mRNA polyadenyation signal"
BASE COUNT 3411 a 1772 c 2373 g 2163 t
ORIGIN
1 tggaagggct aattcactcc caacgaagac aagatatcct tgatctgtgg atctaccaca
61 cacaaggcta cttccctgat tagcagaact acacaccagg gccagggatc agatatccac
121 tgacctttgg atggtgctac aagctagtac cagttgagcc agagaagtta gaagaagcca
181 acaaaggaga gaacaccagc ttgttacacc ctgtgagcct gcatggaatg gatgacccgg
241 agagagaagt gttagagtgg aggtttgaca gccgcctagc atttcatcac atggcccgag
301 agctgcatcc ggagtacttc aagaactgct gacatcgagc ttgctacaag ggactttccg
361 ctggggactt tccagggagg cgtggcctgg gcgggactgg ggagtggcga gccctcagat
421 cctgcatata agcagctgct ttttgcctgt actgggtctc tctggttaga ccagatctga
481 gcctgggagc tctctggcta actagggaac ccactgctta agcctcaata aagcttgcct
541 tgagtgcttc aagtagtgtg tgcccgtctg ttgtgtgact ctggtaacta gagatccctc
601 agaccctttt agtcagtgtg gaaaatctct agcagtggcg cccgaacagg gacctgaaag
661 cgaaagggaa accagaggag ctctctcgac gcaggactcg gcttgctgaa gcgcgcacgg
721 caagaggcga ggggcggcga ctggtgagta cgccaaaaat tttgactagc ggaggctaga
781 aggagagaga tgggtgcgag agcgtcagta ttaagcgggg gagaattaga tcgatgggaa
841 aaaattcggt taaggccagg gggaaagaaa aaatataaat taaaacatat agtatgggca
901 agcagggagc tagaacgatt cgcagttaat cctggcctgt tagaaacatc agaaggctgt
961 agacaaatac tgggacagct acaaccatcc cttcagacag gatcagaaga acttagatca
1021 ttatataata cagtagcaac cctctattgt gtgcatcaaa ggatagagat aaaagacacc
1081 aaggaagctt tagacaagat agaggaagag caaaacaaaa gtaagaaaaa agcacagcaa
1141 gcagcagctg acacaggaca cagcaatcag gtcagccaaa attaccctat agtgcagaac
1201 atccaggggc aaatggtaca tcaggccata tcacctagaa ctttaaatgc atgggtaaaa
1261 gtagtagaag agaaggcttt cagcccagaa gtgataccca tgttttcagc attatcagaa
1321 ggagccaccc cacaagattt aaacaccatg ctaaacacag tggggggaca tcaagcagcc
1381 atgcaaatgt taaaagagac catcaatgag gaagctgcag aatgggatag agtgcatcca
1441 gtgcatgcag ggcctattgc accaggccag atgagagaac caaggggaag tgacatagca
1501 ggaactacta gtacccttca ggaacaaata ggatggatga caaataatcc acctatccca
1561 gtaggagaaa tttataaaag atggataatc ctgggattaa ataaaatagt aagaatgtat
1621 agccctacca gcattctgga cataagacaa ggaccaaagg aaccctttag agactatgta
1681 gaccggttct ataaaactct aagagccgag caagcttcac aggaggtaaa aaattggatg
1741 acagaaacct tgttggtcca aaatgcgaac ccagattgta agactatttt aaaagcattg
1801 ggaccagcgg ctacactaga agaaatgatg acagcatgtc agggagtagg aggacccggc
1861 cataaggcaa gagttttggc tgaagcaatg agccaagtaa caaattcagc taccataatg
1921 atgcagagag gcaattttag gaaccaaaga aagattgtta agtgtttcaa ttgtggcaaa
1981 gaagggcaca cagccagaaa ttgcagggcc cctaggaaaa agggctgttg gaaatgtgga
2041 aaggaaggac accaaatgaa agattgtact gagagacagg ctaatttttt agggaagatc
2101 tggccttcct acaagggaag gccagggaat tttcttcaga gcagaccaga gccaacagcc
2161 ccaccagaag agagcttcag gtctggggta gagacaacaa ctccccctca gaagcaggag
2221 ccgatagaca aggaactgta tcctttaact tccctcaggt cactctttgg caacgacccc
2281 tcgtcacaat aaagataggg gggcaactaa aggaagctct attagataca ggagcagatg
2341 atacagtatt agaagaaatg agtttgccag gaagatggaa accaaaaatg atagggggaa
