LOCUS       JX290008                 552 bp    DNA     linear   VRL 15-SEP-2012
DEFINITION  HIV-1 isolate MACS3-LN-3 from USA nef protein (nef) gene, partial
            cds.
ACCESSION   JX290008
VERSION     JX290008.1
KEYWORDS    .
SOURCE      Human immunodeficiency virus 1 (HIV-1)
  ORGANISM  Human immunodeficiency virus 1
            Viruses; Riboviria; Pararnavirae; Artverviricota; Revtraviricetes;
            Ortervirales; Retroviridae; Orthoretrovirinae; Lentivirus.
REFERENCE   1  (bases 1 to 552)
  AUTHORS   Gray,L., Cowley,D., Crespan,E., Welsh,C., Mackenzie,C.,
            Wesselingh,S., Gorry,P. and Churchill,M.J.
  TITLE     Reduced basal transcriptional activity of central nervous
            system-derived HIV-1 long terminal repeats
  JOURNAL   AIDS Res. Hum. Retroviruses (2012) In press
   PUBMED   22924643
  REMARK    Publication Status: Available-Online prior to print
REFERENCE   2  (bases 1 to 552)
  AUTHORS   Gray,L.R., Cowley,D., Crespan,E., Welsh,C., Mackenzie,C.,
            Wesselingh,S.L., Gorry,P.R. and Churchill,M.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-JUL-2012) Centre for Virology, Burnet Institute, 85
            Commercial Road, Melbourne, Victoria 3004, Australia
FEATURES             Location/Qualifiers
     source          1..552
                     /organism="Human immunodeficiency virus 1"
                     /proviral
                     /mol_type="genomic DNA"
                     /isolate="MACS3-LN-3"
                     /host="Homo sapiens"
                     /db_xref="taxon:11676"
                     /country="USA"
     repeat_region   <1..>552
                     /note="3' long terminal repeat"
                     /rpt_type=long_terminal_repeat
     gene            <1..332
                     /gene="nef"
     CDS             <1..332
                     /gene="nef"
                     /codon_start=3
                     /product="nef protein"
                     /protein_id="AFR45989.1"
                     /translation="EGLIYSKKRQEILDLWVYNTQGYFPDWQNYTPGPGVRYPLTFGW
                     CFKLVPVDPDKVEEATEGENNSLLHPICLHGMEDPEGEVLMWKFDSRLAFHHIAREKH
                     PEYYKNC"
BASE COUNT          145 a          135 c          153 g          119 t
ORIGIN      
        1 tggaagggct aatttactcc aagaaaagac aagagatcct tgatctgtgg gtctacaaca
       61 cacaaggcta cttccctgat tggcagaact acacaccagg gccaggggtc agatacccac
      121 tgacctttgg atggtgcttc aagctagtac cagttgatcc agataaggta gaagaggcca
      181 ctgaaggaga gaacaacagc ttgctacacc ctatatgcct gcatgggatg gaggacccag
      241 agggagaagt attaatgtgg aagtttgaca gccgcctcgc atttcatcac atagcccgag
      301 agaaacatcc ggagtactac aagaactgct gacacagaga ctgttgacaa gggactttcc
      361 gctggggact ttccagggga ggtgtggcct gggcgggacc ggggagtggc gagccctcag
      421 atgctgcata taagcagctg ctttctgcct gtactgggtc tctcttgtta gaccagatcc
      481 gagcccggga gctctctggc taactaggga acccactgct taagcctcaa taaagcttgc
      541 cttgagtgct tc
//