LOCUS       JX289978                 571 bp    DNA     linear   VRL 15-SEP-2012
DEFINITION  HIV-1 isolate MACS2-LN-4 from USA nef protein (nef) gene, partial
            cds.
ACCESSION   JX289978
VERSION     JX289978.1
KEYWORDS    .
SOURCE      Human immunodeficiency virus 1 (HIV-1)
  ORGANISM  Human immunodeficiency virus 1
            Viruses; Riboviria; Pararnavirae; Artverviricota; Revtraviricetes;
            Ortervirales; Retroviridae; Orthoretrovirinae; Lentivirus.
REFERENCE   1  (bases 1 to 571)
  AUTHORS   Gray,L., Cowley,D., Crespan,E., Welsh,C., Mackenzie,C.,
            Wesselingh,S., Gorry,P. and Churchill,M.J.
  TITLE     Reduced basal transcriptional activity of central nervous
            system-derived HIV-1 long terminal repeats
  JOURNAL   AIDS Res. Hum. Retroviruses (2012) In press
   PUBMED   22924643
  REMARK    Publication Status: Available-Online prior to print
REFERENCE   2  (bases 1 to 571)
  AUTHORS   Gray,L.R., Cowley,D., Crespan,E., Welsh,C., Mackenzie,C.,
            Wesselingh,S.L., Gorry,P.R. and Churchill,M.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-JUL-2012) Centre for Virology, Burnet Institute, 85
            Commercial Road, Melbourne, Victoria 3004, Australia
FEATURES             Location/Qualifiers
     source          1..571
                     /organism="Human immunodeficiency virus 1"
                     /proviral
                     /mol_type="genomic DNA"
                     /isolate="MACS2-LN-4"
                     /host="Homo sapiens"
                     /db_xref="taxon:11676"
                     /country="USA"
     repeat_region   <1..>571
                     /note="3' long terminal repeat"
                     /rpt_type=long_terminal_repeat
     gene            <1..332
                     /gene="nef"
     CDS             <1..332
                     /gene="nef"
                     /codon_start=3
                     /product="nef protein"
                     /protein_id="AFR45960.1"
                     /translation="EGLIWSQKRQDILDLWVYHTQGFLPDWQCYTPGPGVRYPLTFGW
                     CFKLVPVEPEKVEEANEGENNCLLHPMGQHGMDDPEKEVLVWKFDIHLAHHHIAREKH
                     PEYFKNC"
BASE COUNT          143 a          138 c          163 g          127 t
ORIGIN      
        1 tggaagggct aatttggtcc caaaaaagac aagatatcct tgatctgtgg gtctaccaca
       61 cacaaggctt cctccctgat tggcagtgct acacaccagg gccaggggtc agatatccac
      121 tgacctttgg gtggtgcttc aagctagtac cagtggagcc agagaaggta gaagaggcca
      181 atgaaggaga gaacaactgc ttgttacacc ctatgggcca gcatgggatg gacgacccgg
      241 agaaagaagt gttagtgtgg aagtttgaca tccacctagc acatcatcac atagcccgag
      301 agaagcatcc ggagtacttt aagaactgtt gacagcctac aagaactgct gacatcgagc
      361 tttctacaag ggactttccg ctggggactt tccaggggag gcgtggcctg ggcgggactg
      421 gggagtggcg agccctcaga tgctgcatat aagcagctgc tttttgcctg tactgggtct
      481 ctctggttag accagatctg agcctgggag ctctccggct gactagggaa cccactgctt
      541 aagcctcaat aaagcttgcc ttgagtgctt c
//