2401 ttggaggttt tatcaaagta agacagtatg atcagatact catagaaatc tgtggacata
2461 aagctatagg tacagtatta gtaggaccta cacctgtcaa cataattgga agaaatctgt
2521 tgactcagat tggttgcact ttaaattttc ccattagccc tattgagact gtaccagtaa
2581 aattaaagcc aggaatggat ggcccaaaag ttaaacaatg gccattgaca gaagaaaaaa
2641 taaaagcatt agtagaaatt tgtacagaga tggaaaagga agggaaaatt tcaaaaattg
2701 ggcctgaaaa tccatacaat actccagtat ttgccataaa gaaaaaagac agtactaaat
2761 ggagaaaatt agtagatttc agagaactta ataagagaac tcaagacttc tgggaagttc
2821 aattaggaat accacatccc gcagggttaa aaaagaaaaa atcagtaaca gtactggatg
2881 tgggtgatgc atatttttca gttcccttag atgaagactt caggaagtat actgcattta
2941 ccatacctag tataaacaat gagacaccag ggattagata tcagtacaat gtgcttccac
3001 agggatggaa aggatcacca gcaatattcc aaagtagcat gacaaaaatc ttagagcctt
3061 ttagaaaaca aaatccagac atagttatct atcaatacat ggatgatttg tatgtaggat
3121 ctgacttaga aatagggcag catagaacaa aaatagagga gctgagacaa catctgttga
3181 ggtggggact taccacacca gacaaaaaac atcagaaaga acctccattc ctttggatgg
3241 gttatgaact ccatcctgat aaatggacag tacagcctat agtgctgcca gaaaaagaca
3301 gctggactgt caatgacata cagaagttag tggggaaatt gaattgggca agtcagattt
3361 acccagggat taaagtaagg caattatgta aactccttag aggaaccaaa gcactaacag
3421 aagtaatacc actaacagaa gaagcagagc tagaactggc agaaaacaga gagattctaa
3481 aagaaccagt acatggagtg tattatgacc catcaaaaga cttaatagca gaaatacaga
3541 agcaggggca aggccaatgg acatatcaaa tttatcaaga gccatttaaa aatctgaaaa
3601 caggaaaata tgcaagaatg aggggtgccc acactaatga tgtaaaacaa ttaacagagg
3661 cagtgcaaaa aataaccaca gaaagcatag taatatgggg aaagactcct aaatttaaac
3721 tgcccataca aaaggaaaca tgggaaacat ggtggacaga gtattggcaa gccacctgga
3781 ttcctgagtg ggagtttgtt aatacccctc ccttagtgaa attatggtac cagttagaga
3841 aagaacccat agtaggagca gaaaccttct atgtagatgg ggcagctaac agggagacta
3901 aattaggaaa agcaggatat gttactaata gaggaagaca aaaagttgtc accctaactg
3961 acacaacaaa tcagaagact gagttacaag caatttatct agctttgcag gattcgggat
4021 tagaagtaaa catagtaaca gactcacaat atgcattagg aatcattcaa gcacaaccag
4081 atcaaagtga atcagagtta gtcaatcaaa taatagagca gttaataaaa aaggaaaagg
4141 tctatctggc atgggtacca gcacacaaag gaattggagg aaatgaacaa gtagataaat
4201 tagtcagtgc tggaatcagg aaagtactat ttttagatgg aatagataag gcccaagatg
4261 aacatgagaa atatcacagt aattggagag caatggctag tgattttaac ctgccacctg
4321 tagtagcaaa agaaatagta gccagctgtg ataaatgtca gctaaaagga gaagccatgc
4381 atggacaagt agactgtagt ccaggaatat ggcaactaga ttgtacacat ttagaaggaa
4441 aagttatcct ggtagcagtt catgtagcca gtggatatat agaagcagaa gttattccag
4501 cagaaacagg gcaggaaaca gcatattttc ttttaaaatt agcaggaaga tggccagtaa
4561 aaacaataca tactgacaat ggcagcaatt tcaccggtgc tacggttagg gccgcctgtt
4621 ggtgggcggg aatcaagcag gaatttggaa ttccctacaa tccccaaagt caaggagtag
4681 tagaatctat gaataaagaa ttaaagaaaa ttataggaca ggtaagagat caggctgaac
4741 atcttaagac agcagtacaa atggcagtat tcatccacaa ttttaaaaga aaagggggga
4801 ttggggggta cagtgcaggg gaaagaatag tagacataat agcaacagac atacaaacta
