LOCUS       JN980377                 681 bp    DNA     linear   VRL 12-MAR-2012
DEFINITION  Hepatitis B virus isolate P192 S protein (S) gene, complete cds.
ACCESSION   JN980377
VERSION     JN980377.1
KEYWORDS    .
SOURCE      Hepatitis B virus
  ORGANISM  Hepatitis B virus
            Viruses; Retro-transcribing viruses; Hepadnaviridae;
            Orthohepadnavirus.
REFERENCE   1  (bases 1 to 681)
  AUTHORS   Zhang,X.-X. and Yu,D.-M.
  TITLE     HBsAg sequences from patients coexsitence of HBsAg and anti-HBsAg
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 681)
  AUTHORS   Zhang,X.-X. and Yu,D.-M.
  TITLE     Direct Submission
  JOURNAL   Submitted (01-NOV-2011) Department of Infectious Disease, Ruijin
            Hospital, Shanghai Jiaotong University School of Medicine, 197
            Ruijiner Road, Shnaghai 200025, China
FEATURES             Location/Qualifiers
     source          1..681
                     /organism="Hepatitis B virus"
                     /mol_type="genomic DNA"
                     /serotype="adrq+"
                     /isolate="P192"
                     /host="Homo sapiens"
                     /db_xref="taxon:10407"
                     /country="China"
                     /collection_date="2010"
                     /note="genotype: C"
     gene            1..681
                     /gene="S"
     CDS             1..681
                     /gene="S"
                     /note="HBsAg"
                     /codon_start=1
                     /product="S protein"
                     /protein_id="AFC98708.1"
                     /translation="MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGG
                     APTCPGLNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQG
                     MLPVCPLLPGTSTTSTGPCKTCTIPANGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
                     FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPI
                     FFCLWVYI"
BASE COUNT          133 a          187 c          141 g          220 t
ORIGIN      
        1 atggagagca caacatcagg attcctagga cccctgctcg tgttacaggc ggggtttttc
       61 ttgttgacaa gaatcctcac aataccacag agtctagact cgtggtggac ttctctcaat
      121 tttctagggg gagcacccac gtgtcctggc ctaaattcgc agtccccaac ctccaatcac
      181 tcaccaacct cttgtcctcc aatttgtcct ggctatcgct ggatgtgtct gcggcgtttt
      241 atcatattcc tcttcatcct gctgctatgc ctcatcttct tgttggttct tctggactat
      301 caaggtatgt tgcccgtttg tcctctactt ccaggaacat caactaccag cacgggacca
      361 tgcaagacct gcacgatacc tgccaacgga acctctatgt ttccctcttg ttgctgtaca
      421 aaaccttcgg acggaaactg cacttgtatt cccatcccat catcctgggc tttcgcaaga
      481 ttcctatggg agtgggcctc agtccgtttc tcctggctca gtttactagt gccatttgtt
      541 cagtggttcg tagggctttc ccccactgtt tggctttcag ttatatggat gatgtggtat
      601 tgggggccaa gtctgtacaa catcttgagt ccctttttac ctctattacc aattttcttt
      661 tgtctttggg tatacatttg a
//