LOCUS JX290008 552 bp DNA linear VRL 15-SEP-2012 DEFINITION HIV-1 isolate MACS3-LN-3 from USA nef protein (nef) gene, partial cds. ACCESSION JX290008 VERSION JX290008.1 KEYWORDS . SOURCE Human immunodeficiency virus 1 (HIV-1) ORGANISM Human immunodeficiency virus 1 Viruses; Riboviria; Pararnavirae; Artverviricota; Revtraviricetes; Ortervirales; Retroviridae; Orthoretrovirinae; Lentivirus. REFERENCE 1 (bases 1 to 552) AUTHORS Gray,L., Cowley,D., Crespan,E., Welsh,C., Mackenzie,C., Wesselingh,S., Gorry,P. and Churchill,M.J. TITLE Reduced basal transcriptional activity of central nervous system-derived HIV-1 long terminal repeats JOURNAL AIDS Res. Hum. Retroviruses (2012) In press PUBMED 22924643 REMARK Publication Status: Available-Online prior to print REFERENCE 2 (bases 1 to 552) AUTHORS Gray,L.R., Cowley,D., Crespan,E., Welsh,C., Mackenzie,C., Wesselingh,S.L., Gorry,P.R. and Churchill,M.J. TITLE Direct Submission JOURNAL Submitted (08-JUL-2012) Centre for Virology, Burnet Institute, 85 Commercial Road, Melbourne, Victoria 3004, Australia FEATURES Location/Qualifiers source 1..552 /organism="Human immunodeficiency virus 1" /proviral /mol_type="genomic DNA" /isolate="MACS3-LN-3" /host="Homo sapiens" /db_xref="taxon:11676" /country="USA" repeat_region <1..>552 /note="3' long terminal repeat" /rpt_type=long_terminal_repeat gene <1..332 /gene="nef" CDS <1..332 /gene="nef" /codon_start=3 /product="nef protein" /protein_id="AFR45989.1" /translation="EGLIYSKKRQEILDLWVYNTQGYFPDWQNYTPGPGVRYPLTFGW CFKLVPVDPDKVEEATEGENNSLLHPICLHGMEDPEGEVLMWKFDSRLAFHHIAREKH PEYYKNC" BASE COUNT 145 a 135 c 153 g 119 t ORIGIN 1 tggaagggct aatttactcc aagaaaagac aagagatcct tgatctgtgg gtctacaaca 61 cacaaggcta cttccctgat tggcagaact acacaccagg gccaggggtc agatacccac 121 tgacctttgg atggtgcttc aagctagtac cagttgatcc agataaggta gaagaggcca 181 ctgaaggaga gaacaacagc ttgctacacc ctatatgcct gcatgggatg gaggacccag 241 agggagaagt attaatgtgg aagtttgaca gccgcctcgc atttcatcac atagcccgag 301 agaaacatcc ggagtactac aagaactgct gacacagaga ctgttgacaa gggactttcc 361 gctggggact ttccagggga ggtgtggcct gggcgggacc ggggagtggc gagccctcag 421 atgctgcata taagcagctg ctttctgcct gtactgggtc tctcttgtta gaccagatcc 481 gagcccggga gctctctggc taactaggga acccactgct taagcctcaa taaagcttgc 541 cttgagtgct tc //