4861 aagaattaca aaaacaaatt acaaaaattc aaaattttcg ggtttattac agggacagca
4921 gaaatccact ttggaaagga ccagcaaagc tcctctggaa aggtgaaggg gcagtagtaa
4981 tacaagataa tagtgacata aaagtagtgc caagaagaaa agcaaagatc attagggatt
5041 atggaaaaca gatggcaggt gatgattgtg tggcaagtag acaggatgag gattagaaca
5101 tggaaaagtt tagtaaaaca ccatatgtat gtttcaggga aagctagggg atggttttat
5161 agacatcact atgaaagccc tcatccaaga ataagttcag aagtacacat cccactaggg
5221 gatgctagat tggtaataac aacatattgg ggtctgcata caggagaaag agactggcat
5281 ttgggtcagg gagtctccat agaatggagg aaaaagagat atagcacaca agtagaccct
5341 gaactagcag accaactaat tcatctgtat tactttgact gtttttcaga ctctgctata
5401 agaaaggcct tattaggaca catagttagc cctaggtgtg aatatcaagc aggacataac
5461 aaggtaggat ctctacaata cttggcacta gcagcattaa taacaccaaa aaagataaag
5521 ccacctttgc ctagtgttac gaaactgaca gaggatagat ggaacaagcc ccagaagacc
5581 aagggccaca gagggagcca cacaatgaat ggacactaga gcttttagag gagcttaaga
5641 atgaagctgt tagacatttt cctaggattt ggctccatgg cttagggcaa catatctatg
5701 aaacttatgg ggatacttgg gcaggagtgg aagccataat aagaattctg caacaactgc
5761 tgtttatcca ttttcagaat tgggtgtcga catagcagaa taggcgttac tcgacagagg
5821 agagcaagaa atggagccag tagatcctag actagagccc tggaagcatc caggaagtca
5881 gcctaaaact gcttgtacca attgctattg taaaaagtgt tgctttcatt gccaagtttg
5941 tttcataaca aaagccttag gcatctccta tggcaggaag aagcggagac agcgacgaag
6001 agctcatcag aacagtcaga ctcatcaagc ttctctatca aagcagtaag tagtacatgt
6061 aacgcaacct ataccaatag tagcaatagt agcattagta gtagcaataa taatagcaat
6121 agttgtgtgg tccatagtaa tcatagaata taggaaaata ttaagacaaa gaaaaataga
6181 caggttaatt gatagactaa tagaaagagc agaagacagt ggcaatgaga gtgaaggaga
6241 aatatcagca cttgtggaga tgggggtgga gatggggcac catgctcctt gggatgttga
6301 tgatctgtag tgctacagaa aaattgtggg tcacagtcta ttatggggta cctgtgtgga
6361 aggaagcaac caccactcta ttttgtgcat cagatgctaa agcatatgat acagaggtac
6421 ataatgtttg ggccacacat gcctgtgtac ccacagaccc caacccacaa gaagtagtat
6481 tggtaaatgt gacagaaaat tttaacatgt ggaaaaatga catggtagaa cagatgcatg
6541 aggatataat cagtttatgg gatcaaagcc taaagccatg tgtaaaatta accccactct
6601 gtgttagttt aaagtgcact gatttgaaga atgatactaa taccaatagt agtagcggga
6661 gaatgataat ggagaaagga gagataaaaa actgctcttt caatatcagc acaagcataa
6721 gaggtaaggt gcagaaagaa tatgcatttt tttataaact tgatataata ccaatagata
6781 atgatactac cagctataag ttgacaagtt gtaacacctc agtcattaca caggcctgtc
6841 caaaggtatc ctttgagcca attcccatac attattgtgc cccggctggt tttgcgattc
6901 taaaatgtaa taataagacg ttcaatggaa caggaccatg tacaaatgtc agcacagtac
6961 aatgtacaca tggaattagg ccagtagtat caactcaact gctgttaaat ggcagtctag
7021 cagaagaaga ggtagtaatt agatctgtca atttcacgga caatgctaaa accataatag
7081 tacagctgaa cacatctgta gaaattaatt gtacaagacc caacaacaat acaagaaaaa
7141 gaatccgtat ccagagagga ccagggagag catttgttac aataggaaaa ataggaaata
7201 tgagacaagc acattgtaac attagtagag caaaatggaa taacacttta aaacagatag
