LOCUS JX289978 571 bp DNA linear VRL 15-SEP-2012 DEFINITION HIV-1 isolate MACS2-LN-4 from USA nef protein (nef) gene, partial cds. ACCESSION JX289978 VERSION JX289978.1 KEYWORDS . SOURCE Human immunodeficiency virus 1 (HIV-1) ORGANISM Human immunodeficiency virus 1 Viruses; Riboviria; Pararnavirae; Artverviricota; Revtraviricetes; Ortervirales; Retroviridae; Orthoretrovirinae; Lentivirus. REFERENCE 1 (bases 1 to 571) AUTHORS Gray,L., Cowley,D., Crespan,E., Welsh,C., Mackenzie,C., Wesselingh,S., Gorry,P. and Churchill,M.J. TITLE Reduced basal transcriptional activity of central nervous system-derived HIV-1 long terminal repeats JOURNAL AIDS Res. Hum. Retroviruses (2012) In press PUBMED 22924643 REMARK Publication Status: Available-Online prior to print REFERENCE 2 (bases 1 to 571) AUTHORS Gray,L.R., Cowley,D., Crespan,E., Welsh,C., Mackenzie,C., Wesselingh,S.L., Gorry,P.R. and Churchill,M.J. TITLE Direct Submission JOURNAL Submitted (08-JUL-2012) Centre for Virology, Burnet Institute, 85 Commercial Road, Melbourne, Victoria 3004, Australia FEATURES Location/Qualifiers source 1..571 /organism="Human immunodeficiency virus 1" /proviral /mol_type="genomic DNA" /isolate="MACS2-LN-4" /host="Homo sapiens" /db_xref="taxon:11676" /country="USA" repeat_region <1..>571 /note="3' long terminal repeat" /rpt_type=long_terminal_repeat gene <1..332 /gene="nef" CDS <1..332 /gene="nef" /codon_start=3 /product="nef protein" /protein_id="AFR45960.1" /translation="EGLIWSQKRQDILDLWVYHTQGFLPDWQCYTPGPGVRYPLTFGW CFKLVPVEPEKVEEANEGENNCLLHPMGQHGMDDPEKEVLVWKFDIHLAHHHIAREKH PEYFKNC" BASE COUNT 143 a 138 c 163 g 127 t ORIGIN 1 tggaagggct aatttggtcc caaaaaagac aagatatcct tgatctgtgg gtctaccaca 61 cacaaggctt cctccctgat tggcagtgct acacaccagg gccaggggtc agatatccac 121 tgacctttgg gtggtgcttc aagctagtac cagtggagcc agagaaggta gaagaggcca 181 atgaaggaga gaacaactgc ttgttacacc ctatgggcca gcatgggatg gacgacccgg 241 agaaagaagt gttagtgtgg aagtttgaca tccacctagc acatcatcac atagcccgag 301 agaagcatcc ggagtacttt aagaactgtt gacagcctac aagaactgct gacatcgagc 361 tttctacaag ggactttccg ctggggactt tccaggggag gcgtggcctg ggcgggactg 421 gggagtggcg agccctcaga tgctgcatat aagcagctgc tttttgcctg tactgggtct 481 ctctggttag accagatctg agcctgggag ctctccggct gactagggaa cccactgctt 541 aagcctcaat aaagcttgcc ttgagtgctt c //