7261 ctagcaaatt aagagaacaa tttggaaata ataaaacaat aatctttaag caatcctcag
7321 gaggggaccc agaaattgta acgcacagtt ttaattgtgg aggggaattt ttctactgta
7381 attcaacaca actgtttaat agtacttggt ttaatagtac ttggagtact gaagggtcaa
7441 ataacactga aggaagtgac acaatcaccc tcccatgcag aataaaacaa attataaaca
7501 tgtggcagaa agtaggaaaa gcaatgtatg cccctcccat cagtggacaa attagatgtt
7561 catcaaatat tacagggctg ctattaacaa gagatggtgg taatagcaac aatgagtccg
7621 agatcttcag acctggagga ggagatatga gggacaattg gagaagtgaa ttatataaat
7681 ataaagtagt aaaaattgaa ccattaggag tagcacccac caaggcaaag agaagagtgg
7741 tgcagagaga aaaaagagca gtgggaatag gagctttgtt ccttgggttc ttgggagcag
7801 caggaagcac tatgggcgca gcctcaatga cgctgacggt acaggccaga caattattgt
7861 ctggtatagt gcagcagcag aacaatttgc tgagggctat tgaggcgcaa cagcatctgt
7921 tgcaactcac agtctggggc atcaagcagc tccaggcaag aatcctggct gtggaaagat
7981 acctaaagga tcaacagctc ctggggattt ggggttgctc tggaaaactc atttgcacca
8041 ctgctgtgcc ttggaatgct agttggagta ataaatctct ggaacagatt tggaatcaca
8101 cgacctggat ggagtgggac agagaaatta acaattacac aagcttaata cactccttaa
8161 ttgaagaatc gcaaaaccag caagaaaaga atgaacaaga attattggaa ttagataaat
8221 gggcaagttt gtggaattgg tttaacataa caaattggct gtggtatata aaattattca
8281 taatgatagt aggaggcttg gtaggtttaa gaatagtttt tgctgtactt tctatagtga
8341 atagagttag gcagggatat tcaccattat cgtttcagac ccacctccca accccgaggg
8401 gacccgacag gcccgaagga atagaagaag aaggtggaga gagagacaga gacagatcca
8461 ttcgattagt gaacggatcc ttggcactta tctgggacga tctgcggagc ctgtgcctct
8521 tcagctacca ccgcttgaga gacttactct tgattgtaac gaggattgtg gaacttctgg
8581 gacgcagggg gtgggaagcc ctcaaatatt ggtggaatct cctacagtat tggagtcagg
8641 aactaaagaa tagtgctgtt agcttgctca atgccacagc catagcagta gctgagggga
8701 cagatagggt tatagaagta gtacaaggag cttgtagagc tattcgccac atacctagaa
8761 gaataagaca gggcttggaa aggattttgc tataagatgg gtggcaagtg gtcaaaaagt
8821 agtgtgattg gatggcctac tgtaagggaa agaatgagac gagctgagcc agcagcagat
8881 agggtgggag cagcatctcg agacctggaa aaacatggag caatcacaag tagcaataca
8941 gcagctacca atgctgcttg tgcctggcta gaagcacaag aggaggagga ggtgggtttt
9001 ccagtcacac ctcaggtacc tttaagacca atgacttaca aggcagctgt agatcttagc
9061 cactttttaa aagaaaaggg gggactggaa gggctaattc actcccaaag aagacaagat
9121 atccttgatc tgtggatcta ccacacacaa ggctacttcc ctgattagca gaactacaca
9181 ccagggccag gggtcagata tccactgacc tttggatggt gctacaagct agtaccagtt
9241 gagccagata agatagaaga ggccaataaa ggagagaaca ccagcttgtt acaccctgtg
9301 agcctgcatg ggatggatga cccggagaga gaagtgttag agtggaggtt tgacagccgc
9361 ctagcatttc atcacgtggc ccgagagctg catccggagt acttcaagaa ctgctgacat
9421 cgagcttgct acaagggact ttccgctggg gactttccag ggaggcgtgg cctgggcggg
9481 actggggagt ggcgagccct cagatcctgc atataagcag ctgctttttg cctgtactgg
9541 gtctctctgg ttagaccaga tctgagcctg ggagctctct ggctaactag ggaacccact
9601 gcttaagcct caataaagct tgccttgagt gcttcaagta gtgtgtgccc gtctgttgtg
9661 tgactctggt aactagagat ccctcagacc cttttagtca gtgtggaaaa tctctagca
//